--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:02:53 GMT 2020
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=500000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=1250
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=1250
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/8res/ML2176/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -353.81 -356.97
2 -353.78 -358.11
--------------------------------------
TOTAL -353.79 -357.69
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902798 0.096390 0.300389 1.470746 0.880071 613.22 682.11 1.001
r(A<->C){all} 0.160510 0.016336 0.000031 0.410524 0.135244 104.19 121.04 1.004
r(A<->G){all} 0.168778 0.019632 0.000027 0.436942 0.133099 64.73 86.96 1.001
r(A<->T){all} 0.161413 0.020453 0.000179 0.456322 0.121854 66.64 71.93 1.001
r(C<->G){all} 0.176883 0.021012 0.000033 0.484876 0.136256 162.92 166.64 1.013
r(C<->T){all} 0.161531 0.020227 0.000073 0.460411 0.119452 74.53 77.25 1.002
r(G<->T){all} 0.170884 0.019906 0.000083 0.444165 0.135226 20.54 59.57 1.007
pi(A){all} 0.223595 0.000671 0.173323 0.272403 0.222989 631.76 691.38 1.001
pi(C){all} 0.293134 0.000847 0.234124 0.346060 0.291736 618.95 684.98 1.001
pi(G){all} 0.252149 0.000724 0.198689 0.300618 0.252005 624.62 638.24 1.005
pi(T){all} 0.231122 0.000683 0.178899 0.279634 0.230479 506.07 552.28 0.999
alpha{1,2} 0.428932 0.246679 0.000343 1.350393 0.253785 353.67 427.23 1.003
alpha{3} 0.461477 0.234895 0.000308 1.408474 0.297966 417.77 454.54 1.000
pinvar{all} 0.993697 0.000053 0.980174 0.999995 0.995974 588.79 635.01 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -339.845833
Model 2: PositiveSelection -339.845825
Model 0: one-ratio -339.845821
Model 3: discrete -339.845821
Model 7: beta -339.845845
Model 8: beta&w>1 -339.845821
Model 0 vs 1 2.4000000053092663E-5
Model 2 vs 1 1.600000007329072E-5
Model 8 vs 7 4.799999999249849E-5
>C1
VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
>C2
VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
>C3
VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
>C4
VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
>C5
VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
>C6
VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=85
C1 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
C2 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
C3 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
C4 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
C5 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
C6 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
**************************************************
C1 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
C2 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
C3 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
C4 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
C5 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
C6 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
***********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 85 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 85 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2550]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2550]--->[2550]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.450 Mb, Max= 30.607 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
C2 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
C3 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
C4 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
C5 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
C6 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
**************************************************
C1 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
C2 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
C3 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
C4 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
C5 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
C6 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
***********************************
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC
C2 GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC
C3 GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC
C4 GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC
C5 GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC
C6 GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC
**************************************************
C1 AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG
C2 AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG
C3 AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG
C4 AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG
C5 AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG
C6 AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG
**************************************************
C1 GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG
C2 GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG
C3 GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG
C4 GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG
C5 GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG
C6 GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG
**************************************************
C1 GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA
C2 GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA
C3 GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA
C4 GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA
C5 GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA
C6 GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA
**************************************************
C1 TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC
C2 TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC
C3 TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC
C4 TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC
C5 TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC
C6 TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC
**************************************************
C1 AGTCC
C2 AGTCC
C3 AGTCC
C4 AGTCC
C5 AGTCC
C6 AGTCC
*****
>C1
GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC
AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG
GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG
GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA
TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC
AGTCC
>C2
GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC
AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG
GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG
GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA
TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC
AGTCC
>C3
GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC
AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG
GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG
GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA
TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC
AGTCC
>C4
GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC
AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG
GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG
GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA
TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC
AGTCC
>C5
GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC
AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG
GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG
GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA
TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC
AGTCC
>C6
GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC
AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG
GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG
GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA
TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC
AGTCC
>C1
VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
>C2
VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
>C3
VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
>C4
VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
>C5
VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
>C6
VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 255 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856527
Setting output file names to "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 332325396
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 500000
Running Markov chain
MCMC stamp = 5115369853
Seed = 991264899
Swapseed = 1579856527
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -570.702226 -- -24.965149
Chain 2 -- -570.702193 -- -24.965149
Chain 3 -- -570.702226 -- -24.965149
Chain 4 -- -570.702193 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -570.702139 -- -24.965149
Chain 2 -- -570.702226 -- -24.965149
Chain 3 -- -570.702226 -- -24.965149
Chain 4 -- -570.702226 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (500000 generations requested):
0 -- [-570.702] (-570.702) (-570.702) (-570.702) * [-570.702] (-570.702) (-570.702) (-570.702)
500 -- (-361.977) (-360.919) [-359.802] (-365.258) * (-367.961) [-363.601] (-365.931) (-367.239) -- 0:00:00
1000 -- [-357.762] (-367.208) (-360.964) (-369.688) * (-362.508) (-361.647) [-361.169] (-359.706) -- 0:00:00
1500 -- [-361.008] (-361.936) (-365.488) (-355.939) * (-361.988) (-362.949) [-360.852] (-361.541) -- 0:00:00
2000 -- (-358.696) (-360.484) (-362.268) [-362.785] * (-372.581) (-359.076) (-368.281) [-357.791] -- 0:00:00
2500 -- (-364.644) [-361.446] (-361.884) (-368.230) * (-364.687) (-358.821) (-365.230) [-362.048] -- 0:00:00
3000 -- [-360.182] (-357.795) (-364.151) (-371.900) * (-364.860) [-362.115] (-362.955) (-364.121) -- 0:02:45
3500 -- (-364.530) (-365.798) [-361.263] (-364.733) * (-365.367) (-357.358) (-362.673) [-358.136] -- 0:02:21
4000 -- [-363.169] (-366.915) (-369.937) (-358.886) * (-361.086) [-361.789] (-360.393) (-361.458) -- 0:02:04
4500 -- (-363.326) (-358.796) [-366.441] (-361.087) * (-362.717) (-364.505) [-364.245] (-365.947) -- 0:01:50
5000 -- (-361.670) (-366.423) [-357.784] (-370.995) * (-364.341) (-365.018) (-365.719) [-356.329] -- 0:01:39
Average standard deviation of split frequencies: 0.099995
5500 -- (-367.065) (-365.537) [-365.292] (-363.310) * (-373.391) (-362.950) [-359.315] (-376.133) -- 0:01:29
6000 -- (-360.380) [-366.165] (-371.472) (-371.270) * (-363.944) (-367.687) (-361.689) [-371.665] -- 0:01:22
6500 -- (-364.945) [-358.702] (-361.204) (-375.084) * [-358.788] (-362.707) (-364.551) (-367.400) -- 0:01:15
7000 -- [-361.849] (-365.288) (-363.527) (-369.065) * (-359.890) [-359.039] (-369.284) (-367.903) -- 0:01:10
7500 -- (-360.421) [-364.611] (-375.041) (-354.090) * (-365.694) [-358.228] (-359.418) (-365.522) -- 0:01:05
8000 -- (-362.040) [-362.785] (-378.650) (-357.948) * (-360.073) [-362.151] (-366.998) (-369.832) -- 0:01:01
8500 -- (-373.068) [-363.088] (-363.912) (-352.926) * [-362.375] (-367.288) (-365.338) (-364.710) -- 0:00:57
9000 -- [-362.821] (-361.087) (-362.763) (-356.696) * (-359.774) [-356.905] (-366.957) (-361.991) -- 0:00:54
9500 -- [-364.793] (-363.292) (-368.730) (-354.510) * (-366.403) (-363.258) (-362.666) [-358.752] -- 0:00:51
10000 -- (-365.054) (-372.995) [-357.811] (-355.484) * (-360.397) (-364.116) [-362.731] (-378.635) -- 0:00:49
Average standard deviation of split frequencies: 0.069173
10500 -- [-360.088] (-362.977) (-365.485) (-353.761) * (-363.616) [-359.576] (-370.453) (-373.567) -- 0:00:46
11000 -- (-370.878) [-353.240] (-363.539) (-354.723) * (-364.224) [-362.444] (-375.201) (-362.029) -- 0:00:44
11500 -- (-375.980) (-354.053) [-370.337] (-360.231) * [-360.438] (-362.163) (-371.036) (-355.102) -- 0:00:42
12000 -- [-374.589] (-354.567) (-363.096) (-363.867) * (-361.677) (-368.603) (-363.520) [-354.751] -- 0:00:40
12500 -- (-362.982) (-354.292) [-366.328] (-355.527) * [-357.364] (-367.968) (-359.163) (-355.239) -- 0:00:39
13000 -- (-359.105) [-353.278] (-360.011) (-360.730) * (-365.080) (-374.367) [-356.591] (-356.183) -- 0:00:37
13500 -- (-371.601) [-355.005] (-374.452) (-355.971) * [-358.510] (-367.001) (-355.549) (-355.089) -- 0:00:36
14000 -- (-363.179) (-354.856) [-362.346] (-358.010) * (-360.898) (-361.760) (-355.113) [-354.039] -- 0:00:34
14500 -- (-361.715) (-355.510) [-362.627] (-356.155) * (-364.848) [-365.607] (-352.736) (-353.341) -- 0:00:33
15000 -- (-364.997) [-355.061] (-365.834) (-352.799) * (-367.540) (-369.454) (-353.541) [-352.664] -- 0:00:32
Average standard deviation of split frequencies: 0.054274
15500 -- (-356.832) (-354.937) [-364.040] (-353.371) * (-369.091) (-372.800) (-353.036) [-354.419] -- 0:00:31
16000 -- (-364.798) (-354.488) (-373.433) [-356.948] * [-365.291] (-363.372) (-354.732) (-357.507) -- 0:00:30
16500 -- [-365.330] (-352.651) (-365.280) (-353.051) * [-360.502] (-365.013) (-353.903) (-354.075) -- 0:00:29
17000 -- (-366.327) [-352.689] (-373.004) (-353.016) * (-367.310) (-359.291) (-357.590) [-354.326] -- 0:00:28
17500 -- (-362.597) [-353.425] (-356.686) (-356.898) * [-360.540] (-361.887) (-354.295) (-353.444) -- 0:00:27
18000 -- (-366.914) (-356.367) (-353.105) [-355.704] * (-365.656) (-365.118) [-353.911] (-355.091) -- 0:00:26
18500 -- [-362.479] (-359.649) (-359.970) (-352.967) * (-382.429) [-360.356] (-358.087) (-354.462) -- 0:00:26
19000 -- (-358.329) (-356.341) [-356.886] (-356.531) * (-376.604) [-363.943] (-358.978) (-353.200) -- 0:00:50
19500 -- (-358.170) (-353.280) [-355.144] (-355.773) * (-377.157) (-356.650) (-362.665) [-352.313] -- 0:00:49
20000 -- (-360.259) (-353.152) (-354.094) [-353.572] * (-370.246) [-358.256] (-360.954) (-353.956) -- 0:00:48
Average standard deviation of split frequencies: 0.037216
20500 -- (-364.572) [-353.002] (-353.732) (-353.806) * (-363.280) (-361.671) (-360.343) [-355.212] -- 0:00:46
21000 -- (-360.721) [-352.575] (-354.171) (-354.518) * (-355.098) [-361.886] (-359.584) (-356.619) -- 0:00:45
21500 -- (-371.057) [-352.250] (-358.349) (-354.852) * [-352.321] (-359.290) (-359.074) (-353.511) -- 0:00:44
22000 -- (-370.855) (-353.064) (-354.154) [-352.828] * (-357.172) (-370.436) [-353.864] (-355.885) -- 0:00:43
22500 -- (-367.714) (-353.910) (-356.292) [-352.664] * [-355.107] (-364.313) (-352.366) (-354.616) -- 0:00:42
23000 -- (-362.907) [-353.486] (-355.144) (-355.623) * [-353.532] (-363.717) (-353.732) (-355.119) -- 0:00:41
23500 -- [-366.058] (-353.414) (-354.725) (-354.811) * [-356.359] (-367.451) (-353.861) (-356.882) -- 0:00:40
24000 -- (-368.211) [-354.447] (-357.723) (-354.045) * (-356.510) (-360.328) [-353.793] (-354.099) -- 0:00:39
24500 -- [-364.456] (-352.453) (-353.701) (-353.669) * [-353.811] (-364.401) (-354.272) (-354.707) -- 0:00:38
25000 -- (-364.757) (-354.305) [-354.349] (-356.324) * (-354.660) (-364.227) [-353.045] (-353.550) -- 0:00:38
Average standard deviation of split frequencies: 0.040579
25500 -- (-365.536) (-353.745) [-353.864] (-354.924) * (-352.524) (-363.474) [-354.588] (-353.336) -- 0:00:37
26000 -- (-364.251) (-355.759) (-354.352) [-353.689] * (-355.230) [-364.052] (-354.074) (-353.646) -- 0:00:36
26500 -- [-362.027] (-354.377) (-355.002) (-356.819) * (-354.166) (-360.620) [-352.782] (-355.352) -- 0:00:35
27000 -- (-361.673) [-355.741] (-352.967) (-357.081) * (-353.820) (-369.838) (-355.385) [-353.420] -- 0:00:35
27500 -- [-363.300] (-356.839) (-355.259) (-360.557) * (-354.513) [-364.365] (-354.247) (-352.841) -- 0:00:34
28000 -- (-372.705) [-353.380] (-353.698) (-363.305) * (-354.577) [-367.378] (-355.022) (-357.914) -- 0:00:33
28500 -- (-371.276) (-355.680) (-354.020) [-354.982] * (-354.302) (-369.244) [-352.962] (-352.854) -- 0:00:33
29000 -- (-357.873) [-354.055] (-354.144) (-356.061) * (-353.908) (-381.711) (-353.797) [-352.709] -- 0:00:32
29500 -- (-356.674) [-353.519] (-352.377) (-354.860) * (-354.954) (-384.050) (-353.039) [-353.063] -- 0:00:31
30000 -- (-355.057) (-354.350) [-354.860] (-353.884) * [-354.396] (-373.826) (-353.765) (-353.436) -- 0:00:31
Average standard deviation of split frequencies: 0.042879
30500 -- [-353.397] (-354.957) (-354.804) (-352.672) * (-357.766) [-359.126] (-356.830) (-356.307) -- 0:00:30
31000 -- (-353.860) (-353.617) (-357.182) [-361.525] * (-353.984) (-352.324) [-352.685] (-357.174) -- 0:00:30
31500 -- (-353.590) [-353.146] (-353.660) (-360.865) * (-355.712) (-354.884) [-357.645] (-352.806) -- 0:00:29
32000 -- [-353.455] (-353.159) (-352.787) (-352.596) * (-353.180) (-353.325) [-358.935] (-354.106) -- 0:00:29
32500 -- (-352.447) (-353.389) [-352.558] (-357.271) * (-352.214) (-354.913) (-357.624) [-353.362] -- 0:00:28
33000 -- (-352.829) (-356.750) [-354.880] (-353.786) * (-352.909) [-353.732] (-356.155) (-353.132) -- 0:00:28
33500 -- [-354.725] (-358.145) (-357.408) (-354.046) * (-355.601) (-354.543) (-356.292) [-353.092] -- 0:00:27
34000 -- (-352.863) (-357.863) [-356.971] (-354.281) * (-358.092) (-352.950) [-354.796] (-355.936) -- 0:00:27
34500 -- (-354.267) (-356.825) (-355.277) [-353.083] * (-354.376) (-352.894) (-355.054) [-354.179] -- 0:00:26
35000 -- (-357.111) (-354.724) (-354.424) [-354.053] * (-354.185) [-353.256] (-353.113) (-353.324) -- 0:00:39
Average standard deviation of split frequencies: 0.040593
35500 -- (-352.859) (-353.247) [-352.479] (-354.718) * (-353.617) (-353.009) [-354.466] (-353.905) -- 0:00:39
36000 -- [-353.025] (-354.848) (-352.873) (-353.571) * [-355.485] (-352.213) (-353.962) (-352.711) -- 0:00:38
36500 -- (-354.680) (-356.575) [-353.423] (-353.883) * [-354.981] (-355.564) (-355.866) (-354.963) -- 0:00:38
37000 -- (-354.360) (-355.648) (-354.342) [-354.694] * [-353.359] (-357.259) (-352.698) (-357.588) -- 0:00:37
37500 -- (-354.410) [-355.845] (-355.102) (-353.493) * (-352.940) (-355.894) [-355.880] (-355.604) -- 0:00:37
38000 -- (-354.156) (-353.926) (-355.885) [-353.509] * (-354.424) [-354.190] (-356.380) (-355.119) -- 0:00:36
38500 -- (-352.816) (-355.232) (-353.674) [-353.686] * (-354.542) (-355.800) (-353.415) [-354.038] -- 0:00:35
39000 -- (-354.338) (-353.831) (-354.918) [-352.824] * [-353.272] (-355.162) (-352.922) (-352.589) -- 0:00:35
39500 -- (-353.703) [-354.886] (-356.290) (-353.266) * (-355.671) [-355.957] (-352.717) (-353.658) -- 0:00:34
40000 -- [-353.978] (-353.297) (-353.497) (-357.024) * (-353.779) (-352.566) [-352.803] (-352.997) -- 0:00:34
Average standard deviation of split frequencies: 0.028336
40500 -- (-354.129) (-353.252) [-352.839] (-355.916) * (-355.022) [-355.410] (-356.367) (-356.109) -- 0:00:34
41000 -- (-353.017) (-353.463) (-353.976) [-354.149] * (-354.156) (-354.848) (-353.479) [-358.127] -- 0:00:33
41500 -- [-354.072] (-353.158) (-354.064) (-354.894) * (-353.623) [-360.234] (-353.301) (-357.727) -- 0:00:33
42000 -- [-354.098] (-354.198) (-353.911) (-353.833) * [-353.683] (-353.029) (-353.234) (-354.720) -- 0:00:32
42500 -- (-352.785) (-353.697) [-353.596] (-361.450) * (-353.201) [-353.122] (-352.768) (-352.606) -- 0:00:32
43000 -- (-353.565) (-357.690) [-357.185] (-356.309) * (-355.611) (-358.048) (-353.076) [-353.195] -- 0:00:31
43500 -- (-354.240) [-353.921] (-353.136) (-353.220) * (-355.526) (-353.210) [-354.393] (-361.031) -- 0:00:31
44000 -- (-353.082) (-352.973) [-354.091] (-353.486) * (-355.447) [-352.720] (-360.715) (-355.060) -- 0:00:31
44500 -- (-355.005) [-354.249] (-353.019) (-353.598) * (-359.225) (-356.276) (-358.299) [-354.168] -- 0:00:30
45000 -- [-355.720] (-354.558) (-355.578) (-354.669) * (-358.704) (-354.316) (-358.421) [-353.587] -- 0:00:30
Average standard deviation of split frequencies: 0.030231
45500 -- [-353.370] (-354.698) (-355.335) (-354.184) * (-355.691) (-355.349) (-357.573) [-355.582] -- 0:00:29
46000 -- (-352.848) [-353.529] (-352.486) (-356.140) * (-357.820) (-352.377) (-355.012) [-353.325] -- 0:00:29
46500 -- [-352.442] (-354.050) (-352.932) (-357.658) * (-352.970) (-353.694) [-356.842] (-353.393) -- 0:00:29
47000 -- [-352.833] (-357.500) (-356.043) (-358.424) * [-352.802] (-358.389) (-358.017) (-354.791) -- 0:00:28
47500 -- (-352.831) [-353.236] (-359.568) (-354.470) * [-354.629] (-357.637) (-354.009) (-354.142) -- 0:00:28
48000 -- (-353.109) (-353.436) [-353.416] (-353.560) * (-353.597) (-359.074) (-358.414) [-353.731] -- 0:00:28
48500 -- (-353.938) (-355.592) (-364.632) [-354.890] * (-352.674) (-353.404) [-354.808] (-353.324) -- 0:00:27
49000 -- (-355.860) (-353.639) (-353.944) [-353.503] * (-352.668) (-358.597) [-356.369] (-355.472) -- 0:00:27
49500 -- (-355.948) (-356.186) (-354.054) [-355.336] * (-353.517) [-355.119] (-354.886) (-355.417) -- 0:00:27
50000 -- (-354.821) [-354.062] (-355.624) (-360.945) * (-356.043) (-353.988) [-356.112] (-355.195) -- 0:00:27
Average standard deviation of split frequencies: 0.023725
50500 -- (-352.901) (-353.652) (-356.305) [-357.548] * (-352.576) [-359.594] (-354.524) (-354.002) -- 0:00:26
51000 -- (-355.716) [-352.271] (-355.338) (-356.237) * (-353.102) [-353.214] (-353.782) (-357.361) -- 0:00:26
51500 -- (-353.855) (-356.509) (-354.595) [-355.539] * (-352.682) (-352.570) (-354.473) [-358.875] -- 0:00:34
52000 -- [-353.875] (-353.911) (-353.606) (-357.779) * [-353.198] (-355.573) (-353.964) (-353.430) -- 0:00:34
52500 -- (-354.456) [-353.694] (-358.409) (-355.581) * [-353.359] (-361.542) (-355.780) (-355.008) -- 0:00:34
53000 -- (-359.193) [-353.397] (-356.029) (-354.096) * [-353.732] (-361.780) (-354.434) (-355.658) -- 0:00:33
53500 -- (-355.095) (-354.115) (-353.556) [-352.700] * (-357.869) (-355.645) (-353.725) [-355.176] -- 0:00:33
54000 -- (-354.029) [-353.526] (-352.956) (-355.238) * (-361.195) (-354.129) [-356.986] (-354.613) -- 0:00:33
54500 -- (-354.418) (-353.405) [-354.600] (-360.465) * (-360.468) (-354.811) (-356.368) [-352.773] -- 0:00:32
55000 -- (-353.372) [-353.112] (-354.939) (-353.615) * (-354.627) [-353.362] (-353.612) (-353.758) -- 0:00:32
Average standard deviation of split frequencies: 0.024853
55500 -- (-353.465) [-356.025] (-355.043) (-354.899) * (-356.501) (-352.783) [-355.411] (-355.740) -- 0:00:32
56000 -- (-353.279) [-354.976] (-358.814) (-359.804) * (-357.668) (-353.060) (-354.302) [-352.700] -- 0:00:31
56500 -- (-356.540) (-357.158) [-353.270] (-358.244) * (-353.231) (-354.998) [-355.778] (-355.503) -- 0:00:31
57000 -- (-355.842) (-354.606) [-352.868] (-364.426) * [-355.369] (-354.226) (-354.389) (-357.111) -- 0:00:31
57500 -- [-355.651] (-353.071) (-354.964) (-354.618) * (-355.300) (-353.795) [-353.592] (-356.237) -- 0:00:30
58000 -- (-354.733) (-355.255) (-353.682) [-354.790] * (-356.145) [-355.941] (-355.783) (-353.404) -- 0:00:30
58500 -- (-354.717) [-353.046] (-357.492) (-353.057) * (-356.499) [-353.223] (-356.011) (-356.457) -- 0:00:30
59000 -- (-353.548) (-359.406) [-352.895] (-356.991) * (-362.178) (-357.572) (-355.691) [-355.856] -- 0:00:29
59500 -- (-353.589) [-355.085] (-353.710) (-364.840) * (-355.898) (-356.985) [-358.409] (-353.836) -- 0:00:29
60000 -- (-354.228) [-355.293] (-354.713) (-353.215) * (-354.612) (-357.279) (-353.979) [-352.680] -- 0:00:29
Average standard deviation of split frequencies: 0.023681
60500 -- (-355.116) (-353.177) (-358.585) [-352.738] * (-357.276) (-352.829) [-354.085] (-355.636) -- 0:00:29
61000 -- [-353.194] (-354.185) (-357.846) (-355.075) * [-356.660] (-354.227) (-356.712) (-353.392) -- 0:00:28
61500 -- [-352.745] (-357.604) (-354.366) (-355.099) * [-354.978] (-355.798) (-356.012) (-353.018) -- 0:00:28
62000 -- (-352.807) [-352.666] (-354.112) (-355.906) * (-356.781) [-355.250] (-355.520) (-355.063) -- 0:00:28
62500 -- [-357.377] (-355.721) (-353.775) (-358.324) * [-354.473] (-352.336) (-356.176) (-354.538) -- 0:00:28
63000 -- (-356.307) (-352.297) [-353.380] (-353.102) * [-353.106] (-352.671) (-354.367) (-354.788) -- 0:00:27
63500 -- (-352.408) (-353.830) (-355.259) [-356.583] * (-354.861) [-358.594] (-352.980) (-353.069) -- 0:00:27
64000 -- (-354.488) [-353.902] (-352.740) (-357.500) * (-355.048) [-361.246] (-354.582) (-352.973) -- 0:00:27
64500 -- [-354.517] (-352.643) (-354.670) (-356.393) * (-358.343) [-355.967] (-359.964) (-353.860) -- 0:00:27
65000 -- (-353.751) (-355.142) [-354.059] (-355.576) * (-361.164) (-355.397) (-355.350) [-353.671] -- 0:00:26
Average standard deviation of split frequencies: 0.021087
65500 -- [-353.871] (-355.157) (-354.311) (-356.358) * (-353.957) [-356.215] (-355.582) (-357.263) -- 0:00:26
66000 -- [-354.530] (-355.853) (-354.798) (-354.752) * (-352.644) [-353.871] (-354.302) (-355.146) -- 0:00:26
66500 -- (-354.520) (-356.063) [-355.157] (-354.742) * (-355.485) (-353.525) [-354.181] (-356.227) -- 0:00:26
67000 -- (-355.140) (-357.934) [-354.587] (-355.848) * (-355.299) [-358.056] (-354.248) (-355.867) -- 0:00:25
67500 -- (-354.092) (-356.232) (-353.356) [-355.825] * [-353.135] (-355.776) (-354.790) (-356.112) -- 0:00:25
68000 -- (-354.370) (-359.776) [-353.783] (-353.909) * (-353.138) [-355.995] (-354.830) (-357.989) -- 0:00:31
68500 -- (-354.494) (-363.119) (-354.052) [-353.945] * (-353.664) [-352.514] (-353.265) (-354.468) -- 0:00:31
69000 -- (-353.386) [-353.512] (-354.216) (-360.104) * [-353.187] (-355.053) (-358.054) (-355.546) -- 0:00:31
69500 -- (-353.386) (-354.391) [-352.747] (-354.549) * (-355.257) [-353.607] (-354.925) (-356.421) -- 0:00:30
70000 -- (-354.852) (-353.422) (-356.753) [-352.588] * (-356.347) (-353.932) [-352.883] (-352.828) -- 0:00:30
Average standard deviation of split frequencies: 0.023824
70500 -- (-354.463) (-355.296) (-353.807) [-352.591] * [-353.021] (-354.859) (-352.861) (-352.724) -- 0:00:30
71000 -- (-357.339) (-353.428) (-355.251) [-352.718] * [-352.308] (-353.405) (-354.972) (-354.156) -- 0:00:30
71500 -- (-353.814) (-358.020) [-356.044] (-352.800) * (-353.302) [-352.495] (-352.576) (-352.796) -- 0:00:29
72000 -- (-353.137) (-354.252) (-356.351) [-353.746] * (-354.422) (-353.627) [-354.865] (-354.648) -- 0:00:29
72500 -- (-352.633) [-353.366] (-353.290) (-352.673) * (-352.157) (-354.866) [-352.891] (-355.531) -- 0:00:29
73000 -- (-356.678) (-356.132) [-356.600] (-352.552) * (-353.459) (-355.707) (-352.719) [-354.052] -- 0:00:29
73500 -- [-353.643] (-354.013) (-357.066) (-355.998) * (-352.810) (-354.535) [-356.301] (-354.850) -- 0:00:29
74000 -- (-355.215) [-353.857] (-356.723) (-355.891) * [-353.264] (-355.812) (-357.207) (-355.087) -- 0:00:28
74500 -- (-355.711) (-352.397) (-352.979) [-352.622] * (-358.434) [-354.059] (-362.098) (-358.549) -- 0:00:28
75000 -- (-352.979) (-353.923) [-353.379] (-353.559) * (-354.827) (-355.726) (-353.786) [-355.306] -- 0:00:28
Average standard deviation of split frequencies: 0.025431
75500 -- [-353.379] (-355.450) (-354.645) (-354.579) * (-353.565) (-359.547) (-354.119) [-355.993] -- 0:00:28
76000 -- [-353.757] (-354.856) (-353.232) (-355.174) * [-354.880] (-356.554) (-353.437) (-357.972) -- 0:00:27
76500 -- (-354.495) (-356.196) [-353.492] (-354.962) * (-353.076) (-353.682) (-354.404) [-362.585] -- 0:00:27
77000 -- (-354.624) (-353.358) [-354.592] (-355.017) * (-352.324) (-355.533) [-353.222] (-360.262) -- 0:00:27
77500 -- (-356.228) (-352.437) (-352.544) [-354.445] * [-355.570] (-353.182) (-356.361) (-356.258) -- 0:00:27
78000 -- (-352.734) [-352.875] (-355.276) (-353.363) * [-355.352] (-354.608) (-354.244) (-352.188) -- 0:00:27
78500 -- (-355.512) [-354.863] (-357.965) (-357.321) * (-356.576) (-355.643) [-354.242] (-353.525) -- 0:00:26
79000 -- (-354.417) (-353.582) [-356.613] (-353.511) * (-356.214) [-353.165] (-353.655) (-352.555) -- 0:00:26
79500 -- (-356.088) (-353.546) [-357.203] (-354.460) * [-357.975] (-355.711) (-355.704) (-352.931) -- 0:00:26
80000 -- (-352.775) (-353.600) (-354.164) [-353.505] * (-354.376) (-353.320) [-356.449] (-353.463) -- 0:00:26
Average standard deviation of split frequencies: 0.019480
80500 -- [-353.178] (-355.495) (-354.057) (-353.782) * (-353.536) (-354.283) (-353.746) [-355.124] -- 0:00:26
81000 -- (-353.707) (-356.855) [-354.088] (-354.031) * [-352.596] (-355.670) (-356.163) (-353.316) -- 0:00:25
81500 -- (-353.332) (-356.096) (-354.552) [-354.931] * (-356.293) (-352.675) (-357.573) [-353.771] -- 0:00:25
82000 -- [-352.547] (-355.066) (-353.127) (-357.267) * (-353.198) [-354.178] (-359.641) (-355.169) -- 0:00:25
82500 -- (-352.350) (-354.676) (-354.529) [-353.006] * [-353.033] (-355.389) (-358.330) (-352.998) -- 0:00:25
83000 -- (-354.350) (-355.699) (-355.990) [-353.636] * (-353.814) [-355.355] (-353.205) (-353.136) -- 0:00:25
83500 -- (-354.316) (-358.369) [-352.384] (-357.274) * (-354.627) (-355.129) (-353.984) [-353.205] -- 0:00:24
84000 -- [-353.395] (-354.703) (-354.114) (-355.174) * (-353.293) [-354.546] (-354.695) (-353.627) -- 0:00:24
84500 -- (-354.902) (-353.608) (-352.802) [-356.172] * (-353.291) [-355.967] (-354.374) (-356.494) -- 0:00:24
85000 -- (-354.680) [-353.662] (-354.170) (-355.279) * (-355.312) (-357.002) [-352.341] (-356.178) -- 0:00:29
Average standard deviation of split frequencies: 0.017541
85500 -- (-354.846) (-353.756) (-359.015) [-354.738] * (-353.548) (-355.887) (-357.417) [-354.271] -- 0:00:29
86000 -- (-357.864) (-353.773) (-358.106) [-353.206] * [-355.719] (-359.713) (-354.199) (-356.493) -- 0:00:28
86500 -- (-353.968) (-354.444) [-353.164] (-355.625) * (-357.386) (-353.301) (-357.633) [-354.536] -- 0:00:28
87000 -- (-352.720) (-353.510) [-356.367] (-358.915) * (-354.466) (-360.516) [-354.512] (-355.746) -- 0:00:28
87500 -- [-353.983] (-353.871) (-358.983) (-360.107) * (-353.928) [-354.084] (-358.383) (-357.277) -- 0:00:28
88000 -- (-353.952) (-354.283) [-354.152] (-358.164) * [-353.430] (-355.306) (-354.394) (-354.744) -- 0:00:28
88500 -- (-353.101) [-355.772] (-355.022) (-355.826) * (-353.964) (-353.278) [-354.438] (-356.944) -- 0:00:27
89000 -- (-353.488) (-354.361) [-353.649] (-356.532) * [-352.829] (-355.348) (-359.041) (-354.628) -- 0:00:27
89500 -- (-352.764) [-355.580] (-355.513) (-358.211) * (-354.028) (-355.978) (-357.477) [-354.511] -- 0:00:27
90000 -- (-353.164) [-354.735] (-352.754) (-354.754) * (-354.374) (-354.114) [-353.589] (-355.336) -- 0:00:27
Average standard deviation of split frequencies: 0.018061
90500 -- (-352.992) (-358.491) (-353.079) [-352.705] * (-354.337) (-355.705) (-356.826) [-354.302] -- 0:00:27
91000 -- (-354.178) (-358.532) (-356.332) [-354.536] * [-352.622] (-355.034) (-355.097) (-353.368) -- 0:00:26
91500 -- (-354.317) (-353.506) [-353.490] (-353.539) * (-354.818) [-355.157] (-354.263) (-353.017) -- 0:00:26
92000 -- (-355.113) [-354.384] (-358.350) (-354.536) * (-353.347) (-354.837) [-354.014] (-352.833) -- 0:00:26
92500 -- (-357.703) (-352.872) (-354.917) [-354.163] * (-355.185) (-355.507) (-355.148) [-353.842] -- 0:00:26
93000 -- (-355.229) (-353.416) [-352.239] (-354.767) * [-353.881] (-352.850) (-364.430) (-354.136) -- 0:00:26
93500 -- (-353.032) [-353.739] (-353.865) (-357.151) * (-354.354) [-352.645] (-353.750) (-352.694) -- 0:00:26
94000 -- (-354.559) [-352.739] (-354.831) (-358.128) * (-357.299) [-356.447] (-353.644) (-359.134) -- 0:00:25
94500 -- (-353.255) (-354.158) (-357.477) [-352.431] * (-356.770) [-354.871] (-355.496) (-356.950) -- 0:00:25
95000 -- [-353.532] (-353.227) (-356.749) (-356.497) * (-354.172) (-354.925) [-354.999] (-356.288) -- 0:00:25
Average standard deviation of split frequencies: 0.018905
95500 -- [-353.194] (-355.614) (-353.963) (-356.157) * (-353.429) (-354.207) (-355.172) [-353.571] -- 0:00:25
96000 -- [-354.473] (-354.120) (-353.866) (-357.579) * [-355.492] (-353.512) (-354.374) (-355.531) -- 0:00:25
96500 -- [-353.185] (-354.293) (-354.679) (-355.936) * [-354.129] (-359.274) (-353.857) (-355.411) -- 0:00:25
97000 -- (-354.579) (-357.576) (-354.644) [-352.986] * (-355.669) (-358.985) [-353.539] (-356.170) -- 0:00:24
97500 -- (-357.476) (-353.441) (-356.922) [-353.472] * (-355.947) (-356.385) (-352.843) [-357.233] -- 0:00:24
98000 -- (-358.373) [-354.122] (-354.196) (-353.962) * (-357.251) (-359.392) [-356.675] (-354.167) -- 0:00:24
98500 -- (-354.956) [-352.746] (-355.119) (-353.729) * (-358.238) [-354.444] (-352.617) (-353.462) -- 0:00:24
99000 -- (-353.094) (-355.750) (-353.249) [-354.298] * (-353.406) (-353.150) (-354.285) [-355.143] -- 0:00:24
99500 -- (-352.391) (-353.684) (-355.131) [-356.322] * (-354.741) (-355.712) [-353.238] (-354.787) -- 0:00:24
100000 -- [-354.010] (-363.604) (-353.388) (-354.461) * (-352.946) (-353.334) [-353.781] (-353.298) -- 0:00:24
Average standard deviation of split frequencies: 0.018497
100500 -- (-357.335) (-357.143) [-354.865] (-354.608) * [-354.145] (-355.966) (-354.424) (-352.530) -- 0:00:23
101000 -- (-352.311) (-353.256) [-354.018] (-354.323) * (-354.503) (-353.757) (-353.769) [-355.040] -- 0:00:27
101500 -- [-353.212] (-354.632) (-355.952) (-354.989) * (-357.630) (-354.347) [-354.056] (-354.244) -- 0:00:27
102000 -- (-354.518) (-354.060) [-353.256] (-357.064) * (-355.275) (-356.796) [-356.297] (-353.701) -- 0:00:27
102500 -- (-353.684) [-355.963] (-355.713) (-352.757) * (-355.998) [-353.586] (-354.211) (-354.765) -- 0:00:27
103000 -- [-359.103] (-354.913) (-355.666) (-358.991) * (-353.664) (-354.356) [-354.905] (-356.393) -- 0:00:26
103500 -- [-354.603] (-355.466) (-357.396) (-356.872) * (-354.233) (-354.949) [-354.437] (-357.142) -- 0:00:26
104000 -- (-357.080) [-354.396] (-356.391) (-355.037) * (-353.896) (-354.554) [-352.286] (-354.307) -- 0:00:26
104500 -- (-355.013) [-357.167] (-356.900) (-353.350) * (-355.649) (-354.572) [-353.769] (-353.076) -- 0:00:26
105000 -- (-354.245) (-354.756) (-355.041) [-353.659] * [-354.947] (-357.489) (-354.226) (-353.387) -- 0:00:26
Average standard deviation of split frequencies: 0.019790
105500 -- [-355.864] (-357.761) (-356.014) (-358.297) * (-355.467) [-352.933] (-353.554) (-352.160) -- 0:00:26
106000 -- (-352.281) [-353.840] (-354.581) (-354.216) * (-356.032) [-353.235] (-353.909) (-352.997) -- 0:00:26
106500 -- [-353.289] (-356.102) (-355.216) (-353.420) * (-354.233) (-353.596) [-353.383] (-355.820) -- 0:00:25
107000 -- (-358.272) [-355.898] (-354.930) (-356.515) * (-358.910) (-353.399) [-352.489] (-357.200) -- 0:00:25
107500 -- (-352.874) [-352.557] (-355.480) (-355.710) * (-354.801) (-357.285) [-354.818] (-360.713) -- 0:00:25
108000 -- [-353.618] (-352.226) (-356.781) (-352.883) * (-352.826) [-353.129] (-353.818) (-353.303) -- 0:00:25
108500 -- (-354.740) [-353.312] (-354.456) (-352.953) * (-353.271) (-355.051) [-354.834] (-360.786) -- 0:00:25
109000 -- [-355.394] (-352.729) (-354.350) (-354.803) * (-355.551) (-357.483) [-355.588] (-359.208) -- 0:00:25
109500 -- [-352.843] (-354.250) (-355.238) (-354.601) * (-353.595) (-355.414) [-356.165] (-354.443) -- 0:00:24
110000 -- (-354.340) (-353.999) (-357.998) [-355.201] * (-357.469) (-355.129) [-354.665] (-358.625) -- 0:00:24
Average standard deviation of split frequencies: 0.019808
110500 -- (-355.019) (-355.007) (-355.749) [-353.218] * [-354.438] (-352.652) (-357.167) (-354.225) -- 0:00:24
111000 -- (-353.762) [-355.152] (-355.905) (-354.166) * (-355.384) (-353.176) [-354.829] (-353.842) -- 0:00:24
111500 -- [-355.933] (-360.751) (-356.959) (-355.625) * (-353.471) (-353.088) [-353.603] (-357.331) -- 0:00:24
112000 -- (-356.919) [-353.766] (-354.106) (-354.428) * (-356.866) (-352.714) [-354.091] (-360.227) -- 0:00:24
112500 -- (-354.091) (-352.709) (-353.646) [-352.787] * (-355.904) [-353.985] (-354.410) (-358.709) -- 0:00:24
113000 -- (-352.509) [-353.302] (-354.825) (-353.549) * (-353.492) [-353.509] (-356.677) (-353.807) -- 0:00:23
113500 -- [-353.646] (-352.929) (-353.038) (-360.532) * (-355.045) (-354.128) [-354.741] (-358.643) -- 0:00:23
114000 -- (-360.878) (-354.235) [-354.174] (-357.161) * (-356.274) [-353.324] (-353.832) (-360.491) -- 0:00:23
114500 -- (-358.314) (-353.958) [-355.834] (-353.836) * (-356.931) (-353.481) [-355.771] (-359.169) -- 0:00:23
115000 -- [-357.675] (-354.183) (-356.397) (-355.578) * (-354.093) (-354.244) [-353.313] (-353.439) -- 0:00:23
Average standard deviation of split frequencies: 0.017539
115500 -- (-353.544) (-356.559) (-353.416) [-353.704] * (-353.344) [-353.774] (-353.908) (-353.886) -- 0:00:23
116000 -- (-353.084) (-356.914) (-357.748) [-353.814] * (-358.102) [-356.339] (-354.527) (-356.226) -- 0:00:23
116500 -- (-353.730) [-354.907] (-352.447) (-353.431) * (-356.673) (-353.108) (-358.704) [-353.057] -- 0:00:23
117000 -- (-356.213) (-354.656) (-355.115) [-354.050] * (-355.768) (-354.231) [-357.227] (-354.755) -- 0:00:22
117500 -- (-356.468) [-354.246] (-359.908) (-354.108) * [-353.963] (-363.813) (-354.313) (-354.060) -- 0:00:26
118000 -- (-354.329) [-353.558] (-356.384) (-360.725) * (-355.781) (-354.258) (-354.015) [-354.210] -- 0:00:25
118500 -- (-356.747) (-352.679) (-355.869) [-358.822] * (-356.780) (-353.504) (-355.436) [-353.687] -- 0:00:25
119000 -- (-355.952) (-355.556) (-356.887) [-353.047] * (-355.469) [-358.715] (-354.322) (-354.602) -- 0:00:25
119500 -- [-352.915] (-352.784) (-355.451) (-353.109) * (-353.928) [-352.705] (-354.441) (-354.307) -- 0:00:25
120000 -- (-356.234) (-355.302) [-353.999] (-353.014) * [-355.018] (-352.687) (-354.998) (-354.339) -- 0:00:25
Average standard deviation of split frequencies: 0.019967
120500 -- [-353.396] (-354.681) (-356.013) (-354.851) * (-353.383) (-354.588) (-355.143) [-353.564] -- 0:00:25
121000 -- [-353.153] (-354.187) (-359.724) (-353.474) * [-355.511] (-357.577) (-361.895) (-354.388) -- 0:00:25
121500 -- (-354.490) (-353.460) [-355.520] (-355.108) * (-355.652) (-359.304) (-353.310) [-354.354] -- 0:00:24
122000 -- (-355.851) [-355.345] (-359.383) (-356.608) * (-359.081) [-356.705] (-353.738) (-358.997) -- 0:00:24
122500 -- (-352.927) (-354.944) (-353.197) [-355.825] * [-352.737] (-356.618) (-355.941) (-353.203) -- 0:00:24
123000 -- (-353.497) [-352.765] (-353.424) (-355.414) * [-355.773] (-356.202) (-357.209) (-355.897) -- 0:00:24
123500 -- (-358.363) (-356.323) [-352.997] (-353.030) * [-355.371] (-354.197) (-354.190) (-356.673) -- 0:00:24
124000 -- (-353.469) [-355.262] (-356.620) (-358.097) * (-354.539) (-354.652) [-353.584] (-354.506) -- 0:00:24
124500 -- (-356.608) (-353.349) (-355.562) [-353.000] * (-354.838) [-354.331] (-354.779) (-355.146) -- 0:00:24
125000 -- (-353.007) (-352.898) [-354.942] (-352.954) * (-355.502) (-355.325) [-352.957] (-354.635) -- 0:00:24
Average standard deviation of split frequencies: 0.018528
125500 -- (-357.195) [-352.724] (-354.226) (-353.478) * (-352.802) (-356.257) (-352.445) [-353.154] -- 0:00:23
126000 -- (-354.810) (-354.888) [-353.564] (-355.306) * (-353.329) (-353.427) (-353.007) [-355.530] -- 0:00:23
126500 -- (-352.339) (-356.097) (-354.809) [-353.866] * (-356.542) [-354.357] (-353.870) (-353.427) -- 0:00:23
127000 -- (-354.293) [-353.340] (-354.559) (-354.777) * [-353.719] (-355.084) (-353.063) (-353.844) -- 0:00:23
127500 -- (-354.394) [-352.738] (-353.957) (-353.881) * (-353.296) (-353.695) (-354.914) [-355.778] -- 0:00:23
128000 -- (-356.338) [-354.403] (-355.539) (-356.669) * (-354.469) [-353.005] (-357.942) (-354.739) -- 0:00:23
128500 -- [-353.630] (-355.196) (-357.575) (-355.228) * [-354.488] (-353.337) (-355.782) (-355.581) -- 0:00:23
129000 -- (-354.462) (-353.881) (-353.564) [-355.046] * (-352.582) (-353.172) (-354.289) [-354.526] -- 0:00:23
129500 -- (-356.421) [-352.641] (-356.327) (-357.135) * [-354.737] (-352.573) (-355.508) (-355.053) -- 0:00:22
130000 -- [-355.480] (-355.883) (-353.016) (-354.961) * (-357.479) (-352.936) [-353.574] (-355.682) -- 0:00:22
Average standard deviation of split frequencies: 0.018760
130500 -- (-358.257) (-354.564) (-354.712) [-353.617] * (-354.925) [-355.935] (-354.989) (-356.123) -- 0:00:22
131000 -- [-356.232] (-353.177) (-358.294) (-353.651) * [-355.773] (-359.165) (-353.380) (-354.157) -- 0:00:22
131500 -- (-356.418) (-356.333) [-357.981] (-354.090) * (-354.984) (-360.401) (-353.184) [-353.409] -- 0:00:22
132000 -- (-356.477) [-359.146] (-354.237) (-358.048) * [-354.984] (-353.824) (-353.341) (-354.341) -- 0:00:22
132500 -- (-352.796) (-356.919) (-356.489) [-358.699] * (-353.915) (-352.969) [-353.144] (-353.192) -- 0:00:22
133000 -- [-354.541] (-354.906) (-355.147) (-352.802) * (-355.399) (-353.133) (-356.322) [-354.424] -- 0:00:22
133500 -- [-354.905] (-354.916) (-352.292) (-352.559) * (-357.961) [-354.034] (-355.951) (-353.951) -- 0:00:21
134000 -- (-353.902) (-352.319) [-355.241] (-352.947) * [-353.810] (-353.818) (-353.414) (-354.937) -- 0:00:21
134500 -- (-356.432) [-356.285] (-356.107) (-357.397) * [-354.658] (-353.782) (-353.254) (-356.406) -- 0:00:24
135000 -- (-360.012) (-358.947) [-353.767] (-355.612) * (-353.697) (-355.507) [-357.317] (-352.654) -- 0:00:24
Average standard deviation of split frequencies: 0.022357
135500 -- [-355.946] (-357.146) (-353.043) (-356.386) * [-353.339] (-355.530) (-354.417) (-359.751) -- 0:00:24
136000 -- [-355.314] (-353.788) (-363.483) (-357.422) * (-357.331) (-354.535) [-354.280] (-356.411) -- 0:00:24
136500 -- (-353.835) [-353.019] (-356.654) (-358.747) * (-353.697) (-356.287) [-356.510] (-353.143) -- 0:00:23
137000 -- (-358.857) (-354.284) (-354.497) [-353.849] * (-357.797) [-353.855] (-356.420) (-353.594) -- 0:00:23
137500 -- [-355.441] (-352.727) (-357.275) (-357.918) * (-353.615) [-352.502] (-356.377) (-356.928) -- 0:00:23
138000 -- (-358.744) (-353.387) (-354.124) [-356.079] * (-362.727) (-353.318) (-356.453) [-361.064] -- 0:00:23
138500 -- [-361.913] (-354.864) (-358.294) (-354.324) * (-358.848) [-357.308] (-357.175) (-355.921) -- 0:00:23
139000 -- [-353.046] (-353.997) (-356.958) (-353.997) * (-354.190) (-354.834) (-354.141) [-352.461] -- 0:00:23
139500 -- (-359.823) (-352.800) [-354.348] (-356.334) * (-352.452) (-353.240) [-353.145] (-357.738) -- 0:00:23
140000 -- [-358.183] (-354.188) (-353.220) (-356.189) * [-353.093] (-353.399) (-352.691) (-358.149) -- 0:00:23
Average standard deviation of split frequencies: 0.020813
140500 -- (-353.414) [-354.004] (-357.957) (-355.059) * (-353.932) (-357.674) [-355.091] (-356.374) -- 0:00:23
141000 -- (-355.128) (-354.212) (-356.093) [-352.577] * (-356.003) (-353.754) (-355.094) [-356.264] -- 0:00:22
141500 -- (-354.042) (-354.320) (-353.716) [-355.054] * (-353.546) [-355.204] (-355.296) (-352.887) -- 0:00:22
142000 -- (-353.150) (-353.970) (-355.487) [-354.590] * (-354.457) (-357.953) [-356.427] (-357.715) -- 0:00:22
142500 -- (-356.481) [-353.182] (-355.973) (-356.396) * (-354.159) (-352.685) [-353.856] (-353.727) -- 0:00:22
143000 -- (-357.357) [-354.722] (-353.727) (-356.908) * (-355.536) (-353.703) [-353.692] (-353.041) -- 0:00:22
143500 -- (-358.307) (-353.801) (-353.447) [-355.370] * [-356.951] (-358.550) (-353.839) (-354.398) -- 0:00:22
144000 -- [-355.773] (-355.711) (-353.451) (-355.999) * (-353.635) (-352.813) (-355.851) [-354.180] -- 0:00:22
144500 -- (-357.575) (-353.277) (-354.691) [-354.776] * [-352.184] (-356.529) (-355.111) (-353.930) -- 0:00:22
145000 -- (-355.094) (-356.416) (-353.297) [-358.934] * [-353.597] (-354.288) (-353.962) (-353.542) -- 0:00:22
Average standard deviation of split frequencies: 0.018671
145500 -- (-355.127) (-353.596) [-355.686] (-353.949) * (-353.073) (-352.166) [-353.800] (-353.870) -- 0:00:21
146000 -- [-355.912] (-356.989) (-359.150) (-353.069) * (-353.323) (-354.898) [-354.702] (-354.891) -- 0:00:21
146500 -- [-355.656] (-355.014) (-354.392) (-353.914) * [-356.036] (-355.486) (-357.036) (-354.771) -- 0:00:21
147000 -- (-353.167) (-353.010) (-352.861) [-353.250] * [-357.749] (-355.539) (-357.596) (-354.244) -- 0:00:21
147500 -- [-354.298] (-352.752) (-356.877) (-352.823) * (-357.522) (-355.316) (-353.513) [-353.662] -- 0:00:21
148000 -- [-353.189] (-356.748) (-354.219) (-353.709) * (-353.226) [-352.954] (-357.151) (-355.101) -- 0:00:21
148500 -- (-356.394) [-356.607] (-353.690) (-355.560) * (-354.006) [-352.826] (-353.366) (-353.029) -- 0:00:21
149000 -- (-354.101) (-354.046) (-355.197) [-353.803] * [-354.730] (-354.143) (-353.155) (-353.895) -- 0:00:21
149500 -- (-353.782) [-354.599] (-355.172) (-355.360) * [-353.715] (-358.395) (-355.082) (-354.155) -- 0:00:21
150000 -- (-355.180) [-354.093] (-354.514) (-353.051) * [-352.502] (-355.631) (-354.172) (-353.225) -- 0:00:21
Average standard deviation of split frequencies: 0.021759
150500 -- [-353.292] (-357.209) (-353.898) (-352.479) * [-353.555] (-353.164) (-354.526) (-355.770) -- 0:00:20
151000 -- (-355.779) (-353.438) (-360.431) [-353.411] * (-358.852) (-354.028) (-357.196) [-359.040] -- 0:00:20
151500 -- (-352.880) (-354.077) [-352.151] (-352.887) * (-355.241) (-355.357) (-355.605) [-355.418] -- 0:00:23
152000 -- (-352.683) (-353.444) [-352.757] (-356.895) * (-355.474) [-353.222] (-354.763) (-353.583) -- 0:00:22
152500 -- (-357.665) [-353.921] (-353.609) (-355.611) * (-353.869) (-353.545) [-354.769] (-357.949) -- 0:00:22
153000 -- [-354.407] (-353.517) (-355.120) (-354.153) * (-359.073) (-357.381) (-353.701) [-354.749] -- 0:00:22
153500 -- (-354.523) [-353.845] (-357.960) (-355.442) * (-356.299) (-354.672) (-352.388) [-354.949] -- 0:00:22
154000 -- (-357.531) [-358.053] (-354.783) (-354.558) * (-353.444) (-354.340) [-352.807] (-354.742) -- 0:00:22
154500 -- (-352.246) (-355.144) [-352.676] (-353.399) * (-353.822) (-355.425) [-354.497] (-354.523) -- 0:00:22
155000 -- [-352.714] (-354.207) (-355.027) (-354.592) * (-354.012) (-355.135) (-355.258) [-353.091] -- 0:00:22
Average standard deviation of split frequencies: 0.022664
155500 -- [-354.956] (-353.065) (-355.378) (-352.898) * [-355.826] (-353.379) (-354.127) (-355.476) -- 0:00:22
156000 -- [-354.746] (-354.243) (-353.403) (-357.006) * [-356.539] (-354.694) (-356.670) (-354.112) -- 0:00:22
156500 -- [-354.919] (-357.215) (-356.071) (-355.431) * [-353.410] (-355.083) (-359.365) (-352.207) -- 0:00:21
157000 -- (-354.212) (-356.650) (-353.485) [-354.844] * [-353.708] (-358.301) (-356.425) (-353.111) -- 0:00:21
157500 -- (-354.732) (-358.054) (-353.072) [-353.755] * [-354.047] (-357.042) (-359.212) (-356.037) -- 0:00:21
158000 -- (-354.272) [-360.337] (-355.298) (-353.086) * [-352.948] (-354.022) (-354.162) (-355.539) -- 0:00:21
158500 -- (-354.122) (-358.927) (-354.277) [-354.245] * (-355.046) (-353.572) [-353.030] (-353.541) -- 0:00:21
159000 -- [-354.484] (-357.100) (-357.105) (-352.934) * (-353.227) (-354.135) (-354.563) [-354.397] -- 0:00:21
159500 -- [-354.650] (-357.553) (-354.461) (-353.040) * (-353.118) (-352.493) (-355.036) [-353.209] -- 0:00:21
160000 -- (-355.365) (-358.244) (-357.186) [-355.574] * (-354.243) (-353.369) (-353.261) [-353.334] -- 0:00:21
Average standard deviation of split frequencies: 0.023339
160500 -- (-352.985) (-354.833) (-356.087) [-359.429] * (-355.149) [-352.422] (-352.779) (-355.482) -- 0:00:21
161000 -- [-353.411] (-354.357) (-358.020) (-354.872) * [-353.152] (-355.485) (-354.253) (-354.589) -- 0:00:21
161500 -- [-354.544] (-355.376) (-355.272) (-354.035) * (-355.822) (-356.892) (-358.401) [-356.372] -- 0:00:20
162000 -- (-354.632) (-353.934) (-355.138) [-353.258] * (-353.184) (-356.305) (-356.202) [-353.586] -- 0:00:20
162500 -- (-356.464) (-353.722) (-353.644) [-353.115] * (-352.927) (-354.563) [-352.765] (-354.522) -- 0:00:20
163000 -- (-355.691) (-358.589) [-352.975] (-353.810) * (-356.843) (-354.562) (-357.020) [-352.525] -- 0:00:20
163500 -- [-353.170] (-356.486) (-353.883) (-352.894) * (-360.062) (-353.065) (-354.061) [-354.414] -- 0:00:20
164000 -- [-352.404] (-356.630) (-355.745) (-353.614) * (-356.117) (-353.926) [-353.154] (-359.279) -- 0:00:20
164500 -- (-353.755) [-353.520] (-352.462) (-354.187) * (-354.704) (-355.447) (-355.559) [-352.823] -- 0:00:20
165000 -- [-353.200] (-358.437) (-352.972) (-352.635) * (-354.423) (-353.544) [-354.002] (-355.364) -- 0:00:20
Average standard deviation of split frequencies: 0.022989
165500 -- (-355.547) (-355.105) (-352.553) [-353.892] * (-353.567) (-353.878) [-354.859] (-353.338) -- 0:00:20
166000 -- (-354.066) (-356.801) (-353.594) [-355.616] * (-353.118) (-353.736) (-356.766) [-353.284] -- 0:00:20
166500 -- (-352.826) (-352.715) [-354.232] (-355.937) * (-355.914) (-356.068) [-357.312] (-353.593) -- 0:00:20
167000 -- (-353.682) (-353.442) (-355.700) [-355.312] * [-357.893] (-354.499) (-365.443) (-356.749) -- 0:00:19
167500 -- (-353.616) (-353.618) [-354.617] (-355.778) * (-352.879) (-357.416) [-353.476] (-352.695) -- 0:00:19
168000 -- (-354.008) [-354.190] (-355.343) (-356.388) * [-352.601] (-352.667) (-352.244) (-353.782) -- 0:00:19
168500 -- (-354.684) [-352.706] (-359.285) (-357.112) * (-353.461) (-354.625) (-354.034) [-354.046] -- 0:00:21
169000 -- (-353.595) (-354.625) [-354.793] (-353.841) * (-354.467) [-355.451] (-357.895) (-355.569) -- 0:00:21
169500 -- (-353.418) [-353.547] (-355.471) (-355.147) * (-355.596) (-354.799) (-355.231) [-354.819] -- 0:00:21
170000 -- (-353.919) [-356.599] (-357.160) (-355.287) * (-353.542) [-352.633] (-358.334) (-353.674) -- 0:00:21
Average standard deviation of split frequencies: 0.023018
170500 -- (-352.757) (-354.603) (-354.677) [-354.466] * (-353.510) [-354.741] (-354.418) (-356.100) -- 0:00:21
171000 -- [-352.958] (-357.018) (-355.059) (-357.824) * (-354.940) (-356.880) [-352.861] (-353.671) -- 0:00:21
171500 -- [-354.120] (-366.234) (-354.042) (-355.217) * (-353.664) (-354.160) (-353.060) [-353.114] -- 0:00:21
172000 -- [-353.517] (-358.750) (-354.964) (-354.869) * [-355.712] (-354.702) (-354.646) (-354.315) -- 0:00:20
172500 -- (-354.166) [-354.387] (-353.283) (-353.313) * [-358.157] (-356.492) (-356.695) (-356.931) -- 0:00:20
173000 -- (-354.714) [-353.536] (-356.849) (-356.933) * [-355.446] (-353.645) (-355.274) (-355.008) -- 0:00:20
173500 -- (-353.713) (-353.645) (-354.450) [-355.050] * (-354.052) [-354.068] (-357.119) (-354.375) -- 0:00:20
174000 -- (-358.653) (-352.517) (-353.782) [-357.256] * (-357.562) (-356.714) [-354.285] (-354.468) -- 0:00:20
174500 -- (-355.226) (-355.544) (-352.949) [-354.883] * (-354.103) [-358.710] (-353.417) (-354.825) -- 0:00:20
175000 -- (-353.761) (-353.342) [-354.826] (-354.592) * [-353.945] (-354.127) (-354.547) (-356.426) -- 0:00:20
Average standard deviation of split frequencies: 0.023213
175500 -- (-353.344) (-353.808) [-354.201] (-352.663) * (-354.429) [-354.261] (-354.742) (-352.745) -- 0:00:20
176000 -- [-354.680] (-352.593) (-354.470) (-353.121) * (-353.775) [-355.545] (-352.290) (-353.616) -- 0:00:20
176500 -- (-353.984) [-354.518] (-356.284) (-353.867) * [-353.281] (-352.535) (-355.413) (-355.837) -- 0:00:20
177000 -- (-355.095) [-353.858] (-352.627) (-352.828) * (-354.070) (-354.390) [-356.425] (-358.040) -- 0:00:20
177500 -- (-353.275) (-354.531) (-353.372) [-353.839] * (-356.918) [-357.229] (-353.374) (-354.659) -- 0:00:19
178000 -- (-353.803) (-353.180) (-357.764) [-353.508] * (-353.632) (-355.736) (-355.707) [-357.365] -- 0:00:19
178500 -- (-353.884) [-356.131] (-353.875) (-352.657) * [-354.352] (-353.563) (-355.103) (-353.738) -- 0:00:19
179000 -- [-353.986] (-359.462) (-353.213) (-353.261) * (-353.647) [-352.478] (-357.350) (-353.811) -- 0:00:19
179500 -- (-353.048) (-354.891) (-356.046) [-355.785] * (-354.484) [-353.266] (-357.430) (-355.298) -- 0:00:19
180000 -- (-355.796) (-355.313) [-357.081] (-353.076) * (-352.552) (-354.027) (-358.934) [-353.125] -- 0:00:19
Average standard deviation of split frequencies: 0.021657
180500 -- (-355.347) (-354.427) (-356.330) [-357.336] * (-354.936) (-353.236) [-356.576] (-353.755) -- 0:00:19
181000 -- (-355.169) (-355.344) [-352.775] (-356.003) * (-353.726) (-354.981) (-353.743) [-353.027] -- 0:00:19
181500 -- (-353.466) [-352.731] (-355.272) (-353.026) * (-356.704) (-353.972) (-352.950) [-352.433] -- 0:00:19
182000 -- (-356.013) (-353.657) (-357.304) [-355.289] * (-355.814) (-355.511) (-353.539) [-354.845] -- 0:00:19
182500 -- (-353.942) [-354.642] (-358.437) (-353.156) * (-353.640) (-358.085) [-354.265] (-355.394) -- 0:00:19
183000 -- (-353.133) (-353.183) (-359.127) [-352.478] * (-360.076) (-355.365) [-353.417] (-354.402) -- 0:00:19
183500 -- (-353.704) (-352.919) (-354.219) [-353.974] * (-359.499) (-355.580) [-354.792] (-353.559) -- 0:00:18
184000 -- (-353.747) (-352.547) [-354.180] (-353.416) * [-358.327] (-355.777) (-352.689) (-353.110) -- 0:00:18
184500 -- [-358.261] (-352.339) (-355.434) (-354.236) * (-353.929) [-355.048] (-353.298) (-355.601) -- 0:00:18
185000 -- (-354.673) [-354.395] (-354.375) (-355.402) * (-354.225) (-353.978) [-354.088] (-356.330) -- 0:00:18
Average standard deviation of split frequencies: 0.021923
185500 -- (-353.718) (-353.339) [-353.192] (-356.433) * (-354.135) [-352.905] (-353.260) (-353.083) -- 0:00:20
186000 -- (-355.454) (-353.495) (-356.442) [-356.565] * (-353.647) [-356.924] (-353.607) (-352.540) -- 0:00:20
186500 -- [-352.889] (-353.811) (-354.713) (-356.287) * (-356.159) [-357.100] (-354.239) (-356.425) -- 0:00:20
187000 -- (-353.513) [-354.638] (-353.443) (-359.072) * (-352.866) (-352.830) (-352.914) [-353.808] -- 0:00:20
187500 -- (-352.838) (-355.107) [-353.521] (-357.013) * (-353.780) (-354.698) (-353.405) [-355.489] -- 0:00:20
188000 -- (-352.938) (-354.223) [-358.098] (-355.088) * (-354.612) (-353.242) (-353.253) [-354.326] -- 0:00:19
188500 -- (-353.893) (-353.593) (-355.817) [-353.082] * (-357.903) [-352.891] (-354.830) (-354.408) -- 0:00:19
189000 -- (-352.937) (-355.871) (-357.696) [-352.958] * (-354.704) (-353.949) (-356.160) [-353.390] -- 0:00:19
189500 -- [-353.254] (-353.480) (-356.047) (-354.315) * [-352.583] (-354.534) (-352.309) (-355.466) -- 0:00:19
190000 -- (-354.069) (-353.156) [-354.318] (-353.225) * [-354.471] (-353.752) (-355.818) (-358.431) -- 0:00:19
Average standard deviation of split frequencies: 0.021663
190500 -- (-358.081) (-353.939) [-352.698] (-356.939) * (-353.621) (-352.446) [-353.186] (-353.628) -- 0:00:19
191000 -- (-352.583) (-355.115) [-353.058] (-354.051) * (-353.863) (-355.834) (-358.776) [-356.141] -- 0:00:19
191500 -- (-353.371) (-354.358) (-352.608) [-354.666] * (-354.039) (-354.320) (-357.656) [-354.219] -- 0:00:19
192000 -- (-356.595) (-354.402) (-355.195) [-355.798] * (-353.911) (-354.211) (-354.233) [-354.385] -- 0:00:19
192500 -- (-353.863) (-354.379) (-352.719) [-353.655] * [-355.407] (-359.466) (-356.816) (-354.850) -- 0:00:19
193000 -- (-353.319) (-356.779) [-355.410] (-354.516) * (-353.443) [-353.881] (-356.282) (-354.789) -- 0:00:19
193500 -- [-354.453] (-355.104) (-354.391) (-353.315) * [-353.747] (-353.042) (-353.204) (-353.358) -- 0:00:19
194000 -- (-353.350) (-354.331) [-355.701] (-357.315) * (-352.527) [-354.191] (-354.907) (-353.583) -- 0:00:18
194500 -- (-357.837) (-353.454) [-353.994] (-359.354) * [-354.066] (-355.280) (-352.603) (-354.971) -- 0:00:18
195000 -- [-357.091] (-357.563) (-354.689) (-353.525) * (-353.446) (-354.236) (-353.974) [-354.343] -- 0:00:18
Average standard deviation of split frequencies: 0.020507
195500 -- (-352.629) (-357.840) [-355.626] (-353.028) * (-355.728) (-354.995) (-352.730) [-355.481] -- 0:00:18
196000 -- (-352.460) [-352.986] (-354.012) (-354.822) * [-355.952] (-355.771) (-354.808) (-357.078) -- 0:00:18
196500 -- [-354.748] (-354.144) (-354.880) (-353.635) * (-352.239) (-355.187) [-353.794] (-353.481) -- 0:00:18
197000 -- (-354.028) [-354.507] (-354.650) (-353.640) * (-354.431) (-357.044) [-355.203] (-356.352) -- 0:00:18
197500 -- (-353.317) (-355.507) (-356.075) [-354.198] * (-356.944) (-359.269) (-353.596) [-355.432] -- 0:00:18
198000 -- (-353.832) (-354.133) [-354.226] (-354.040) * (-353.249) [-354.109] (-358.694) (-356.350) -- 0:00:18
198500 -- (-355.825) (-354.283) [-354.577] (-353.078) * [-353.684] (-356.481) (-353.940) (-354.788) -- 0:00:18
199000 -- (-353.619) (-360.738) (-355.685) [-354.314] * (-354.133) (-356.936) (-354.926) [-353.203] -- 0:00:18
199500 -- (-353.097) (-358.214) [-360.005] (-354.119) * (-353.233) (-354.709) (-354.265) [-352.812] -- 0:00:18
200000 -- (-356.150) (-355.161) (-356.725) [-356.704] * [-353.879] (-353.270) (-353.951) (-352.650) -- 0:00:18
Average standard deviation of split frequencies: 0.019185
200500 -- (-354.332) [-352.547] (-361.922) (-352.884) * (-358.972) (-352.951) (-352.969) [-353.230] -- 0:00:17
201000 -- [-353.740] (-356.155) (-356.272) (-354.738) * (-353.015) (-353.175) [-354.551] (-353.067) -- 0:00:17
201500 -- (-354.804) (-355.127) (-354.421) [-354.057] * (-352.763) (-358.857) [-353.610] (-354.071) -- 0:00:17
202000 -- (-357.991) (-354.100) [-353.104] (-353.944) * (-359.853) (-353.151) (-355.963) [-354.071] -- 0:00:17
202500 -- (-355.361) (-354.279) (-355.270) [-353.191] * (-356.284) (-353.913) (-354.620) [-353.110] -- 0:00:19
203000 -- (-352.637) (-354.343) (-357.595) [-353.392] * (-355.028) [-355.123] (-355.855) (-356.571) -- 0:00:19
203500 -- (-352.815) (-353.299) (-353.262) [-354.872] * (-355.006) [-355.594] (-360.493) (-359.114) -- 0:00:18
204000 -- (-353.465) [-352.890] (-354.539) (-357.419) * (-352.637) (-355.615) [-358.269] (-353.620) -- 0:00:18
204500 -- (-355.545) [-352.282] (-352.619) (-356.988) * (-353.549) (-360.744) [-359.651] (-353.584) -- 0:00:18
205000 -- [-355.860] (-353.347) (-355.625) (-357.635) * (-355.902) (-357.813) (-359.485) [-352.808] -- 0:00:18
Average standard deviation of split frequencies: 0.018307
205500 -- [-354.076] (-354.362) (-353.890) (-353.264) * (-354.897) [-354.556] (-359.957) (-356.581) -- 0:00:18
206000 -- [-353.780] (-353.215) (-352.690) (-355.074) * (-359.755) (-355.567) [-353.869] (-355.638) -- 0:00:18
206500 -- [-353.471] (-354.493) (-352.999) (-352.616) * [-355.185] (-355.727) (-354.340) (-353.168) -- 0:00:18
207000 -- [-353.197] (-353.338) (-353.442) (-353.457) * [-357.508] (-357.279) (-355.248) (-355.981) -- 0:00:18
207500 -- [-353.336] (-354.252) (-355.413) (-355.710) * (-353.384) [-354.168] (-353.074) (-355.656) -- 0:00:18
208000 -- (-354.769) (-353.996) [-353.997] (-353.273) * (-355.108) (-357.223) (-354.100) [-354.654] -- 0:00:18
208500 -- [-353.462] (-355.004) (-352.972) (-355.479) * (-355.718) (-355.977) [-354.028] (-353.741) -- 0:00:18
209000 -- (-353.143) (-354.180) [-352.656] (-355.027) * (-353.808) (-356.135) (-353.820) [-353.586] -- 0:00:18
209500 -- (-353.502) (-356.986) [-354.695] (-354.850) * (-352.834) [-353.178] (-361.693) (-355.665) -- 0:00:18
210000 -- (-354.409) [-352.706] (-352.950) (-354.694) * (-354.245) (-356.333) [-355.311] (-353.403) -- 0:00:17
Average standard deviation of split frequencies: 0.018490
210500 -- (-355.884) (-353.319) (-353.606) [-357.139] * [-352.382] (-354.685) (-353.432) (-355.851) -- 0:00:17
211000 -- (-355.097) (-353.558) [-354.344] (-355.731) * (-358.460) (-354.223) (-355.893) [-354.521] -- 0:00:17
211500 -- (-354.926) [-356.509] (-358.060) (-354.146) * (-354.737) (-357.380) (-356.534) [-353.459] -- 0:00:17
212000 -- (-353.869) [-354.668] (-355.336) (-354.210) * (-356.548) (-355.880) (-355.477) [-355.280] -- 0:00:17
212500 -- [-353.072] (-355.300) (-355.450) (-353.209) * (-355.369) [-352.491] (-354.186) (-355.331) -- 0:00:17
213000 -- (-356.604) (-353.397) (-356.224) [-354.041] * (-353.922) (-353.177) (-355.394) [-355.114] -- 0:00:17
213500 -- (-356.307) (-353.220) (-355.944) [-353.224] * (-357.796) [-354.881] (-357.945) (-356.503) -- 0:00:17
214000 -- (-355.524) (-353.094) (-354.587) [-354.277] * [-355.501] (-353.387) (-354.617) (-355.806) -- 0:00:17
214500 -- (-354.243) (-353.069) [-354.551] (-357.140) * [-355.182] (-353.935) (-353.369) (-355.289) -- 0:00:17
215000 -- (-353.968) (-352.863) [-352.540] (-355.964) * (-357.762) [-357.072] (-353.855) (-353.665) -- 0:00:17
Average standard deviation of split frequencies: 0.019412
215500 -- (-355.883) (-356.844) (-357.135) [-357.433] * [-353.581] (-355.757) (-354.599) (-354.045) -- 0:00:17
216000 -- [-354.218] (-354.123) (-353.514) (-356.742) * (-352.501) (-354.615) (-356.742) [-357.314] -- 0:00:17
216500 -- (-354.106) (-352.832) [-354.428] (-353.978) * [-354.017] (-355.014) (-354.163) (-358.811) -- 0:00:17
217000 -- (-354.678) (-353.833) [-353.771] (-357.934) * (-353.416) [-354.587] (-354.055) (-357.942) -- 0:00:16
217500 -- (-354.099) (-353.383) [-353.963] (-359.838) * (-356.018) (-354.029) (-352.302) [-357.135] -- 0:00:16
218000 -- [-352.920] (-353.798) (-354.653) (-354.027) * [-353.099] (-356.402) (-353.282) (-362.226) -- 0:00:16
218500 -- [-352.706] (-353.713) (-356.027) (-352.423) * (-353.258) (-352.431) [-355.807] (-354.433) -- 0:00:16
219000 -- [-354.365] (-356.079) (-353.211) (-354.359) * (-355.302) (-353.382) (-352.760) [-358.397] -- 0:00:16
219500 -- [-353.012] (-355.565) (-353.404) (-354.070) * (-353.638) (-353.960) [-353.122] (-353.795) -- 0:00:16
220000 -- (-358.257) [-354.537] (-355.265) (-354.570) * (-354.712) [-357.507] (-353.755) (-353.608) -- 0:00:17
Average standard deviation of split frequencies: 0.020238
220500 -- [-355.242] (-356.527) (-356.227) (-355.842) * (-360.346) (-353.313) (-355.167) [-353.920] -- 0:00:17
221000 -- (-354.759) (-361.697) (-356.058) [-353.066] * [-354.717] (-358.666) (-357.637) (-356.474) -- 0:00:17
221500 -- (-353.750) (-356.721) [-355.897] (-354.493) * (-353.887) [-356.899] (-355.246) (-357.141) -- 0:00:17
222000 -- [-353.707] (-354.232) (-354.506) (-354.579) * (-355.856) (-358.968) [-354.347] (-355.137) -- 0:00:17
222500 -- [-352.945] (-355.674) (-352.565) (-353.038) * (-356.106) (-355.348) (-357.874) [-357.095] -- 0:00:17
223000 -- (-352.936) [-353.561] (-353.306) (-353.861) * (-354.002) [-353.803] (-354.907) (-362.275) -- 0:00:17
223500 -- (-355.574) (-354.290) [-355.064] (-352.897) * (-354.329) (-356.210) [-355.425] (-353.709) -- 0:00:17
224000 -- (-357.976) (-353.760) [-355.134] (-354.589) * (-355.093) [-352.617] (-360.740) (-354.419) -- 0:00:17
224500 -- [-355.142] (-355.492) (-355.991) (-352.621) * [-354.660] (-353.647) (-356.303) (-352.486) -- 0:00:17
225000 -- (-356.236) (-352.823) [-354.863] (-352.751) * [-354.075] (-354.945) (-354.313) (-353.368) -- 0:00:17
Average standard deviation of split frequencies: 0.019431
225500 -- (-354.307) (-353.521) [-354.861] (-353.456) * (-356.258) [-357.585] (-355.600) (-353.695) -- 0:00:17
226000 -- (-354.113) (-353.505) [-356.996] (-356.127) * (-353.217) (-354.601) [-353.689] (-353.137) -- 0:00:16
226500 -- (-357.528) (-353.815) (-355.424) [-355.000] * (-355.950) (-355.776) (-355.032) [-353.351] -- 0:00:16
227000 -- (-352.713) [-354.638] (-352.574) (-353.585) * (-353.083) [-353.141] (-355.021) (-356.045) -- 0:00:16
227500 -- [-353.111] (-358.250) (-353.193) (-352.763) * (-354.747) [-353.330] (-356.092) (-354.506) -- 0:00:16
228000 -- (-355.937) (-355.332) (-354.396) [-355.930] * [-353.368] (-354.362) (-357.587) (-354.023) -- 0:00:16
228500 -- (-355.997) [-356.257] (-355.672) (-353.640) * [-353.890] (-355.083) (-356.537) (-353.591) -- 0:00:16
229000 -- (-355.182) (-358.951) (-355.881) [-356.547] * (-354.223) (-354.970) (-356.971) [-355.515] -- 0:00:16
229500 -- (-352.802) (-356.288) (-354.411) [-353.534] * (-354.600) [-355.134] (-355.058) (-354.832) -- 0:00:16
230000 -- (-352.582) (-353.186) (-355.758) [-355.509] * [-355.810] (-355.915) (-353.999) (-355.135) -- 0:00:16
Average standard deviation of split frequencies: 0.020114
230500 -- [-353.126] (-353.446) (-354.424) (-355.116) * (-355.692) (-355.948) (-358.209) [-353.003] -- 0:00:16
231000 -- (-352.590) [-353.239] (-353.543) (-355.063) * (-353.448) (-353.913) (-356.709) [-354.240] -- 0:00:16
231500 -- (-353.127) [-355.655] (-355.368) (-354.284) * (-353.773) (-356.681) [-354.978] (-353.510) -- 0:00:16
232000 -- (-354.190) (-355.569) [-353.673] (-357.587) * [-353.160] (-354.834) (-354.574) (-352.591) -- 0:00:16
232500 -- (-353.963) (-355.695) [-353.843] (-358.109) * (-354.732) (-355.741) [-354.438] (-352.843) -- 0:00:16
233000 -- (-352.764) (-352.981) [-356.139] (-359.209) * [-354.433] (-354.060) (-353.795) (-354.985) -- 0:00:16
233500 -- (-353.241) (-356.064) (-353.008) [-355.499] * [-354.560] (-354.643) (-354.210) (-354.668) -- 0:00:15
234000 -- [-358.068] (-355.976) (-355.404) (-354.858) * (-354.107) (-355.929) (-354.675) [-354.191] -- 0:00:15
234500 -- (-356.589) (-354.200) (-353.129) [-354.050] * (-353.173) (-353.695) (-356.116) [-354.509] -- 0:00:15
235000 -- [-353.169] (-353.506) (-355.332) (-353.269) * (-356.773) (-355.216) [-354.468] (-359.738) -- 0:00:16
Average standard deviation of split frequencies: 0.020921
235500 -- [-353.679] (-354.189) (-353.484) (-354.120) * (-356.586) [-354.145] (-352.701) (-355.538) -- 0:00:16
236000 -- (-361.140) (-353.985) (-353.288) [-354.186] * (-356.790) [-354.048] (-355.178) (-353.131) -- 0:00:16
236500 -- (-355.748) (-354.659) [-352.803] (-357.243) * (-357.088) (-356.063) [-352.836] (-354.026) -- 0:00:16
237000 -- (-355.451) [-353.744] (-353.087) (-357.126) * (-356.189) [-356.230] (-354.904) (-356.230) -- 0:00:16
237500 -- [-354.649] (-353.789) (-356.738) (-355.003) * (-353.013) [-353.521] (-356.078) (-354.923) -- 0:00:16
238000 -- (-355.210) (-354.959) (-354.085) [-354.077] * (-354.243) (-356.919) [-353.393] (-355.611) -- 0:00:16
238500 -- (-359.747) (-353.444) (-357.104) [-362.276] * (-355.357) (-353.638) [-354.835] (-357.181) -- 0:00:16
239000 -- (-359.393) (-353.048) (-354.136) [-353.660] * [-353.650] (-354.728) (-356.233) (-352.449) -- 0:00:16
239500 -- (-354.056) (-356.218) (-354.383) [-353.970] * (-355.241) [-354.087] (-353.873) (-354.013) -- 0:00:16
240000 -- (-355.278) (-355.058) [-354.803] (-355.142) * (-355.164) (-357.255) [-352.833] (-353.765) -- 0:00:16
Average standard deviation of split frequencies: 0.020132
240500 -- (-357.527) [-356.282] (-354.349) (-359.178) * (-358.470) (-354.400) [-353.001] (-352.891) -- 0:00:16
241000 -- [-354.869] (-353.690) (-357.600) (-355.069) * (-353.425) (-355.051) [-354.047] (-352.934) -- 0:00:16
241500 -- (-356.327) (-356.071) [-353.507] (-352.791) * [-355.710] (-352.867) (-355.799) (-352.254) -- 0:00:16
242000 -- (-354.077) [-357.768] (-352.305) (-352.867) * (-358.218) (-358.086) [-355.709] (-353.629) -- 0:00:15
242500 -- (-353.382) [-358.128] (-355.313) (-354.310) * (-360.314) (-354.926) (-355.397) [-353.226] -- 0:00:15
243000 -- (-352.695) (-355.904) [-354.017] (-352.209) * (-354.689) (-352.901) [-352.721] (-354.094) -- 0:00:15
243500 -- (-353.534) (-355.748) [-352.930] (-352.129) * (-352.628) [-360.226] (-353.276) (-353.229) -- 0:00:15
244000 -- (-357.195) (-354.041) (-353.729) [-355.334] * (-355.407) (-356.727) (-353.587) [-353.684] -- 0:00:15
244500 -- [-355.733] (-356.918) (-353.151) (-353.915) * [-354.369] (-356.165) (-354.551) (-358.907) -- 0:00:15
245000 -- (-354.643) [-352.605] (-352.362) (-352.916) * [-354.439] (-356.633) (-354.685) (-356.353) -- 0:00:15
Average standard deviation of split frequencies: 0.019802
245500 -- (-355.903) (-356.407) (-354.980) [-354.014] * [-352.635] (-355.373) (-357.715) (-356.381) -- 0:00:15
246000 -- (-352.931) [-355.738] (-352.392) (-353.199) * [-352.321] (-353.010) (-352.315) (-355.005) -- 0:00:15
246500 -- (-353.253) (-355.290) (-352.572) [-353.498] * (-352.638) (-352.217) [-352.599] (-356.677) -- 0:00:15
247000 -- (-354.473) (-357.147) (-354.090) [-354.118] * (-356.716) (-352.519) (-352.911) [-355.291] -- 0:00:15
247500 -- (-354.229) [-355.531] (-353.782) (-356.555) * [-355.011] (-352.710) (-356.994) (-361.718) -- 0:00:15
248000 -- [-359.151] (-357.971) (-353.609) (-355.142) * (-354.761) (-353.639) [-357.010] (-353.331) -- 0:00:15
248500 -- (-352.877) [-356.010] (-356.104) (-356.869) * (-355.668) [-355.012] (-361.039) (-356.353) -- 0:00:15
249000 -- (-353.827) (-353.096) [-354.897] (-361.694) * (-355.189) [-354.687] (-354.381) (-355.006) -- 0:00:15
249500 -- (-357.106) (-354.214) (-354.696) [-353.766] * (-356.442) (-355.116) (-356.648) [-355.559] -- 0:00:15
250000 -- (-353.826) (-353.034) (-353.848) [-354.711] * (-355.839) (-354.495) (-353.232) [-357.454] -- 0:00:15
Average standard deviation of split frequencies: 0.019558
250500 -- [-353.999] (-354.734) (-355.887) (-357.857) * (-353.995) (-355.603) [-352.549] (-354.264) -- 0:00:14
251000 -- (-356.416) [-356.137] (-354.946) (-353.549) * [-353.231] (-354.169) (-352.778) (-357.117) -- 0:00:15
251500 -- (-357.050) (-353.383) [-353.776] (-352.807) * (-355.120) [-353.155] (-356.888) (-355.039) -- 0:00:15
252000 -- (-359.696) (-354.008) (-354.927) [-353.999] * (-354.639) (-356.099) [-356.142] (-355.885) -- 0:00:15
252500 -- [-361.342] (-358.517) (-352.387) (-354.350) * [-355.077] (-355.077) (-353.784) (-354.282) -- 0:00:15
253000 -- (-352.728) (-353.119) [-353.435] (-353.228) * (-355.575) [-356.055] (-353.515) (-354.516) -- 0:00:15
253500 -- [-354.563] (-354.065) (-354.976) (-356.384) * (-359.670) [-353.495] (-355.355) (-355.918) -- 0:00:15
254000 -- (-355.137) (-356.481) (-354.284) [-355.041] * (-356.526) (-355.512) (-355.642) [-354.356] -- 0:00:15
254500 -- (-356.159) (-356.012) [-358.848] (-355.379) * (-354.210) [-356.788] (-355.411) (-354.062) -- 0:00:15
255000 -- (-356.083) [-358.316] (-356.788) (-354.463) * [-352.695] (-352.525) (-355.566) (-353.113) -- 0:00:15
Average standard deviation of split frequencies: 0.018967
255500 -- [-354.810] (-353.787) (-353.275) (-356.693) * (-354.734) (-358.012) (-354.941) [-356.157] -- 0:00:15
256000 -- (-358.307) (-353.082) (-356.157) [-354.564] * (-354.921) [-358.466] (-353.234) (-354.302) -- 0:00:15
256500 -- (-356.034) (-352.417) (-354.986) [-352.860] * [-355.068] (-352.885) (-353.537) (-357.639) -- 0:00:15
257000 -- (-355.024) (-352.617) [-352.660] (-356.638) * [-356.087] (-354.154) (-353.335) (-355.089) -- 0:00:15
257500 -- [-354.032] (-352.542) (-353.447) (-357.923) * (-353.774) (-357.735) [-353.563] (-353.837) -- 0:00:15
258000 -- (-357.587) (-354.105) [-354.123] (-357.439) * (-353.642) (-355.080) (-355.564) [-353.695] -- 0:00:15
258500 -- (-353.435) (-352.965) (-355.546) [-354.742] * (-357.266) (-367.709) [-357.659] (-354.248) -- 0:00:14
259000 -- [-353.375] (-354.373) (-353.555) (-352.559) * (-357.114) (-353.371) [-356.307] (-354.422) -- 0:00:14
259500 -- [-355.557] (-354.356) (-352.740) (-355.145) * (-354.321) (-352.375) (-359.702) [-352.868] -- 0:00:14
260000 -- (-356.306) (-357.460) (-353.779) [-356.273] * (-353.150) [-354.907] (-352.685) (-352.910) -- 0:00:14
Average standard deviation of split frequencies: 0.019170
260500 -- (-355.873) (-354.829) [-356.035] (-361.267) * (-353.166) [-352.987] (-352.613) (-352.823) -- 0:00:14
261000 -- (-357.815) [-352.378] (-355.624) (-362.085) * (-355.148) [-353.527] (-354.207) (-356.864) -- 0:00:14
261500 -- (-354.551) (-354.737) [-354.086] (-358.871) * [-354.248] (-353.387) (-353.338) (-355.243) -- 0:00:14
262000 -- (-354.567) (-353.677) [-352.523] (-356.843) * (-355.295) [-354.082] (-358.943) (-356.280) -- 0:00:14
262500 -- [-356.682] (-355.541) (-354.870) (-354.931) * [-354.047] (-352.232) (-356.543) (-355.081) -- 0:00:14
263000 -- (-355.709) (-358.374) [-353.717] (-354.787) * [-364.404] (-354.104) (-353.892) (-357.258) -- 0:00:14
263500 -- (-357.706) [-358.073] (-356.120) (-359.157) * (-357.156) [-354.717] (-355.711) (-356.686) -- 0:00:14
264000 -- (-356.880) (-356.157) (-356.067) [-353.209] * [-354.727] (-353.072) (-354.068) (-355.106) -- 0:00:14
264500 -- (-353.781) (-356.948) [-353.464] (-353.861) * [-353.648] (-353.975) (-354.816) (-353.172) -- 0:00:14
265000 -- (-354.151) (-356.217) (-352.656) [-353.230] * (-353.837) (-355.333) [-355.584] (-353.501) -- 0:00:14
Average standard deviation of split frequencies: 0.019051
265500 -- (-353.797) (-354.873) [-354.414] (-354.394) * (-355.186) (-357.043) (-353.955) [-353.098] -- 0:00:14
266000 -- (-354.005) (-360.966) [-353.938] (-352.762) * (-357.334) (-353.109) [-354.633] (-353.974) -- 0:00:14
266500 -- [-355.341] (-359.251) (-354.128) (-353.453) * (-356.930) [-353.182] (-353.007) (-356.275) -- 0:00:14
267000 -- [-355.669] (-355.215) (-356.522) (-354.294) * (-353.235) [-353.657] (-356.011) (-354.402) -- 0:00:14
267500 -- (-354.245) (-354.993) (-354.345) [-354.225] * [-352.815] (-358.787) (-356.294) (-354.799) -- 0:00:14
268000 -- (-354.023) (-353.132) (-356.600) [-353.110] * (-355.210) [-353.353] (-355.647) (-356.107) -- 0:00:14
268500 -- (-354.223) (-353.833) (-356.906) [-354.257] * (-354.117) (-353.024) (-354.350) [-353.212] -- 0:00:14
269000 -- (-355.061) [-353.047] (-354.026) (-356.037) * (-352.854) (-355.089) (-353.147) [-354.455] -- 0:00:14
269500 -- (-354.076) (-357.740) [-352.445] (-353.393) * (-355.949) (-355.555) (-353.585) [-353.691] -- 0:00:14
270000 -- (-354.971) (-354.498) [-353.962] (-355.279) * [-353.333] (-353.753) (-354.325) (-355.217) -- 0:00:14
Average standard deviation of split frequencies: 0.016110
270500 -- [-353.393] (-353.923) (-358.508) (-353.875) * (-353.785) (-355.506) [-355.203] (-355.087) -- 0:00:14
271000 -- [-352.564] (-353.926) (-356.934) (-353.900) * [-352.704] (-355.045) (-354.164) (-356.079) -- 0:00:14
271500 -- [-352.979] (-354.149) (-353.435) (-354.567) * (-354.165) (-359.587) (-356.441) [-355.338] -- 0:00:14
272000 -- (-354.616) (-354.676) [-359.523] (-353.363) * (-353.460) (-354.523) (-352.936) [-357.778] -- 0:00:14
272500 -- (-354.311) (-353.316) [-355.476] (-357.623) * (-355.817) (-354.394) [-353.056] (-358.031) -- 0:00:14
273000 -- (-352.667) (-353.529) (-356.066) [-357.017] * (-355.817) [-356.461] (-352.944) (-357.933) -- 0:00:14
273500 -- (-357.981) (-353.907) (-353.664) [-354.765] * [-353.389] (-354.188) (-353.850) (-355.136) -- 0:00:14
274000 -- [-353.511] (-354.734) (-356.001) (-355.411) * (-360.546) (-355.533) (-352.786) [-355.563] -- 0:00:14
274500 -- (-355.353) [-353.802] (-356.475) (-353.538) * (-358.097) (-353.796) (-355.256) [-353.108] -- 0:00:13
275000 -- (-356.682) (-354.400) (-353.760) [-353.613] * (-354.349) (-354.322) [-358.369] (-354.139) -- 0:00:13
Average standard deviation of split frequencies: 0.014138
275500 -- (-354.140) (-355.033) (-357.442) [-354.434] * (-358.410) (-354.020) (-360.481) [-352.242] -- 0:00:13
276000 -- (-353.851) (-354.248) (-355.211) [-356.547] * [-356.088] (-353.756) (-356.421) (-352.828) -- 0:00:13
276500 -- (-353.417) (-352.836) (-354.088) [-353.833] * (-352.825) (-355.560) (-355.118) [-353.432] -- 0:00:13
277000 -- (-356.660) (-353.939) (-356.450) [-354.186] * [-354.753] (-356.833) (-358.210) (-354.797) -- 0:00:13
277500 -- (-354.683) (-353.938) [-353.471] (-355.502) * (-354.409) (-353.810) [-356.080] (-355.509) -- 0:00:13
278000 -- [-353.264] (-355.883) (-352.937) (-352.971) * [-354.831] (-358.130) (-355.531) (-352.576) -- 0:00:13
278500 -- (-360.063) (-355.183) (-353.494) [-354.733] * [-355.151] (-353.983) (-353.642) (-352.969) -- 0:00:13
279000 -- (-354.383) [-354.806] (-353.926) (-356.385) * (-354.219) (-357.390) [-354.530] (-353.557) -- 0:00:13
279500 -- (-359.839) [-354.751] (-354.320) (-353.908) * (-355.411) (-355.602) (-353.549) [-356.796] -- 0:00:13
280000 -- [-356.927] (-362.511) (-355.353) (-356.660) * (-355.532) [-354.814] (-354.126) (-354.267) -- 0:00:13
Average standard deviation of split frequencies: 0.013790
280500 -- (-356.484) (-355.998) [-356.068] (-356.034) * (-353.831) (-354.229) [-353.928] (-353.736) -- 0:00:13
281000 -- (-355.755) (-354.046) [-357.639] (-352.875) * (-354.411) [-356.368] (-354.313) (-360.148) -- 0:00:13
281500 -- [-356.102] (-356.518) (-353.685) (-355.876) * (-356.213) (-353.859) (-355.673) [-359.638] -- 0:00:13
282000 -- (-354.357) [-355.488] (-354.456) (-352.694) * (-354.556) (-356.203) (-353.390) [-355.800] -- 0:00:13
282500 -- (-357.685) (-354.934) (-357.012) [-353.492] * (-354.771) (-353.390) [-354.461] (-354.021) -- 0:00:13
283000 -- (-354.299) [-356.069] (-354.358) (-356.571) * (-354.761) (-357.917) (-355.116) [-353.221] -- 0:00:13
283500 -- [-353.542] (-356.959) (-354.176) (-358.532) * (-353.150) (-354.843) (-353.989) [-354.825] -- 0:00:13
284000 -- (-352.855) [-352.489] (-356.615) (-358.018) * (-357.239) (-361.175) (-354.762) [-355.409] -- 0:00:13
284500 -- (-352.793) (-354.941) (-352.565) [-353.386] * (-358.424) [-356.317] (-355.739) (-357.020) -- 0:00:13
285000 -- (-357.561) (-355.589) (-354.128) [-354.447] * (-355.258) [-355.517] (-354.827) (-352.960) -- 0:00:13
Average standard deviation of split frequencies: 0.014314
285500 -- [-353.704] (-357.092) (-353.493) (-353.391) * [-354.629] (-355.490) (-352.871) (-354.939) -- 0:00:13
286000 -- (-357.073) (-355.149) (-353.291) [-353.263] * (-356.418) (-354.677) [-352.654] (-356.315) -- 0:00:13
286500 -- (-353.781) (-355.883) (-354.969) [-353.862] * (-354.523) [-353.889] (-353.583) (-355.149) -- 0:00:13
287000 -- (-356.538) [-353.789] (-355.120) (-355.774) * (-355.338) (-352.975) (-353.897) [-353.666] -- 0:00:13
287500 -- (-355.502) [-353.841] (-354.291) (-356.488) * (-360.022) (-355.163) (-356.874) [-353.443] -- 0:00:13
288000 -- (-357.054) [-354.459] (-354.533) (-355.879) * (-354.106) [-355.364] (-354.528) (-353.306) -- 0:00:13
288500 -- (-355.146) (-355.268) (-353.976) [-352.968] * (-353.824) [-355.058] (-353.824) (-354.784) -- 0:00:13
289000 -- (-352.883) (-354.004) [-354.056] (-356.363) * (-355.772) [-355.418] (-354.954) (-355.537) -- 0:00:13
289500 -- (-359.885) [-354.473] (-354.515) (-352.418) * [-353.651] (-355.430) (-356.914) (-354.389) -- 0:00:13
290000 -- [-353.706] (-353.412) (-356.152) (-355.960) * (-354.490) (-354.092) (-353.737) [-352.841] -- 0:00:13
Average standard deviation of split frequencies: 0.014506
290500 -- (-354.864) [-354.537] (-357.341) (-354.186) * [-355.780] (-359.140) (-355.426) (-357.395) -- 0:00:12
291000 -- [-352.200] (-355.512) (-354.852) (-354.411) * [-354.621] (-356.690) (-353.420) (-353.234) -- 0:00:12
291500 -- (-356.913) (-354.123) (-354.384) [-355.181] * (-354.826) (-353.558) (-354.139) [-355.195] -- 0:00:12
292000 -- (-354.473) [-356.648] (-355.689) (-357.666) * (-352.852) [-353.967] (-359.049) (-354.601) -- 0:00:12
292500 -- (-353.431) (-354.415) (-356.964) [-353.645] * [-354.371] (-354.068) (-355.073) (-358.026) -- 0:00:12
293000 -- (-354.769) (-354.279) (-353.455) [-352.712] * (-352.600) [-352.736] (-357.133) (-353.626) -- 0:00:12
293500 -- (-355.681) (-356.613) [-353.956] (-354.313) * (-353.062) (-352.479) [-353.045] (-354.587) -- 0:00:12
294000 -- [-358.429] (-354.706) (-354.118) (-357.224) * [-358.945] (-355.410) (-356.010) (-357.053) -- 0:00:12
294500 -- (-354.095) (-354.091) [-353.182] (-357.853) * (-355.713) (-355.304) (-356.325) [-353.582] -- 0:00:12
295000 -- (-356.685) (-352.997) [-354.289] (-354.948) * [-359.163] (-355.065) (-357.130) (-352.738) -- 0:00:12
Average standard deviation of split frequencies: 0.013006
295500 -- (-353.823) [-352.978] (-355.361) (-353.046) * (-356.084) (-356.219) (-355.175) [-353.704] -- 0:00:12
296000 -- [-356.514] (-358.703) (-356.497) (-352.670) * (-354.935) (-352.389) (-353.460) [-355.602] -- 0:00:12
296500 -- (-353.024) (-353.547) (-353.851) [-355.986] * (-356.197) (-354.964) (-353.798) [-354.603] -- 0:00:12
297000 -- (-354.477) (-354.449) (-356.540) [-354.072] * (-355.878) (-353.985) [-354.663] (-353.706) -- 0:00:12
297500 -- (-354.060) (-354.037) (-354.183) [-356.386] * (-354.462) (-354.568) [-355.500] (-358.005) -- 0:00:12
298000 -- [-353.507] (-353.022) (-355.721) (-353.012) * (-355.061) (-352.439) [-355.886] (-356.000) -- 0:00:12
298500 -- [-353.349] (-362.139) (-354.550) (-354.439) * (-353.046) (-352.153) [-353.375] (-355.209) -- 0:00:12
299000 -- (-355.004) [-354.506] (-353.227) (-353.703) * [-353.459] (-353.285) (-358.167) (-358.197) -- 0:00:12
299500 -- [-357.065] (-355.449) (-356.577) (-354.275) * (-355.785) (-354.086) (-354.761) [-355.565] -- 0:00:12
300000 -- [-353.459] (-357.199) (-356.530) (-354.089) * [-353.448] (-356.034) (-355.463) (-353.216) -- 0:00:12
Average standard deviation of split frequencies: 0.013281
300500 -- (-352.985) (-353.722) [-352.469] (-354.047) * (-355.512) (-354.230) (-352.817) [-352.915] -- 0:00:12
301000 -- (-355.062) (-355.865) [-355.438] (-355.360) * (-356.029) [-355.627] (-352.894) (-355.754) -- 0:00:12
301500 -- (-353.745) [-353.048] (-355.786) (-354.499) * [-354.364] (-357.440) (-353.762) (-354.178) -- 0:00:12
302000 -- (-354.842) (-355.345) (-357.305) [-357.326] * (-355.896) (-354.620) (-356.430) [-357.650] -- 0:00:12
302500 -- (-356.780) [-353.628] (-354.850) (-353.722) * [-352.629] (-355.112) (-357.514) (-352.956) -- 0:00:12
303000 -- (-354.903) (-356.172) [-353.374] (-353.244) * (-354.968) [-353.041] (-357.253) (-359.519) -- 0:00:12
303500 -- (-353.899) (-353.748) (-357.654) [-353.296] * (-355.324) [-352.322] (-358.252) (-352.964) -- 0:00:12
304000 -- (-354.252) [-354.215] (-358.850) (-354.000) * (-354.507) (-352.792) [-356.390] (-358.393) -- 0:00:12
304500 -- (-355.702) [-354.756] (-364.036) (-352.926) * (-354.118) (-353.488) (-355.691) [-353.997] -- 0:00:12
305000 -- (-356.552) [-355.168] (-354.692) (-353.344) * (-356.292) (-354.235) (-356.936) [-355.161] -- 0:00:12
Average standard deviation of split frequencies: 0.013266
305500 -- (-354.380) (-354.488) [-353.802] (-352.247) * (-354.576) (-353.721) [-353.431] (-353.491) -- 0:00:12
306000 -- (-353.120) (-354.630) (-353.084) [-352.500] * (-356.434) (-354.635) (-355.416) [-355.783] -- 0:00:12
306500 -- [-352.643] (-352.769) (-353.641) (-356.184) * [-353.969] (-353.488) (-353.487) (-356.322) -- 0:00:11
307000 -- (-354.708) [-356.358] (-354.255) (-355.589) * [-353.099] (-360.052) (-357.866) (-353.169) -- 0:00:11
307500 -- [-355.949] (-354.106) (-354.555) (-357.860) * (-360.409) (-358.802) (-356.592) [-353.342] -- 0:00:11
308000 -- [-353.956] (-356.429) (-354.386) (-353.943) * [-354.198] (-355.567) (-352.552) (-353.278) -- 0:00:11
308500 -- [-354.069] (-354.851) (-357.233) (-355.026) * (-357.258) [-356.364] (-355.176) (-352.511) -- 0:00:11
309000 -- [-353.201] (-355.048) (-352.478) (-353.325) * [-355.593] (-356.715) (-354.013) (-354.663) -- 0:00:11
309500 -- [-353.963] (-355.891) (-355.520) (-353.515) * [-353.262] (-355.228) (-353.061) (-356.186) -- 0:00:11
310000 -- (-353.093) (-353.716) (-353.951) [-353.047] * (-353.875) (-353.728) [-355.142] (-354.872) -- 0:00:11
Average standard deviation of split frequencies: 0.012898
310500 -- [-355.271] (-354.695) (-353.592) (-358.422) * (-356.107) (-352.941) [-356.564] (-352.919) -- 0:00:11
311000 -- (-355.941) [-353.318] (-355.082) (-355.193) * (-353.884) (-354.592) (-353.720) [-353.572] -- 0:00:11
311500 -- (-352.222) (-353.160) [-354.556] (-353.989) * [-356.148] (-355.485) (-353.611) (-355.921) -- 0:00:11
312000 -- (-354.116) (-355.634) [-353.682] (-355.934) * [-353.291] (-353.596) (-354.466) (-354.924) -- 0:00:11
312500 -- (-353.433) (-354.106) [-355.016] (-355.180) * (-357.908) (-355.611) (-355.790) [-356.166] -- 0:00:11
313000 -- (-355.622) (-353.905) [-353.406] (-354.517) * (-353.922) [-354.220] (-353.435) (-355.167) -- 0:00:11
313500 -- (-353.717) [-353.447] (-354.731) (-355.006) * (-357.761) (-354.995) [-355.316] (-356.241) -- 0:00:11
314000 -- (-356.540) [-352.807] (-352.615) (-356.927) * (-356.491) (-354.881) (-355.565) [-354.015] -- 0:00:11
314500 -- (-352.454) (-353.477) [-352.567] (-353.341) * (-352.896) (-356.092) (-352.919) [-356.383] -- 0:00:11
315000 -- (-357.728) (-354.755) [-353.031] (-355.253) * [-356.822] (-352.760) (-354.545) (-354.353) -- 0:00:11
Average standard deviation of split frequencies: 0.012773
315500 -- (-357.924) [-353.296] (-354.404) (-353.099) * (-361.672) (-359.026) [-355.014] (-355.164) -- 0:00:11
316000 -- (-353.233) [-352.808] (-354.055) (-355.093) * (-356.375) (-358.803) (-355.883) [-353.522] -- 0:00:11
316500 -- (-355.783) [-355.135] (-357.442) (-355.955) * (-358.813) (-358.986) (-357.061) [-355.371] -- 0:00:11
317000 -- (-355.776) (-355.053) (-355.170) [-352.360] * (-356.744) (-357.018) [-355.581] (-354.388) -- 0:00:11
317500 -- (-352.825) (-357.427) [-353.825] (-354.575) * (-358.270) (-361.165) (-354.360) [-353.665] -- 0:00:11
318000 -- (-354.321) [-353.330] (-355.468) (-353.338) * (-355.131) (-357.542) (-354.333) [-353.271] -- 0:00:11
318500 -- (-352.896) (-353.693) [-354.028] (-353.126) * (-354.169) [-354.787] (-354.060) (-353.602) -- 0:00:11
319000 -- (-353.320) [-357.278] (-352.647) (-356.355) * (-353.799) (-354.214) (-354.346) [-355.588] -- 0:00:11
319500 -- [-353.963] (-355.957) (-356.588) (-353.972) * [-353.326] (-356.007) (-353.836) (-353.234) -- 0:00:11
320000 -- [-353.755] (-358.006) (-358.070) (-354.305) * [-354.901] (-352.808) (-353.349) (-354.135) -- 0:00:11
Average standard deviation of split frequencies: 0.013490
320500 -- [-352.460] (-356.691) (-359.893) (-355.865) * (-354.192) [-353.323] (-355.541) (-354.554) -- 0:00:11
321000 -- (-357.229) [-354.317] (-356.219) (-362.250) * [-355.365] (-354.311) (-354.612) (-355.681) -- 0:00:11
321500 -- (-355.689) (-356.142) [-357.142] (-355.593) * [-356.104] (-354.376) (-354.475) (-354.555) -- 0:00:11
322000 -- (-352.467) [-355.516] (-354.221) (-355.049) * (-357.705) [-353.211] (-355.463) (-354.022) -- 0:00:11
322500 -- [-352.423] (-354.451) (-352.926) (-357.922) * (-356.063) (-353.832) [-355.549] (-355.545) -- 0:00:11
323000 -- [-353.565] (-356.502) (-360.129) (-357.267) * (-357.543) (-353.970) (-354.299) [-356.445] -- 0:00:10
323500 -- (-353.478) (-357.062) [-354.261] (-355.575) * (-356.382) (-356.786) (-356.147) [-353.069] -- 0:00:10
324000 -- [-353.327] (-356.954) (-357.650) (-352.901) * (-356.311) [-355.562] (-354.502) (-353.245) -- 0:00:10
324500 -- [-352.494] (-354.178) (-358.100) (-357.536) * [-357.309] (-355.059) (-353.527) (-355.687) -- 0:00:10
325000 -- (-352.519) [-354.704] (-356.668) (-356.746) * (-355.550) [-355.866] (-358.526) (-356.557) -- 0:00:10
Average standard deviation of split frequencies: 0.013577
325500 -- (-354.333) [-355.066] (-356.196) (-353.850) * (-355.096) [-359.527] (-352.193) (-353.332) -- 0:00:10
326000 -- (-354.089) (-353.965) [-352.321] (-353.943) * (-355.994) (-355.677) [-355.076] (-354.534) -- 0:00:10
326500 -- (-353.069) (-354.093) [-353.178] (-356.877) * (-353.701) (-354.650) [-354.234] (-354.355) -- 0:00:10
327000 -- [-356.269] (-354.267) (-352.924) (-357.687) * (-355.620) (-354.983) [-353.892] (-354.879) -- 0:00:10
327500 -- (-353.812) (-356.461) (-356.603) [-353.647] * [-356.154] (-355.211) (-353.758) (-353.474) -- 0:00:10
328000 -- (-354.748) (-358.477) [-356.811] (-355.158) * (-354.990) (-354.429) [-354.384] (-354.636) -- 0:00:10
328500 -- [-356.584] (-358.483) (-354.131) (-355.158) * [-357.343] (-353.454) (-355.576) (-356.623) -- 0:00:10
329000 -- (-356.634) [-356.344] (-353.836) (-357.435) * [-353.179] (-354.075) (-353.947) (-356.922) -- 0:00:10
329500 -- (-361.816) (-352.895) (-353.657) [-353.053] * [-353.559] (-354.110) (-356.321) (-356.565) -- 0:00:10
330000 -- (-357.760) (-356.102) [-353.759] (-354.141) * (-355.875) (-354.778) (-354.503) [-354.506] -- 0:00:10
Average standard deviation of split frequencies: 0.011740
330500 -- [-355.559] (-354.429) (-357.798) (-353.967) * (-353.235) [-353.946] (-355.957) (-355.061) -- 0:00:10
331000 -- (-354.299) (-355.681) (-353.947) [-355.904] * (-358.457) (-355.781) (-356.086) [-353.722] -- 0:00:10
331500 -- (-355.910) [-353.884] (-352.453) (-355.158) * [-352.705] (-354.518) (-355.772) (-357.279) -- 0:00:10
332000 -- [-353.629] (-353.951) (-356.506) (-356.505) * (-357.976) (-352.623) [-352.675] (-354.858) -- 0:00:10
332500 -- (-357.186) [-352.587] (-353.728) (-353.839) * (-356.755) (-354.142) (-354.574) [-355.869] -- 0:00:10
333000 -- (-353.588) (-354.868) (-353.882) [-352.979] * (-355.407) [-353.848] (-354.507) (-354.607) -- 0:00:10
333500 -- [-353.603] (-352.550) (-353.967) (-355.489) * (-353.796) (-354.419) (-354.341) [-355.068] -- 0:00:10
334000 -- (-355.306) [-352.375] (-354.294) (-354.631) * (-355.327) (-354.829) (-352.342) [-353.251] -- 0:00:10
334500 -- (-354.859) [-356.086] (-353.650) (-356.009) * (-354.599) (-357.281) (-355.172) [-354.673] -- 0:00:10
335000 -- (-354.019) (-352.824) (-352.344) [-357.020] * (-354.180) (-353.678) (-353.066) [-355.187] -- 0:00:10
Average standard deviation of split frequencies: 0.013173
335500 -- [-355.871] (-357.043) (-356.105) (-354.566) * (-355.792) [-355.093] (-353.664) (-356.723) -- 0:00:10
336000 -- [-353.454] (-353.594) (-355.086) (-352.850) * [-354.019] (-353.635) (-356.122) (-354.709) -- 0:00:10
336500 -- (-354.632) [-355.358] (-359.747) (-352.879) * (-358.385) [-352.862] (-355.955) (-355.791) -- 0:00:10
337000 -- (-354.092) (-353.594) (-359.962) [-352.401] * (-354.859) [-353.149] (-354.689) (-358.456) -- 0:00:10
337500 -- (-353.892) [-354.109] (-355.619) (-352.489) * (-356.813) [-352.724] (-357.778) (-360.392) -- 0:00:10
338000 -- [-354.527] (-355.104) (-352.724) (-354.542) * (-354.490) (-352.577) (-353.683) [-360.186] -- 0:00:10
338500 -- (-352.799) (-352.370) (-356.078) [-355.306] * [-353.690] (-353.613) (-352.598) (-353.735) -- 0:00:10
339000 -- (-352.973) (-354.525) [-359.152] (-359.989) * [-356.778] (-353.579) (-353.453) (-353.433) -- 0:00:09
339500 -- (-357.127) [-353.047] (-356.635) (-353.942) * (-353.459) [-355.178] (-353.571) (-359.028) -- 0:00:09
340000 -- (-354.526) [-354.387] (-354.037) (-353.886) * (-353.752) (-353.908) (-353.261) [-353.152] -- 0:00:09
Average standard deviation of split frequencies: 0.012269
340500 -- (-354.756) (-353.157) [-354.702] (-352.653) * (-352.159) (-354.117) [-358.620] (-353.651) -- 0:00:09
341000 -- (-354.397) (-353.189) [-352.486] (-362.308) * [-353.662] (-353.162) (-354.132) (-358.242) -- 0:00:09
341500 -- (-356.501) (-356.082) (-355.042) [-356.190] * [-353.364] (-354.604) (-356.024) (-365.402) -- 0:00:09
342000 -- (-353.828) (-357.571) (-355.971) [-353.981] * [-355.220] (-354.524) (-356.237) (-361.397) -- 0:00:09
342500 -- (-352.485) (-353.017) (-356.003) [-353.290] * (-353.891) (-353.611) [-353.356] (-355.453) -- 0:00:09
343000 -- (-352.502) (-355.569) [-354.434] (-354.516) * (-352.828) (-352.762) (-355.741) [-353.575] -- 0:00:09
343500 -- (-354.917) [-353.463] (-352.858) (-357.039) * (-356.829) (-356.114) [-353.503] (-353.854) -- 0:00:09
344000 -- (-353.371) (-352.604) [-353.162] (-352.739) * (-352.803) (-356.530) (-355.141) [-355.607] -- 0:00:09
344500 -- (-354.156) (-358.327) [-356.139] (-356.138) * (-356.933) (-353.867) [-353.195] (-354.861) -- 0:00:09
345000 -- (-357.287) (-356.506) (-353.674) [-354.453] * (-354.704) [-353.309] (-356.468) (-357.749) -- 0:00:09
Average standard deviation of split frequencies: 0.011832
345500 -- [-354.439] (-354.028) (-353.440) (-352.741) * (-358.371) (-353.153) [-354.105] (-355.319) -- 0:00:09
346000 -- (-353.516) [-353.611] (-354.143) (-352.261) * [-353.957] (-354.026) (-356.464) (-358.341) -- 0:00:09
346500 -- [-353.659] (-353.437) (-355.116) (-353.821) * (-354.990) (-354.032) [-354.498] (-357.213) -- 0:00:09
347000 -- (-353.323) [-354.695] (-354.096) (-353.094) * (-355.785) [-354.319] (-356.545) (-353.924) -- 0:00:09
347500 -- (-353.300) [-353.292] (-353.656) (-353.421) * (-352.504) (-356.678) [-356.578] (-355.545) -- 0:00:09
348000 -- (-354.615) [-355.348] (-354.252) (-353.698) * [-356.944] (-357.160) (-354.450) (-354.152) -- 0:00:09
348500 -- [-358.014] (-355.822) (-355.052) (-354.849) * [-355.878] (-357.121) (-354.127) (-355.111) -- 0:00:09
349000 -- (-354.339) [-354.307] (-355.291) (-353.539) * [-354.534] (-356.881) (-356.483) (-354.560) -- 0:00:09
349500 -- (-352.950) (-355.881) (-356.461) [-354.103] * (-352.566) (-357.773) (-355.316) [-355.194] -- 0:00:09
350000 -- [-353.589] (-354.659) (-353.370) (-353.164) * [-352.644] (-353.914) (-356.007) (-356.745) -- 0:00:09
Average standard deviation of split frequencies: 0.011576
350500 -- [-353.114] (-354.808) (-355.278) (-353.554) * (-355.777) (-355.280) [-354.297] (-353.294) -- 0:00:09
351000 -- [-354.738] (-353.144) (-353.332) (-352.794) * (-353.297) (-352.455) (-354.671) [-352.510] -- 0:00:09
351500 -- (-354.801) [-352.694] (-353.407) (-352.535) * (-356.206) (-352.777) [-355.865] (-353.352) -- 0:00:09
352000 -- (-357.312) (-354.405) [-353.962] (-353.416) * (-354.851) (-353.788) (-355.472) [-353.644] -- 0:00:09
352500 -- (-354.507) (-352.923) [-352.986] (-353.392) * (-356.589) (-355.164) [-357.431] (-359.349) -- 0:00:09
353000 -- (-353.344) [-354.028] (-353.764) (-355.177) * [-356.599] (-354.103) (-353.617) (-357.299) -- 0:00:09
353500 -- [-352.883] (-357.656) (-356.334) (-358.571) * (-356.521) (-355.094) [-356.373] (-354.106) -- 0:00:09
354000 -- (-353.863) (-353.073) (-355.679) [-353.382] * (-355.829) (-353.704) [-353.127] (-357.022) -- 0:00:09
354500 -- (-352.311) (-353.459) [-353.565] (-354.935) * (-353.093) (-352.789) (-353.370) [-357.089] -- 0:00:09
355000 -- (-353.060) (-353.274) (-360.226) [-355.224] * (-352.497) (-355.288) [-354.937] (-358.988) -- 0:00:08
Average standard deviation of split frequencies: 0.012824
355500 -- (-353.721) (-355.758) (-358.026) [-353.375] * (-354.010) (-355.660) (-353.888) [-354.111] -- 0:00:08
356000 -- [-353.011] (-355.003) (-352.918) (-354.041) * (-353.036) (-354.182) [-352.793] (-357.593) -- 0:00:08
356500 -- [-353.905] (-356.972) (-355.599) (-354.163) * (-352.963) (-356.027) (-352.713) [-354.894] -- 0:00:08
357000 -- (-357.767) (-357.504) (-357.221) [-353.275] * (-359.633) [-352.595] (-354.932) (-355.938) -- 0:00:08
357500 -- (-359.938) (-356.728) [-356.251] (-354.527) * [-355.259] (-355.305) (-353.295) (-355.688) -- 0:00:08
358000 -- [-353.671] (-353.911) (-356.336) (-361.449) * (-353.137) (-356.726) [-353.689] (-356.933) -- 0:00:08
358500 -- (-355.097) (-353.649) [-354.683] (-356.150) * (-353.667) (-355.856) [-354.300] (-355.615) -- 0:00:08
359000 -- (-357.149) [-352.794] (-355.468) (-356.872) * (-352.664) (-360.420) [-353.875] (-357.192) -- 0:00:08
359500 -- (-356.271) (-357.041) (-354.751) [-352.974] * (-355.011) (-360.016) [-355.486] (-355.650) -- 0:00:08
360000 -- [-353.159] (-355.432) (-357.428) (-355.837) * (-357.079) (-362.471) [-354.492] (-356.604) -- 0:00:08
Average standard deviation of split frequencies: 0.012780
360500 -- (-354.459) [-352.676] (-355.223) (-353.691) * (-353.848) [-353.523] (-354.880) (-357.356) -- 0:00:08
361000 -- [-355.825] (-353.386) (-352.686) (-352.470) * (-355.678) [-357.649] (-355.436) (-353.171) -- 0:00:08
361500 -- (-357.610) (-355.687) [-352.968] (-355.317) * (-357.093) (-355.493) [-359.045] (-354.385) -- 0:00:08
362000 -- (-358.920) [-354.479] (-357.227) (-355.288) * (-358.188) [-353.005] (-356.005) (-353.041) -- 0:00:08
362500 -- (-356.998) (-356.218) [-355.457] (-352.504) * [-354.787] (-356.608) (-352.464) (-353.027) -- 0:00:08
363000 -- (-353.770) (-356.146) (-353.588) [-352.104] * (-353.233) (-361.556) (-352.996) [-353.934] -- 0:00:08
363500 -- (-354.598) [-353.905] (-355.866) (-352.191) * (-357.371) (-355.663) [-352.551] (-352.754) -- 0:00:08
364000 -- (-353.033) (-353.250) [-353.638] (-353.038) * (-353.373) (-353.411) [-354.758] (-353.061) -- 0:00:08
364500 -- (-354.562) (-353.738) [-353.754] (-352.333) * (-353.279) (-352.632) (-353.726) [-356.799] -- 0:00:08
365000 -- (-356.308) (-356.168) [-352.783] (-353.266) * (-355.760) [-354.160] (-360.599) (-353.819) -- 0:00:08
Average standard deviation of split frequencies: 0.012379
365500 -- (-355.415) (-354.467) [-352.737] (-353.375) * [-353.434] (-354.291) (-356.563) (-353.873) -- 0:00:08
366000 -- [-355.349] (-353.788) (-352.852) (-355.808) * [-354.987] (-354.011) (-357.140) (-353.595) -- 0:00:08
366500 -- (-355.502) (-355.798) (-353.818) [-352.844] * (-354.631) (-357.991) (-362.831) [-352.997] -- 0:00:08
367000 -- (-356.250) (-353.885) (-353.589) [-354.600] * (-356.202) [-355.025] (-357.066) (-355.308) -- 0:00:08
367500 -- (-355.092) (-353.972) [-353.247] (-353.676) * (-355.614) (-358.526) [-357.261] (-354.929) -- 0:00:08
368000 -- [-355.158] (-352.922) (-353.557) (-356.319) * [-352.666] (-354.000) (-353.972) (-355.567) -- 0:00:08
368500 -- [-354.793] (-354.152) (-352.888) (-354.918) * (-353.622) [-357.855] (-352.638) (-358.328) -- 0:00:08
369000 -- (-356.731) (-358.480) [-354.720] (-354.481) * (-357.264) (-355.932) [-353.494] (-357.320) -- 0:00:08
369500 -- (-352.707) (-362.257) (-354.020) [-354.246] * (-362.288) (-355.532) [-355.603] (-353.818) -- 0:00:08
370000 -- [-353.097] (-353.798) (-355.920) (-353.693) * (-354.845) (-354.098) (-355.497) [-352.367] -- 0:00:08
Average standard deviation of split frequencies: 0.013071
370500 -- (-354.636) (-353.556) (-352.640) [-353.568] * (-354.420) (-353.214) [-352.975] (-352.182) -- 0:00:08
371000 -- [-352.781] (-357.251) (-354.506) (-355.320) * (-359.843) [-353.012] (-355.123) (-357.405) -- 0:00:07
371500 -- (-356.088) (-358.752) [-354.128] (-356.993) * (-359.644) [-355.184] (-354.583) (-359.866) -- 0:00:07
372000 -- [-355.157] (-357.742) (-354.915) (-353.508) * (-354.372) (-354.363) (-358.796) [-352.989] -- 0:00:07
372500 -- (-353.567) (-359.889) [-354.674] (-354.785) * (-354.376) (-353.842) (-357.428) [-358.042] -- 0:00:07
373000 -- [-353.018] (-355.713) (-359.381) (-353.819) * (-354.955) (-357.080) (-353.433) [-353.625] -- 0:00:07
373500 -- (-353.335) (-358.352) (-354.668) [-353.527] * (-354.707) (-354.468) (-355.140) [-354.799] -- 0:00:07
374000 -- [-355.807] (-355.949) (-354.425) (-355.388) * (-354.388) [-354.591] (-358.810) (-356.392) -- 0:00:07
374500 -- (-352.576) (-355.141) (-354.030) [-354.048] * [-357.847] (-352.771) (-354.973) (-354.549) -- 0:00:07
375000 -- [-357.380] (-356.903) (-354.232) (-355.312) * (-354.636) [-354.694] (-359.141) (-353.259) -- 0:00:07
Average standard deviation of split frequencies: 0.013197
375500 -- (-355.658) (-352.563) (-355.039) [-353.274] * (-360.161) (-353.213) (-357.848) [-354.870] -- 0:00:07
376000 -- [-355.241] (-352.942) (-355.054) (-356.741) * (-352.860) (-354.985) [-355.223] (-357.969) -- 0:00:07
376500 -- (-353.688) [-353.203] (-353.986) (-355.500) * [-355.459] (-354.616) (-355.688) (-354.682) -- 0:00:07
377000 -- (-353.233) (-353.438) (-355.004) [-355.782] * (-355.288) (-354.252) (-355.048) [-354.147] -- 0:00:07
377500 -- (-352.972) (-357.056) [-356.328] (-355.707) * (-354.241) (-355.309) [-354.923] (-354.510) -- 0:00:07
378000 -- (-352.567) [-355.869] (-353.766) (-357.574) * [-353.748] (-355.441) (-353.328) (-356.672) -- 0:00:07
378500 -- (-353.644) (-354.349) (-353.032) [-353.926] * [-354.596] (-355.026) (-352.915) (-356.978) -- 0:00:07
379000 -- (-353.081) [-353.473] (-355.414) (-355.659) * [-355.359] (-355.658) (-352.138) (-352.649) -- 0:00:07
379500 -- [-355.829] (-354.319) (-354.398) (-354.104) * [-354.662] (-359.548) (-352.349) (-356.521) -- 0:00:07
380000 -- [-352.762] (-354.517) (-353.508) (-354.608) * (-354.284) (-353.135) (-353.925) [-357.683] -- 0:00:07
Average standard deviation of split frequencies: 0.012590
380500 -- [-353.019] (-353.598) (-357.063) (-353.569) * (-352.711) (-353.888) (-354.020) [-354.808] -- 0:00:07
381000 -- (-354.141) [-353.063] (-352.774) (-355.210) * [-354.188] (-354.953) (-355.228) (-354.156) -- 0:00:07
381500 -- (-356.451) (-352.797) (-355.096) [-353.120] * (-354.486) (-353.801) (-353.928) [-357.870] -- 0:00:07
382000 -- (-362.065) [-354.930] (-354.431) (-356.725) * (-353.237) (-354.614) (-355.381) [-353.695] -- 0:00:07
382500 -- (-353.884) (-355.734) (-355.917) [-358.245] * (-353.303) [-356.089] (-354.150) (-352.788) -- 0:00:07
383000 -- (-353.787) (-354.766) [-355.096] (-356.089) * (-353.262) (-358.003) [-353.207] (-355.635) -- 0:00:07
383500 -- [-354.098] (-353.403) (-354.275) (-355.400) * (-353.240) [-353.634] (-360.144) (-355.529) -- 0:00:07
384000 -- (-355.916) [-354.606] (-352.310) (-354.777) * [-354.837] (-354.806) (-355.071) (-355.764) -- 0:00:07
384500 -- (-353.929) (-355.305) (-354.044) [-355.403] * (-352.587) (-357.621) (-353.443) [-356.352] -- 0:00:07
385000 -- (-355.697) (-356.210) [-355.201] (-354.652) * [-356.340] (-354.512) (-353.428) (-353.401) -- 0:00:07
Average standard deviation of split frequencies: 0.011738
385500 -- (-356.101) (-357.825) (-352.636) [-353.895] * [-354.437] (-352.767) (-359.781) (-354.212) -- 0:00:07
386000 -- (-354.960) [-355.163] (-354.081) (-354.970) * [-357.047] (-355.111) (-356.174) (-354.105) -- 0:00:07
386500 -- [-353.144] (-354.787) (-355.536) (-361.059) * (-354.461) (-353.255) [-352.452] (-356.548) -- 0:00:07
387000 -- (-355.416) (-353.034) [-357.095] (-357.385) * (-352.933) (-354.773) [-355.678] (-352.777) -- 0:00:07
387500 -- (-354.192) [-353.932] (-355.663) (-355.816) * (-354.646) (-353.881) (-359.551) [-353.529] -- 0:00:06
388000 -- (-352.664) (-356.998) (-354.520) [-356.112] * (-355.005) (-356.967) [-352.265] (-354.316) -- 0:00:06
388500 -- (-355.503) [-356.258] (-354.980) (-361.237) * [-353.814] (-356.871) (-355.675) (-355.976) -- 0:00:06
389000 -- (-354.733) [-355.468] (-352.102) (-354.978) * (-356.683) (-354.257) [-355.001] (-356.442) -- 0:00:06
389500 -- (-363.151) (-358.282) [-352.580] (-354.331) * (-353.830) (-358.462) (-355.363) [-353.275] -- 0:00:06
390000 -- (-362.103) [-354.382] (-352.518) (-355.637) * (-355.577) (-353.911) (-352.992) [-356.652] -- 0:00:06
Average standard deviation of split frequencies: 0.012564
390500 -- [-355.450] (-352.970) (-354.776) (-354.243) * (-358.267) (-356.083) [-354.129] (-355.535) -- 0:00:06
391000 -- (-355.251) (-355.100) [-355.166] (-357.374) * (-355.391) [-354.248] (-354.882) (-358.004) -- 0:00:06
391500 -- (-354.378) [-354.888] (-353.248) (-354.333) * [-358.414] (-353.707) (-355.896) (-353.947) -- 0:00:06
392000 -- (-363.718) (-352.591) [-353.218] (-354.078) * (-354.982) (-353.377) [-353.653] (-352.815) -- 0:00:06
392500 -- (-354.928) (-354.893) (-353.241) [-353.742] * [-353.027] (-352.936) (-353.899) (-355.225) -- 0:00:06
393000 -- (-355.244) (-352.441) [-355.709] (-356.197) * (-356.676) (-357.430) [-354.161] (-354.275) -- 0:00:06
393500 -- [-354.845] (-352.492) (-356.696) (-354.662) * (-355.646) [-354.408] (-353.910) (-358.424) -- 0:00:06
394000 -- (-354.199) (-354.019) [-356.013] (-353.159) * (-354.892) [-353.166] (-354.871) (-353.631) -- 0:00:06
394500 -- (-354.622) (-353.737) (-353.537) [-354.229] * [-356.843] (-352.481) (-359.240) (-360.769) -- 0:00:06
395000 -- (-356.100) (-353.130) (-359.588) [-354.212] * (-357.007) (-353.150) (-354.272) [-356.483] -- 0:00:06
Average standard deviation of split frequencies: 0.012464
395500 -- (-352.905) (-352.932) [-357.056] (-354.712) * (-353.762) [-355.187] (-356.644) (-353.000) -- 0:00:06
396000 -- (-353.831) (-352.720) (-354.353) [-353.209] * (-353.022) (-355.239) [-358.493] (-355.996) -- 0:00:06
396500 -- (-354.341) [-352.507] (-352.932) (-355.449) * (-353.534) (-361.979) (-353.278) [-354.357] -- 0:00:06
397000 -- (-354.053) [-354.375] (-358.617) (-354.743) * (-357.134) [-352.487] (-355.587) (-358.023) -- 0:00:06
397500 -- (-353.327) (-358.475) (-353.821) [-355.389] * (-352.729) (-355.276) [-352.802] (-354.588) -- 0:00:06
398000 -- (-353.585) [-358.518] (-353.317) (-356.683) * (-355.991) (-354.474) (-355.610) [-353.281] -- 0:00:06
398500 -- (-352.660) (-354.978) (-354.096) [-354.738] * [-355.185] (-353.915) (-355.250) (-358.026) -- 0:00:06
399000 -- (-355.107) (-361.597) (-354.075) [-353.664] * (-353.541) [-353.057] (-354.540) (-358.205) -- 0:00:06
399500 -- [-354.684] (-353.304) (-354.712) (-355.256) * [-352.641] (-353.478) (-354.414) (-354.689) -- 0:00:06
400000 -- [-354.248] (-353.114) (-358.271) (-355.276) * (-353.095) [-353.551] (-353.783) (-353.087) -- 0:00:06
Average standard deviation of split frequencies: 0.012042
400500 -- (-359.327) (-354.754) [-357.858] (-352.605) * (-352.835) [-353.526] (-355.173) (-353.351) -- 0:00:06
401000 -- (-352.914) (-354.826) (-353.810) [-352.701] * (-356.206) (-355.634) (-356.307) [-353.016] -- 0:00:06
401500 -- (-352.621) (-354.738) [-354.902] (-356.500) * (-353.673) [-354.139] (-357.856) (-354.209) -- 0:00:06
402000 -- [-355.195] (-355.655) (-353.597) (-355.500) * (-356.537) [-357.288] (-353.392) (-355.603) -- 0:00:06
402500 -- (-357.586) (-353.287) [-355.322] (-354.536) * (-355.533) [-353.119] (-353.639) (-354.634) -- 0:00:06
403000 -- (-354.402) (-353.871) [-355.248] (-353.583) * (-358.211) (-358.717) [-352.922] (-354.191) -- 0:00:06
403500 -- (-355.873) (-353.360) (-354.055) [-352.805] * (-355.722) (-355.317) [-352.280] (-357.706) -- 0:00:05
404000 -- [-353.904] (-354.054) (-355.936) (-354.194) * (-359.359) (-353.223) [-355.608] (-355.459) -- 0:00:05
404500 -- (-356.024) [-353.119] (-353.448) (-352.961) * (-354.133) (-362.968) [-355.849] (-355.490) -- 0:00:05
405000 -- (-354.335) (-352.489) (-355.230) [-358.989] * (-356.207) (-358.475) (-354.437) [-355.514] -- 0:00:05
Average standard deviation of split frequencies: 0.012021
405500 -- (-355.794) [-356.706] (-356.279) (-353.979) * [-353.456] (-353.680) (-354.802) (-354.463) -- 0:00:05
406000 -- (-355.853) (-356.585) [-352.785] (-357.623) * [-355.146] (-353.895) (-355.154) (-353.763) -- 0:00:05
406500 -- [-355.712] (-358.182) (-358.322) (-353.270) * (-358.260) (-355.055) [-353.553] (-355.038) -- 0:00:05
407000 -- [-354.033] (-354.044) (-356.187) (-354.376) * (-354.188) [-354.684] (-355.187) (-360.034) -- 0:00:05
407500 -- (-353.687) (-355.545) [-355.454] (-353.150) * (-354.002) [-354.605] (-355.965) (-361.228) -- 0:00:05
408000 -- (-354.464) (-352.930) [-354.900] (-354.857) * (-353.728) (-352.545) (-355.195) [-357.059] -- 0:00:05
408500 -- (-355.663) [-353.665] (-354.997) (-355.268) * (-360.896) (-352.618) [-353.099] (-354.878) -- 0:00:05
409000 -- (-354.246) (-353.323) [-352.521] (-353.801) * (-360.251) (-358.171) (-357.156) [-354.996] -- 0:00:05
409500 -- [-354.188] (-354.032) (-356.547) (-359.121) * [-356.260] (-360.125) (-355.952) (-353.111) -- 0:00:05
410000 -- [-355.682] (-356.849) (-353.193) (-357.000) * [-356.153] (-354.422) (-354.105) (-355.156) -- 0:00:05
Average standard deviation of split frequencies: 0.011479
410500 -- (-354.494) [-356.415] (-353.929) (-357.190) * (-355.650) (-353.111) (-353.835) [-354.487] -- 0:00:05
411000 -- (-356.000) (-353.597) [-353.809] (-353.504) * (-357.019) (-352.386) [-354.704] (-356.401) -- 0:00:05
411500 -- (-362.227) (-352.779) (-354.157) [-353.459] * (-356.684) [-355.039] (-355.204) (-355.964) -- 0:00:05
412000 -- [-356.944] (-355.384) (-352.823) (-355.630) * (-358.336) (-353.874) (-352.839) [-353.557] -- 0:00:05
412500 -- (-355.968) [-354.498] (-353.864) (-355.874) * (-356.471) (-355.659) (-357.159) [-352.294] -- 0:00:05
413000 -- (-353.058) (-357.560) [-352.768] (-356.447) * (-356.952) (-355.937) (-354.923) [-357.925] -- 0:00:05
413500 -- (-356.451) (-355.045) [-352.542] (-355.632) * (-355.975) (-354.560) (-353.050) [-355.482] -- 0:00:05
414000 -- (-354.941) [-356.893] (-354.183) (-355.070) * (-354.930) (-355.893) (-353.933) [-360.476] -- 0:00:05
414500 -- (-354.875) (-357.778) [-353.321] (-356.329) * [-354.160] (-360.148) (-355.245) (-355.273) -- 0:00:05
415000 -- [-358.378] (-352.670) (-352.665) (-360.542) * (-353.094) (-355.745) (-355.181) [-355.575] -- 0:00:05
Average standard deviation of split frequencies: 0.010765
415500 -- (-355.940) [-356.119] (-355.709) (-357.284) * (-354.584) (-353.342) (-356.357) [-355.641] -- 0:00:05
416000 -- (-352.933) (-357.302) (-356.342) [-353.044] * (-352.683) (-352.709) [-355.602] (-354.996) -- 0:00:05
416500 -- (-358.342) [-357.195] (-353.954) (-353.913) * [-354.841] (-356.271) (-354.840) (-354.549) -- 0:00:05
417000 -- [-356.231] (-356.294) (-363.154) (-352.631) * (-353.947) (-357.336) [-354.445] (-356.513) -- 0:00:05
417500 -- (-357.590) [-352.964] (-362.742) (-352.632) * (-352.949) (-357.164) [-352.982] (-354.504) -- 0:00:05
418000 -- (-354.406) [-357.162] (-354.505) (-355.612) * [-353.799] (-354.737) (-354.291) (-352.897) -- 0:00:05
418500 -- [-355.453] (-354.191) (-353.781) (-358.139) * (-352.736) [-354.822] (-357.076) (-356.895) -- 0:00:05
419000 -- (-353.378) (-358.323) (-353.002) [-354.089] * (-354.789) (-354.398) (-353.886) [-353.770] -- 0:00:05
419500 -- (-357.120) (-353.136) (-354.762) [-355.303] * (-353.901) (-354.691) (-353.017) [-352.796] -- 0:00:04
420000 -- (-353.527) (-356.228) (-354.737) [-354.303] * (-356.977) [-355.805] (-354.912) (-356.125) -- 0:00:04
Average standard deviation of split frequencies: 0.011206
420500 -- (-354.223) (-357.803) [-354.599] (-355.418) * (-356.271) (-354.550) [-352.735] (-355.442) -- 0:00:04
421000 -- (-354.579) (-361.196) [-357.622] (-353.995) * (-354.246) (-354.230) (-355.566) [-354.721] -- 0:00:04
421500 -- (-353.423) [-355.209] (-358.502) (-356.659) * (-354.102) [-353.547] (-353.900) (-356.102) -- 0:00:04
422000 -- (-358.485) (-354.330) [-354.664] (-353.515) * (-352.918) (-353.830) (-355.114) [-356.940] -- 0:00:04
422500 -- (-358.098) [-353.894] (-352.869) (-355.320) * [-355.407] (-353.358) (-356.072) (-354.777) -- 0:00:04
423000 -- (-355.241) (-356.266) (-354.493) [-355.129] * [-355.596] (-353.894) (-352.221) (-355.437) -- 0:00:04
423500 -- (-354.017) (-354.499) [-354.930] (-353.282) * [-352.797] (-354.510) (-352.936) (-354.526) -- 0:00:04
424000 -- (-355.717) (-353.844) (-355.194) [-357.088] * (-352.742) [-352.853] (-356.202) (-354.819) -- 0:00:04
424500 -- [-354.267] (-354.509) (-352.651) (-354.489) * [-353.288] (-354.037) (-353.700) (-354.243) -- 0:00:04
425000 -- [-353.640] (-357.221) (-353.605) (-353.176) * [-361.352] (-355.255) (-353.179) (-354.426) -- 0:00:04
Average standard deviation of split frequencies: 0.011312
425500 -- (-353.615) (-357.155) [-354.084] (-356.761) * (-354.643) (-356.235) (-355.166) [-354.143] -- 0:00:04
426000 -- (-353.047) (-357.195) [-356.096] (-357.471) * (-355.052) (-355.629) [-361.848] (-354.788) -- 0:00:04
426500 -- (-353.972) (-354.449) (-358.814) [-356.930] * (-353.173) (-355.069) (-358.172) [-354.718] -- 0:00:04
427000 -- (-354.075) (-355.933) (-354.696) [-358.739] * [-354.648] (-354.664) (-353.144) (-356.111) -- 0:00:04
427500 -- (-355.040) [-354.386] (-353.246) (-359.346) * (-354.021) (-354.635) (-356.403) [-355.545] -- 0:00:04
428000 -- (-355.662) [-353.431] (-354.571) (-353.360) * (-356.856) [-354.425] (-354.707) (-357.109) -- 0:00:04
428500 -- (-357.763) [-353.483] (-355.263) (-356.444) * (-355.159) (-353.988) [-352.455] (-354.798) -- 0:00:04
429000 -- (-352.743) (-354.046) [-354.597] (-359.785) * [-354.786] (-354.771) (-357.759) (-353.217) -- 0:00:04
429500 -- (-355.639) [-352.685] (-355.384) (-360.239) * (-354.710) (-352.234) (-354.145) [-353.452] -- 0:00:04
430000 -- [-355.363] (-359.278) (-353.628) (-362.912) * (-353.269) (-355.160) (-355.286) [-356.435] -- 0:00:04
Average standard deviation of split frequencies: 0.011736
430500 -- (-356.085) (-360.435) (-352.586) [-353.107] * (-353.472) (-357.045) (-353.294) [-353.453] -- 0:00:04
431000 -- (-352.620) (-356.494) (-352.837) [-353.685] * (-354.567) (-354.837) [-355.360] (-356.017) -- 0:00:04
431500 -- (-355.560) [-354.418] (-354.825) (-354.941) * (-353.573) [-355.621] (-353.904) (-354.231) -- 0:00:04
432000 -- (-360.250) [-353.408] (-353.507) (-353.188) * (-353.105) (-355.822) [-354.644] (-353.444) -- 0:00:04
432500 -- [-355.512] (-354.564) (-355.137) (-352.910) * [-354.190] (-354.696) (-354.085) (-354.835) -- 0:00:04
433000 -- (-356.406) (-353.948) (-356.367) [-352.925] * (-356.095) (-357.193) (-354.407) [-352.932] -- 0:00:04
433500 -- (-354.738) (-352.603) [-357.731] (-356.558) * [-358.166] (-355.079) (-358.719) (-362.048) -- 0:00:04
434000 -- (-356.823) [-353.725] (-356.444) (-354.383) * (-358.753) [-352.649] (-354.096) (-358.919) -- 0:00:04
434500 -- (-353.308) (-353.947) [-352.891] (-352.453) * (-353.101) (-352.561) [-354.940] (-355.679) -- 0:00:04
435000 -- [-354.032] (-354.412) (-355.783) (-357.358) * [-355.620] (-354.952) (-353.764) (-352.623) -- 0:00:04
Average standard deviation of split frequencies: 0.011893
435500 -- [-354.957] (-357.370) (-354.931) (-356.387) * (-354.004) (-356.140) (-353.884) [-356.140] -- 0:00:03
436000 -- (-356.272) [-354.584] (-353.193) (-353.230) * (-358.593) (-354.127) [-353.916] (-352.638) -- 0:00:03
436500 -- (-355.042) (-357.235) (-355.348) [-355.591] * (-352.475) (-354.251) [-355.902] (-356.774) -- 0:00:03
437000 -- (-353.690) (-353.026) (-354.561) [-356.127] * (-357.841) (-359.658) [-354.546] (-352.264) -- 0:00:03
437500 -- (-354.159) (-355.271) (-353.470) [-352.875] * (-354.811) (-355.888) [-352.864] (-355.342) -- 0:00:03
438000 -- (-357.716) (-357.422) [-353.695] (-353.824) * (-354.658) (-358.571) (-352.758) [-353.315] -- 0:00:03
438500 -- (-356.296) [-355.601] (-352.865) (-355.281) * (-354.566) (-355.661) [-353.412] (-353.531) -- 0:00:03
439000 -- [-353.825] (-354.097) (-354.026) (-354.990) * [-356.782] (-355.834) (-353.774) (-354.303) -- 0:00:03
439500 -- (-354.692) (-357.227) [-356.989] (-352.424) * (-354.036) (-356.062) (-355.322) [-354.533] -- 0:00:03
440000 -- (-355.385) [-353.955] (-356.258) (-353.400) * (-354.582) [-353.356] (-353.171) (-354.597) -- 0:00:03
Average standard deviation of split frequencies: 0.012334
440500 -- (-356.018) [-354.399] (-353.700) (-354.195) * (-353.459) [-356.053] (-353.381) (-354.113) -- 0:00:03
441000 -- [-353.474] (-357.207) (-354.257) (-355.751) * (-357.194) [-353.419] (-354.227) (-352.850) -- 0:00:03
441500 -- [-356.279] (-356.117) (-353.918) (-353.484) * (-354.024) (-353.307) (-354.770) [-352.780] -- 0:00:03
442000 -- (-353.017) [-355.657] (-356.074) (-354.918) * (-353.430) (-357.165) [-353.053] (-352.880) -- 0:00:03
442500 -- (-358.134) (-354.448) (-355.783) [-353.893] * (-353.578) [-355.387] (-352.280) (-353.158) -- 0:00:03
443000 -- (-354.522) (-357.245) [-353.964] (-356.531) * (-353.709) (-357.605) (-354.485) [-356.150] -- 0:00:03
443500 -- (-353.003) (-354.253) (-355.830) [-353.496] * [-354.211] (-356.479) (-355.839) (-359.859) -- 0:00:03
444000 -- (-353.015) (-355.104) (-352.878) [-359.203] * (-353.055) [-353.499] (-355.863) (-356.498) -- 0:00:03
444500 -- [-355.685] (-354.229) (-354.400) (-354.545) * (-357.540) [-352.787] (-353.006) (-353.441) -- 0:00:03
445000 -- (-355.411) [-358.264] (-353.215) (-354.827) * (-353.807) [-355.080] (-356.502) (-352.686) -- 0:00:03
Average standard deviation of split frequencies: 0.011039
445500 -- (-356.585) (-360.351) [-354.759] (-353.358) * [-355.746] (-356.010) (-355.855) (-354.471) -- 0:00:03
446000 -- (-359.151) (-354.047) (-358.451) [-355.571] * (-354.800) (-358.626) [-353.865] (-354.975) -- 0:00:03
446500 -- (-356.668) [-356.555] (-356.080) (-357.642) * (-355.389) [-354.862] (-354.280) (-354.161) -- 0:00:03
447000 -- (-355.940) (-355.931) [-355.228] (-355.160) * (-354.711) [-355.062] (-355.182) (-355.947) -- 0:00:03
447500 -- [-353.544] (-356.486) (-354.416) (-353.425) * (-352.563) (-358.820) [-353.365] (-352.674) -- 0:00:03
448000 -- (-354.689) (-359.097) [-355.372] (-356.839) * (-354.953) (-357.081) [-352.588] (-353.702) -- 0:00:03
448500 -- (-354.089) (-356.517) (-357.694) [-353.319] * (-355.229) [-353.074] (-354.515) (-354.714) -- 0:00:03
449000 -- [-353.452] (-353.752) (-353.510) (-354.792) * (-355.917) (-353.590) (-354.303) [-352.546] -- 0:00:03
449500 -- (-353.997) (-353.431) [-356.413] (-358.188) * (-353.965) (-354.230) (-355.119) [-354.685] -- 0:00:03
450000 -- (-354.758) (-356.267) [-352.785] (-355.906) * (-354.106) [-352.972] (-355.455) (-352.447) -- 0:00:03
Average standard deviation of split frequencies: 0.010809
450500 -- (-355.868) [-356.612] (-354.318) (-356.714) * [-356.470] (-355.699) (-354.619) (-358.260) -- 0:00:03
451000 -- (-354.800) [-358.349] (-355.830) (-354.855) * [-355.870] (-353.609) (-354.402) (-355.116) -- 0:00:03
451500 -- (-354.657) (-352.957) [-354.424] (-354.628) * (-359.083) [-353.149] (-354.412) (-356.416) -- 0:00:03
452000 -- [-354.514] (-353.167) (-353.945) (-357.095) * [-355.123] (-353.421) (-357.919) (-353.166) -- 0:00:02
452500 -- [-354.023] (-352.951) (-354.063) (-357.505) * (-354.079) [-353.069] (-358.225) (-353.741) -- 0:00:02
453000 -- (-356.134) [-352.488] (-353.693) (-356.304) * (-353.544) (-354.318) [-353.470] (-355.199) -- 0:00:02
453500 -- (-355.421) [-353.347] (-354.811) (-353.432) * (-353.318) [-356.129] (-353.917) (-352.801) -- 0:00:02
454000 -- (-355.059) (-353.144) [-356.652] (-357.054) * (-355.552) (-353.798) (-353.937) [-354.338] -- 0:00:02
454500 -- (-354.108) [-352.485] (-354.092) (-355.780) * [-352.615] (-354.370) (-358.394) (-356.250) -- 0:00:02
455000 -- [-354.851] (-352.960) (-354.771) (-354.009) * (-355.547) (-354.751) [-353.200] (-354.346) -- 0:00:02
Average standard deviation of split frequencies: 0.011142
455500 -- (-353.492) (-353.357) (-355.367) [-354.256] * (-361.732) (-356.029) [-354.237] (-355.631) -- 0:00:02
456000 -- (-353.749) [-354.629] (-355.782) (-352.870) * [-353.457] (-352.677) (-355.174) (-353.409) -- 0:00:02
456500 -- (-353.354) (-353.795) [-353.984] (-352.955) * (-355.471) [-353.941] (-353.969) (-357.275) -- 0:00:02
457000 -- [-353.610] (-352.964) (-353.722) (-355.103) * (-354.424) [-355.795] (-353.209) (-355.582) -- 0:00:02
457500 -- (-356.831) [-353.886] (-353.626) (-352.467) * (-354.844) (-355.058) [-353.571] (-353.759) -- 0:00:02
458000 -- (-354.059) (-354.036) [-354.429] (-353.545) * (-355.599) [-353.127] (-356.709) (-353.759) -- 0:00:02
458500 -- (-353.595) (-353.712) (-354.348) [-352.748] * (-355.264) [-352.690] (-355.335) (-353.383) -- 0:00:02
459000 -- (-356.389) (-353.619) [-357.715] (-353.619) * (-353.296) (-353.851) [-354.528] (-354.958) -- 0:00:02
459500 -- [-352.540] (-352.484) (-356.503) (-354.435) * [-353.627] (-353.063) (-354.414) (-352.953) -- 0:00:02
460000 -- (-354.902) (-353.990) (-355.163) [-355.021] * (-354.224) (-356.461) [-352.810] (-352.409) -- 0:00:02
Average standard deviation of split frequencies: 0.011939
460500 -- (-353.898) (-356.348) (-356.837) [-353.638] * (-353.031) (-353.908) (-356.997) [-353.630] -- 0:00:02
461000 -- (-352.200) (-358.309) (-352.979) [-355.296] * (-352.491) [-354.940] (-354.653) (-353.410) -- 0:00:02
461500 -- [-355.210] (-357.473) (-355.250) (-353.258) * [-352.634] (-352.599) (-354.123) (-353.381) -- 0:00:02
462000 -- [-357.185] (-356.530) (-353.725) (-358.347) * (-354.070) (-352.907) [-357.171] (-352.839) -- 0:00:02
462500 -- (-354.549) (-354.743) (-355.611) [-355.697] * [-353.263] (-356.170) (-353.184) (-354.459) -- 0:00:02
463000 -- (-352.349) [-354.344] (-353.528) (-353.819) * [-352.901] (-354.453) (-354.501) (-362.826) -- 0:00:02
463500 -- [-355.291] (-355.017) (-353.612) (-355.960) * (-352.586) (-352.255) [-355.793] (-353.815) -- 0:00:02
464000 -- [-354.398] (-353.962) (-354.348) (-357.119) * (-353.406) [-352.662] (-352.382) (-356.730) -- 0:00:02
464500 -- (-354.057) (-357.712) (-355.480) [-357.531] * [-353.998] (-353.336) (-358.946) (-354.700) -- 0:00:02
465000 -- (-353.238) [-354.876] (-355.895) (-354.382) * (-356.979) [-354.023] (-360.234) (-355.188) -- 0:00:02
Average standard deviation of split frequencies: 0.010903
465500 -- [-353.956] (-353.818) (-353.430) (-356.829) * (-354.382) (-353.186) (-358.918) [-352.443] -- 0:00:02
466000 -- (-355.326) [-354.234] (-353.830) (-358.045) * (-352.871) [-352.424] (-353.697) (-361.323) -- 0:00:02
466500 -- (-353.945) [-353.634] (-357.381) (-357.811) * [-352.821] (-358.686) (-356.780) (-358.284) -- 0:00:02
467000 -- [-353.900] (-357.236) (-353.721) (-357.043) * (-355.008) (-356.602) (-354.376) [-358.478] -- 0:00:02
467500 -- (-354.418) (-353.487) [-355.520] (-354.733) * [-354.317] (-353.326) (-358.654) (-361.751) -- 0:00:02
468000 -- (-355.150) (-352.688) [-353.734] (-355.343) * [-353.474] (-353.735) (-356.765) (-353.196) -- 0:00:01
468500 -- (-354.209) (-354.313) (-356.597) [-354.020] * (-358.110) (-353.179) [-354.474] (-352.762) -- 0:00:01
469000 -- (-353.227) (-356.661) (-353.278) [-353.499] * (-357.083) (-354.951) (-355.390) [-353.155] -- 0:00:01
469500 -- (-353.528) (-354.729) (-353.537) [-353.051] * (-352.453) [-354.565] (-353.381) (-353.713) -- 0:00:01
470000 -- (-353.852) (-353.666) [-356.272] (-355.767) * (-352.275) (-355.845) (-354.578) [-353.963] -- 0:00:01
Average standard deviation of split frequencies: 0.010683
470500 -- [-353.509] (-353.569) (-352.574) (-357.926) * (-358.501) [-352.973] (-352.507) (-354.097) -- 0:00:01
471000 -- [-353.082] (-357.048) (-353.801) (-353.648) * (-354.545) (-353.191) (-355.140) [-352.925] -- 0:00:01
471500 -- (-356.095) (-356.295) [-354.329] (-352.354) * (-354.195) (-363.048) (-353.432) [-354.442] -- 0:00:01
472000 -- (-355.735) [-353.234] (-355.951) (-360.436) * (-356.609) (-360.108) [-352.184] (-356.674) -- 0:00:01
472500 -- (-356.324) [-354.774] (-359.537) (-353.559) * (-359.709) (-354.513) [-354.162] (-358.204) -- 0:00:01
473000 -- [-354.138] (-356.992) (-354.031) (-357.767) * (-357.771) [-354.369] (-356.425) (-353.215) -- 0:00:01
473500 -- (-352.587) (-355.438) (-352.345) [-353.512] * (-355.472) (-353.576) [-352.614] (-356.794) -- 0:00:01
474000 -- [-353.125] (-353.932) (-353.698) (-358.657) * (-354.165) (-353.812) (-353.620) [-354.820] -- 0:00:01
474500 -- (-353.302) (-353.646) [-353.148] (-354.612) * (-354.570) (-354.356) (-357.974) [-354.364] -- 0:00:01
475000 -- (-354.898) [-355.366] (-358.379) (-353.624) * (-354.371) (-354.123) (-353.025) [-353.830] -- 0:00:01
Average standard deviation of split frequencies: 0.010674
475500 -- (-354.380) [-354.617] (-356.138) (-360.273) * [-353.894] (-356.508) (-354.201) (-355.250) -- 0:00:01
476000 -- [-352.992] (-354.192) (-355.295) (-353.473) * (-358.532) [-355.378] (-355.232) (-355.314) -- 0:00:01
476500 -- (-353.088) (-356.419) [-355.458] (-358.241) * (-357.429) [-352.630] (-353.796) (-355.916) -- 0:00:01
477000 -- (-354.415) (-358.300) [-355.583] (-354.032) * (-354.781) (-353.524) (-356.311) [-352.542] -- 0:00:01
477500 -- (-353.849) (-358.068) (-357.385) [-356.424] * (-354.953) [-352.436] (-354.654) (-354.417) -- 0:00:01
478000 -- (-354.380) (-353.750) (-355.690) [-354.385] * (-356.304) (-356.815) [-353.155] (-353.820) -- 0:00:01
478500 -- [-357.409] (-354.358) (-355.406) (-353.802) * (-354.017) (-353.529) [-353.035] (-354.060) -- 0:00:01
479000 -- (-357.556) (-354.283) [-353.817] (-352.631) * (-354.788) (-353.607) [-357.654] (-355.103) -- 0:00:01
479500 -- (-357.974) (-354.328) [-353.526] (-354.720) * (-352.830) [-353.293] (-353.762) (-354.887) -- 0:00:01
480000 -- [-354.474] (-357.519) (-352.315) (-355.427) * (-353.260) (-355.458) [-353.003] (-357.481) -- 0:00:01
Average standard deviation of split frequencies: 0.010951
480500 -- (-355.147) (-355.190) (-354.216) [-353.736] * (-353.445) [-353.466] (-354.620) (-354.550) -- 0:00:01
481000 -- (-354.530) (-356.887) (-352.776) [-353.741] * [-353.580] (-355.004) (-354.455) (-355.438) -- 0:00:01
481500 -- [-353.614] (-356.447) (-353.366) (-353.538) * (-352.802) (-357.859) (-355.106) [-359.493] -- 0:00:01
482000 -- (-357.491) (-353.871) (-353.714) [-356.894] * (-353.379) (-356.210) (-359.362) [-354.158] -- 0:00:01
482500 -- (-353.884) [-354.752] (-353.217) (-355.224) * (-353.238) (-354.799) [-352.627] (-358.120) -- 0:00:01
483000 -- [-356.497] (-352.876) (-357.985) (-354.217) * [-353.290] (-353.950) (-355.180) (-356.807) -- 0:00:01
483500 -- (-363.594) [-354.014] (-353.159) (-358.364) * (-353.771) (-357.425) (-354.942) [-353.323] -- 0:00:01
484000 -- [-355.501] (-358.570) (-352.952) (-356.207) * [-355.150] (-356.398) (-353.705) (-352.420) -- 0:00:00
484500 -- (-355.294) (-354.732) [-354.367] (-356.220) * (-357.600) [-353.058] (-354.283) (-353.859) -- 0:00:00
485000 -- (-353.643) (-352.826) (-354.105) [-355.096] * (-354.090) [-353.077] (-354.421) (-354.744) -- 0:00:00
Average standard deviation of split frequencies: 0.010777
485500 -- (-353.098) [-353.658] (-353.213) (-353.087) * (-354.172) (-352.244) [-353.724] (-358.178) -- 0:00:00
486000 -- (-354.277) (-353.588) [-356.642] (-353.261) * [-354.071] (-355.059) (-356.710) (-356.412) -- 0:00:00
486500 -- (-353.450) [-353.744] (-354.699) (-353.594) * (-355.026) (-354.405) [-355.616] (-354.081) -- 0:00:00
487000 -- (-353.577) (-353.730) (-357.002) [-354.412] * (-356.094) [-355.384] (-355.397) (-353.488) -- 0:00:00
487500 -- [-354.063] (-353.275) (-354.459) (-352.506) * [-354.491] (-354.183) (-355.734) (-353.204) -- 0:00:00
488000 -- (-355.098) (-352.534) [-353.889] (-354.274) * (-356.106) [-355.378] (-358.012) (-354.056) -- 0:00:00
488500 -- (-354.836) [-353.373] (-353.999) (-355.619) * (-352.645) (-352.801) (-354.385) [-355.458] -- 0:00:00
489000 -- [-355.008] (-356.855) (-357.125) (-353.432) * (-356.170) [-352.847] (-353.527) (-354.646) -- 0:00:00
489500 -- (-356.353) [-354.267] (-356.633) (-355.755) * (-359.584) [-352.952] (-357.705) (-355.747) -- 0:00:00
490000 -- [-356.128] (-358.136) (-358.308) (-366.204) * (-355.296) [-353.953] (-353.132) (-356.789) -- 0:00:00
Average standard deviation of split frequencies: 0.010355
490500 -- (-361.733) [-352.247] (-352.618) (-355.949) * [-353.113] (-352.934) (-354.901) (-353.297) -- 0:00:00
491000 -- [-354.150] (-355.022) (-354.093) (-357.601) * (-355.777) [-354.517] (-352.816) (-354.069) -- 0:00:00
491500 -- (-358.991) (-352.921) (-353.415) [-355.727] * (-353.930) (-352.593) [-354.244] (-352.462) -- 0:00:00
492000 -- (-353.924) (-354.927) [-353.626] (-355.485) * [-355.404] (-355.236) (-352.533) (-353.917) -- 0:00:00
492500 -- (-354.426) (-356.085) (-353.569) [-353.241] * (-358.359) [-353.560] (-355.270) (-355.625) -- 0:00:00
493000 -- (-352.934) [-353.660] (-353.033) (-355.015) * [-358.776] (-353.822) (-358.892) (-354.420) -- 0:00:00
493500 -- [-356.099] (-352.489) (-353.696) (-357.205) * (-361.352) (-355.094) [-354.373] (-352.679) -- 0:00:00
494000 -- (-353.996) (-354.804) [-355.562] (-355.319) * [-353.516] (-352.489) (-354.763) (-353.984) -- 0:00:00
494500 -- (-352.654) [-355.990] (-356.478) (-354.996) * (-355.692) (-357.507) [-354.068] (-356.285) -- 0:00:00
495000 -- [-354.593] (-354.371) (-353.609) (-356.124) * (-352.935) (-356.847) [-352.807] (-357.144) -- 0:00:00
Average standard deviation of split frequencies: 0.010085
495500 -- (-357.275) (-357.277) (-355.609) [-354.720] * (-353.179) (-352.917) (-356.134) [-358.787] -- 0:00:00
496000 -- (-356.970) (-353.364) [-353.414] (-353.330) * [-354.182] (-353.522) (-357.034) (-354.965) -- 0:00:00
496500 -- (-354.646) (-355.237) (-353.381) [-353.119] * (-356.431) [-354.117] (-354.630) (-353.885) -- 0:00:00
497000 -- (-352.304) (-354.201) (-352.931) [-352.941] * (-356.192) (-353.878) [-353.534] (-354.755) -- 0:00:00
497500 -- (-353.494) [-353.481] (-354.258) (-360.256) * [-354.323] (-352.745) (-353.662) (-357.808) -- 0:00:00
498000 -- (-355.840) (-354.576) (-355.996) [-354.194] * [-354.315] (-353.446) (-352.459) (-353.083) -- 0:00:00
498500 -- [-354.961] (-356.714) (-352.695) (-354.247) * [-353.578] (-352.125) (-353.209) (-354.356) -- 0:00:00
499000 -- (-355.136) [-356.729] (-353.985) (-354.003) * (-353.411) (-352.750) (-354.811) [-354.742] -- 0:00:00
499500 -- (-355.518) [-356.611] (-358.468) (-353.706) * (-355.737) (-353.842) [-357.825] (-360.213) -- 0:00:00
500000 -- (-353.134) (-359.342) [-354.237] (-354.689) * (-353.416) (-352.891) [-353.053] (-354.323) -- 0:00:00
Average standard deviation of split frequencies: 0.010200
Analysis completed in 30 seconds
Analysis used 29.58 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -352.04
Likelihood of best state for "cold" chain of run 2 was -352.04
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
77.1 % ( 78 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
47.0 % ( 45 %) Dirichlet(Pi{all})
51.0 % ( 50 %) Slider(Pi{all})
88.8 % ( 85 %) Multiplier(Alpha{1,2})
87.7 % ( 85 %) Multiplier(Alpha{3})
27.1 % ( 35 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 86 %) ParsSPR(Tau{all},V{all})
30.7 % ( 20 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
35.8 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
78.6 % ( 78 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
48.7 % ( 38 %) Dirichlet(Pi{all})
50.0 % ( 41 %) Slider(Pi{all})
88.5 % ( 75 %) Multiplier(Alpha{1,2})
88.2 % ( 81 %) Multiplier(Alpha{3})
27.4 % ( 21 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.5 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 92 %) ParsSPR(Tau{all},V{all})
30.8 % ( 25 %) Multiplier(V{all})
97.3 % ( 99 %) Nodeslider(V{all})
35.6 % ( 32 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
------------------------------
1 | 0.80 0.64 0.50
2 | 83580 0.82 0.67
3 | 83206 83620 0.84
4 | 83310 82942 83342
Chain swap information for run 2:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83336 0.82 0.67
3 | 83133 83462 0.83
4 | 83240 83382 83447
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 1250
Summarizing parameters in files /data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -353.47
| 1 1 |
| 21 22 |
| 1 11 1 |
|1 1 1 1 1 1 2 1 2 22 |
| 2 2 2 1 1 1 1 1 2 2 |
| 12 122 2 2 2 2 2 1 |
|22 1 2 22 * 2 1 2 |
| 1 1 21 2 11 21 11 11 2*|
| 2 * 2 2 222 1 1 1 1 |
| 2 1 1 2 1 22 2 112 2 1 |
| 2 2 12 2 1 22 1 11 |
| *1 1 2 2 2 2 |
| 1 2 |
| 1 |
| 1 1 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -355.72
^ ^
125000 500000
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -353.81 -356.97
2 -353.78 -358.11
--------------------------------------
TOTAL -353.79 -357.69
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902798 0.096390 0.300389 1.470746 0.880071 613.22 682.11 1.001
r(A<->C){all} 0.160510 0.016336 0.000031 0.410524 0.135244 104.19 121.04 1.004
r(A<->G){all} 0.168778 0.019632 0.000027 0.436942 0.133099 64.73 86.96 1.001
r(A<->T){all} 0.161413 0.020453 0.000179 0.456322 0.121854 66.64 71.93 1.001
r(C<->G){all} 0.176883 0.021012 0.000033 0.484876 0.136256 162.92 166.64 1.013
r(C<->T){all} 0.161531 0.020227 0.000073 0.460411 0.119452 74.53 77.25 1.002
r(G<->T){all} 0.170884 0.019906 0.000083 0.444165 0.135226 20.54 59.57 1.007
pi(A){all} 0.223595 0.000671 0.173323 0.272403 0.222989 631.76 691.38 1.001
pi(C){all} 0.293134 0.000847 0.234124 0.346060 0.291736 618.95 684.98 1.001
pi(G){all} 0.252149 0.000724 0.198689 0.300618 0.252005 624.62 638.24 1.005
pi(T){all} 0.231122 0.000683 0.178899 0.279634 0.230479 506.07 552.28 0.999
alpha{1,2} 0.428932 0.246679 0.000343 1.350393 0.253785 353.67 427.23 1.003
alpha{3} 0.461477 0.234895 0.000308 1.408474 0.297966 417.77 454.54 1.000
pinvar{all} 0.993697 0.000053 0.980174 0.999995 0.995974 588.79 635.01 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 1250
Summarizing trees in files "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 2002 trees in 2 files (sampling 1502 of them)
(Each file contained 1001 trees of which 751 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- ..****
9 -- .*.*..
10 -- ....**
11 -- .**.**
12 -- ...*.*
13 -- ..**..
14 -- .*.***
15 -- ..*.*.
16 -- .*..*.
17 -- .**...
18 -- .****.
19 -- .***.*
20 -- ...**.
21 -- .*...*
22 -- .*..**
23 -- ..*.**
24 -- ..**.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 237 0.157790 0.017890 0.145140 0.170439 2
8 228 0.151798 0.000000 0.151798 0.151798 2
9 223 0.148469 0.010357 0.141145 0.155792 2
10 222 0.147803 0.003766 0.145140 0.150466 2
11 221 0.147137 0.004708 0.143808 0.150466 2
12 219 0.145806 0.004708 0.142477 0.149134 2
13 218 0.145140 0.018831 0.131824 0.158455 2
14 217 0.144474 0.008474 0.138482 0.150466 2
15 216 0.143808 0.011299 0.135819 0.151798 2
16 213 0.141811 0.031071 0.119840 0.163782 2
17 207 0.137816 0.010357 0.130493 0.145140 2
18 200 0.133156 0.005649 0.129161 0.137150 2
19 198 0.131824 0.028247 0.111851 0.151798 2
20 198 0.131824 0.001883 0.130493 0.133156 2
21 193 0.128495 0.000942 0.127830 0.129161 2
22 148 0.098535 0.007532 0.093209 0.103862 2
23 144 0.095872 0.009416 0.089214 0.102530 2
24 143 0.095206 0.008474 0.089214 0.101198 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099106 0.009200 0.000066 0.289337 0.071589 1.001 2
length{all}[2] 0.101109 0.009533 0.000113 0.296652 0.071825 0.999 2
length{all}[3] 0.097542 0.009935 0.000261 0.307919 0.070012 1.001 2
length{all}[4] 0.104720 0.011331 0.000061 0.317871 0.072812 1.000 2
length{all}[5] 0.095913 0.010049 0.000055 0.304217 0.063066 1.000 2
length{all}[6] 0.102288 0.011856 0.000032 0.324180 0.067714 1.002 2
length{all}[7] 0.096733 0.008065 0.002275 0.257637 0.069013 1.003 2
length{all}[8] 0.095747 0.008678 0.000087 0.280638 0.071746 0.998 2
length{all}[9] 0.108553 0.010366 0.000246 0.300993 0.075757 0.996 2
length{all}[10] 0.108685 0.016011 0.000049 0.338310 0.064252 0.998 2
length{all}[11] 0.086420 0.007834 0.000477 0.265915 0.057909 0.998 2
length{all}[12] 0.093816 0.009009 0.000333 0.295958 0.059853 1.000 2
length{all}[13] 0.100181 0.010436 0.000832 0.281950 0.070938 1.006 2
length{all}[14] 0.104887 0.010479 0.000019 0.313711 0.071965 0.995 2
length{all}[15] 0.108669 0.011726 0.000939 0.343048 0.067662 0.997 2
length{all}[16] 0.097882 0.007975 0.001916 0.268201 0.070240 1.001 2
length{all}[17] 0.099747 0.008434 0.000340 0.292414 0.067353 0.998 2
length{all}[18] 0.099766 0.010008 0.000064 0.295478 0.065500 0.995 2
length{all}[19] 0.092214 0.008701 0.000435 0.261739 0.061101 1.002 2
length{all}[20] 0.096665 0.007589 0.001460 0.260583 0.069548 0.995 2
length{all}[21] 0.104716 0.010898 0.000855 0.311510 0.065751 0.997 2
length{all}[22] 0.089632 0.008062 0.000522 0.279340 0.061036 0.995 2
length{all}[23] 0.093338 0.009039 0.000259 0.264579 0.063797 0.993 2
length{all}[24] 0.109569 0.011828 0.000156 0.312322 0.073630 1.007 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.010200
Maximum standard deviation of split frequencies = 0.031071
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|-------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 42 trees
90 % credible set contains 89 trees
95 % credible set contains 96 trees
99 % credible set contains 102 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 255
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 42 patterns at 85 / 85 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 42 patterns at 85 / 85 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
40992 bytes for conP
3696 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.063368 0.094252 0.028719 0.080815 0.108699 0.057957 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -376.199307
Iterating by ming2
Initial: fx= 376.199307
x= 0.06337 0.09425 0.02872 0.08081 0.10870 0.05796 0.30000 1.30000
1 h-m-p 0.0000 0.0003 204.2043 +++ 361.906389 m 0.0003 14 | 1/8
2 h-m-p 0.0160 8.0000 16.4027 -------------.. | 1/8
3 h-m-p 0.0000 0.0003 187.0300 +++ 349.637578 m 0.0003 48 | 2/8
4 h-m-p 0.0160 8.0000 17.3270 -------------.. | 2/8
5 h-m-p 0.0000 0.0001 167.9384 ++ 347.808858 m 0.0001 81 | 3/8
6 h-m-p 0.0079 3.9531 15.9724 -------------.. | 3/8
7 h-m-p 0.0000 0.0002 145.3800 +++ 343.372894 m 0.0002 115 | 4/8
8 h-m-p 0.0086 4.3191 12.8216 -------------.. | 4/8
9 h-m-p 0.0000 0.0002 118.9109 +++ 341.082673 m 0.0002 149 | 5/8
10 h-m-p 0.0090 4.5042 9.3913 -------------.. | 5/8
11 h-m-p 0.0000 0.0002 84.1697 +++ 339.845872 m 0.0002 183 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 339.845872 m 8.0000 194 | 6/8
13 h-m-p 0.7157 8.0000 0.0000 ++ 339.845872 m 8.0000 207 | 6/8
14 h-m-p 0.0160 8.0000 0.0259 ----Y 339.845872 0 0.0000 224 | 6/8
15 h-m-p 0.0160 8.0000 0.0020 ---C 339.845872 0 0.0001 240 | 6/8
16 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/8
17 h-m-p 0.0160 8.0000 0.0000 +++++ 339.845872 m 8.0000 280 | 6/8
18 h-m-p 0.0160 8.0000 0.8453 +++++ 339.845843 m 8.0000 296 | 6/8
19 h-m-p 1.6000 8.0000 0.3203 ++ 339.845841 m 8.0000 309 | 6/8
20 h-m-p 1.6000 8.0000 1.3646 C 339.845841 0 1.6000 322 | 6/8
21 h-m-p 1.6000 8.0000 0.0395 Y 339.845841 0 0.8233 333 | 6/8
22 h-m-p 1.6000 8.0000 0.0030 ++ 339.845841 m 8.0000 346 | 6/8
23 h-m-p 0.0887 8.0000 0.2735 ++Y 339.845841 0 2.2733 361 | 6/8
24 h-m-p 1.6000 8.0000 0.0079 ++ 339.845841 m 8.0000 374 | 6/8
25 h-m-p 0.0160 8.0000 9.6311 +++++ 339.845824 m 8.0000 390 | 6/8
26 h-m-p 1.6000 8.0000 1.1952 ++ 339.845824 m 8.0000 401 | 6/8
27 h-m-p 0.1925 8.0000 49.6627 +++ 339.845821 m 8.0000 413 | 6/8
28 h-m-p 1.6000 8.0000 0.0144 -----C 339.845821 0 0.0004 429 | 6/8
29 h-m-p 0.0160 8.0000 0.4174 +++++ 339.845821 m 8.0000 445 | 6/8
30 h-m-p 0.1228 8.0000 27.1898 ++++ 339.845821 m 8.0000 460 | 6/8
31 h-m-p 0.1183 0.5914 479.5454 -C 339.845821 0 0.0105 472 | 6/8
32 h-m-p 0.7201 8.0000 7.0137 --C 339.845821 0 0.0113 485 | 6/8
33 h-m-p 1.6000 8.0000 0.0161 Y 339.845821 0 2.8000 496 | 6/8
34 h-m-p 1.6000 8.0000 0.0000 C 339.845821 0 1.6000 509
Out..
lnL = -339.845821
510 lfun, 510 eigenQcodon, 3060 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.056923 0.042843 0.042479 0.079695 0.043346 0.070146 720.481171 0.549204 0.209453
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.033945
np = 9
lnL0 = -366.630070
Iterating by ming2
Initial: fx= 366.630070
x= 0.05692 0.04284 0.04248 0.07969 0.04335 0.07015 720.48117 0.54920 0.20945
1 h-m-p 0.0000 0.0005 188.6820 +++ 346.584280 m 0.0005 15 | 1/9
2 h-m-p 0.0000 0.0001 42.7155 ++ 346.424906 m 0.0001 27 | 2/9
3 h-m-p 0.0000 0.0000 747.7977 ++ 345.900770 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 16681.5434 ++ 342.757682 m 0.0000 51 | 4/9
5 h-m-p 0.0001 0.0003 26.6561 ++ 342.629759 m 0.0003 63 | 5/9
6 h-m-p 0.0000 0.0002 66.9576 ++ 341.457134 m 0.0002 75 | 6/9
7 h-m-p 0.0054 0.7980 0.6072 ------------.. | 6/9
8 h-m-p 0.0000 0.0002 81.5424 +++ 339.845841 m 0.0002 113 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 339.845841 m 8.0000 125 | 6/9
10 h-m-p 0.0160 8.0000 0.0000 +++++ 339.845841 m 8.0000 142 | 6/9
11 h-m-p 0.0160 8.0000 0.0662 +++++ 339.845834 m 8.0000 160 | 6/9
12 h-m-p 0.1617 0.8083 0.2836 ++ 339.845833 m 0.8083 175 | 7/9
13 h-m-p 1.6000 8.0000 0.0001 C 339.845833 0 0.4000 190 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 C 339.845833 0 1.6000 204 | 7/9
15 h-m-p 1.3374 8.0000 0.0000 Y 339.845833 0 0.8333 218 | 7/9
16 h-m-p 0.6938 8.0000 0.0000 -C 339.845833 0 0.0434 233
Out..
lnL = -339.845833
234 lfun, 702 eigenQcodon, 2808 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.066841 0.033805 0.017132 0.039226 0.097709 0.062392 720.067252 1.482765 0.550081 0.201648 43.547703
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.005402
np = 11
lnL0 = -353.214753
Iterating by ming2
Initial: fx= 353.214753
x= 0.06684 0.03381 0.01713 0.03923 0.09771 0.06239 720.06725 1.48277 0.55008 0.20165 43.54770
1 h-m-p 0.0000 0.0007 56.6550 ++++ 350.656467 m 0.0007 18 | 1/11
2 h-m-p 0.0046 0.0380 7.6553 ++ 348.469760 m 0.0380 32 | 2/11
3 h-m-p 0.0006 0.0032 141.5399 ++ 343.420471 m 0.0032 46 | 3/11
4 h-m-p 0.0003 0.0017 137.1988 ++ 342.458993 m 0.0017 60 | 4/11
5 h-m-p 0.0000 0.0001 2002.3967 ++ 341.902339 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0001 6396.3515 ++ 340.358983 m 0.0001 88 | 6/11
7 h-m-p 0.0001 0.0134 7651.9899 ---------.. | 6/11
8 h-m-p 0.0000 0.0001 74.9499 ++ 339.845825 m 0.0001 123 | 7/11
9 h-m-p 1.6000 8.0000 0.0000 -----Y 339.845825 0 0.0004 142
Out..
lnL = -339.845825
143 lfun, 572 eigenQcodon, 2574 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -339.845360 S = -339.844149 -0.000462
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 42 patterns 0:03
did 20 / 42 patterns 0:03
did 30 / 42 patterns 0:03
did 40 / 42 patterns 0:03
did 42 / 42 patterns 0:03
Time used: 0:03
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038758 0.108278 0.061423 0.047482 0.083312 0.024912 720.067254 0.269006 0.947168 18.960302 40.342174 67.473353
ntime & nrate & np: 6 4 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 0.000931
np = 12
lnL0 = -368.132215
Iterating by ming2
Initial: fx= 368.132215
x= 0.03876 0.10828 0.06142 0.04748 0.08331 0.02491 720.06725 0.26901 0.94717 18.96030 40.34217 67.47335
1 h-m-p 0.0000 0.0003 181.5215 +++ 357.094905 m 0.0003 18 | 1/12
2 h-m-p 0.0049 0.0652 10.9468 ------------.. | 1/12
3 h-m-p 0.0000 0.0002 171.7445 +++ 351.739845 m 0.0002 59 | 2/12
4 h-m-p 0.0041 0.0923 6.7433 ------------.. | 2/12
5 h-m-p 0.0000 0.0001 156.1101 ++ 348.981609 m 0.0001 99 | 3/12
6 h-m-p 0.0033 0.2626 4.5772 ------------.. | 3/12
7 h-m-p 0.0000 0.0002 135.9396 +++ 345.618845 m 0.0002 140 | 4/12
8 h-m-p 0.0160 8.0000 2.9778 -------------.. | 4/12
9 h-m-p 0.0000 0.0003 111.9784 +++ 341.994658 m 0.0003 182 | 5/12
10 h-m-p 0.0160 8.0000 1.5294 -------------.. | 5/12
11 h-m-p 0.0000 0.0003 80.3367 +++ 339.845821 m 0.0003 224 | 6/12
12 h-m-p 1.6000 8.0000 0.0000 +Y 339.845821 0 6.4000 240 | 6/12
13 h-m-p 1.6000 8.0000 0.0000 Y 339.845821 0 0.4000 261
Out..
lnL = -339.845821
262 lfun, 1048 eigenQcodon, 4716 P(t)
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.021687 0.048802 0.094783 0.091633 0.047471 0.084885 720.067254 0.363606 1.069937
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.047235
np = 9
lnL0 = -370.667095
Iterating by ming2
Initial: fx= 370.667095
x= 0.02169 0.04880 0.09478 0.09163 0.04747 0.08488 720.06725 0.36361 1.06994
1 h-m-p 0.0000 0.0003 186.0463 +++ 360.936706 m 0.0003 15 | 1/9
2 h-m-p 0.0044 0.0398 10.5842 ------------.. | 1/9
3 h-m-p 0.0000 0.0003 173.7878 +++ 350.783938 m 0.0003 50 | 2/9
4 h-m-p 0.0078 0.0641 6.5187 -------------.. | 2/9
5 h-m-p 0.0000 0.0000 159.9595 ++ 350.353297 m 0.0000 85 | 3/9
6 h-m-p 0.0005 0.0969 4.3204 -----------.. | 3/9
7 h-m-p 0.0000 0.0005 137.7030 +++ 341.309868 m 0.0005 119 | 4/9
8 h-m-p 0.0220 0.2038 2.3794 -------------.. | 4/9
9 h-m-p 0.0000 0.0001 116.7520 ++ 340.124996 m 0.0001 154 | 5/9
10 h-m-p 0.0050 2.2226 1.4406 ------------.. | 5/9
11 h-m-p 0.0000 0.0000 83.0186 ++ 339.845845 m 0.0000 188 | 6/9
12 h-m-p 0.2168 8.0000 0.0000 Y 339.845845 0 0.2168 200 | 6/9
13 h-m-p 0.0742 8.0000 0.0000 ------Y 339.845845 0 0.0000 221
Out..
lnL = -339.845845
222 lfun, 2442 eigenQcodon, 13320 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.056174 0.094553 0.034208 0.018149 0.046390 0.045245 720.067254 0.900000 0.512934 1.067765 37.920605
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.008182
np = 11
lnL0 = -351.725449
Iterating by ming2
Initial: fx= 351.725449
x= 0.05617 0.09455 0.03421 0.01815 0.04639 0.04524 720.06725 0.90000 0.51293 1.06777 37.92060
1 h-m-p 0.0000 0.0007 60.6956 ++++ 348.710696 m 0.0007 18 | 1/11
2 h-m-p 0.0002 0.0011 86.8427 +YYCCCC 346.969582 5 0.0007 41 | 1/11
3 h-m-p 0.0021 0.0104 8.8506 ++ 346.204097 m 0.0104 55 | 2/11
4 h-m-p 0.0003 0.0014 35.5375 ++ 345.355678 m 0.0014 69 | 3/11
5 h-m-p 0.0000 0.0001 1283.1314 ++ 343.180999 m 0.0001 83 | 4/11
6 h-m-p 0.0005 0.0030 90.6326 ++ 340.859157 m 0.0030 97 | 5/11
7 h-m-p 0.0000 0.0002 447.3443 ++ 339.845825 m 0.0002 111 | 6/11
8 h-m-p 1.6000 8.0000 0.0000 ----C 339.845825 0 0.0016 129 | 6/11
9 h-m-p 0.0160 8.0000 0.0000 +++++ 339.845825 m 8.0000 151 | 6/11
10 h-m-p 0.0119 5.9569 0.1719 +++++ 339.845822 m 5.9569 173
QuantileBeta(0.85, 0.95886, 0.00494) = 1.000000e+00 2000 rounds
| 6/11
11 h-m-p 0.0000 0.0000 0.0764
h-m-p: 1.20484687e-17 6.02423437e-17 7.63593543e-02 339.845822
..
QuantileBeta(0.85, 0.95886, 0.00494) = 1.000000e+00 2000 rounds
| 6/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 339.845822 m 8.0000 211
QuantileBeta(0.85, 0.95886, 0.00494) = 1.000000e+00 2000 rounds
| 7/11
13 h-m-p 0.0160 8.0000 0.0648 +++++ 339.845821 m 8.0000 233 | 7/11
14 h-m-p 0.2859 1.4293 0.1076 ++ 339.845821 m 1.4293 251 | 8/11
15 h-m-p 0.1705 8.0000 0.0085 +++ 339.845821 m 8.0000 270 | 8/11
16 h-m-p 0.0457 8.0000 1.4870 ++++ 339.845821 m 8.0000 289 | 8/11
17 h-m-p 0.2186 1.0930 44.6135 ---------N 339.845821 0 0.0000 312 | 8/11
18 h-m-p 1.6000 8.0000 0.0000 C 339.845821 0 1.6000 326 | 8/11
19 h-m-p 0.1824 8.0000 0.0000 -N 339.845821 0 0.0114 344
Out..
lnL = -339.845821
345 lfun, 4140 eigenQcodon, 22770 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -339.843997 S = -339.843871 -0.000055
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 42 patterns 0:14
did 20 / 42 patterns 0:14
did 30 / 42 patterns 0:14
did 40 / 42 patterns 0:14
did 42 / 42 patterns 0:14
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=85
NC_011896_1_WP_010908748_1_2325_MLBR_RS11015 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
NC_002677_1_NP_302428_1_1300_ML2176 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
NZ_LVXE01000030_1_WP_010908748_1_1398_A3216_RS08860 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
NZ_LYPH01000066_1_WP_010908748_1_2323_A8144_RS11135 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
NZ_CP029543_1_WP_010908748_1_2343_DIJ64_RS11915 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
NZ_AP014567_1_WP_010908748_1_2410_JK2ML_RS12250 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP
**************************************************
NC_011896_1_WP_010908748_1_2325_MLBR_RS11015 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
NC_002677_1_NP_302428_1_1300_ML2176 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
NZ_LVXE01000030_1_WP_010908748_1_1398_A3216_RS08860 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
NZ_LYPH01000066_1_WP_010908748_1_2323_A8144_RS11135 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
NZ_CP029543_1_WP_010908748_1_2343_DIJ64_RS11915 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
NZ_AP014567_1_WP_010908748_1_2410_JK2ML_RS12250 VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
***********************************
>NC_011896_1_WP_010908748_1_2325_MLBR_RS11015 GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC AGTCC >NC_002677_1_NP_302428_1_1300_ML2176 GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC AGTCC >NZ_LVXE01000030_1_WP_010908748_1_1398_A3216_RS08860 GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC AGTCC >NZ_LYPH01000066_1_WP_010908748_1_2323_A8144_RS11135 GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC AGTCC >NZ_CP029543_1_WP_010908748_1_2343_DIJ64_RS11915 GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC AGTCC >NZ_AP014567_1_WP_010908748_1_2410_JK2ML_RS12250 GTGAGCGGTCCCGTCTACGACCCTAGCGTGGTTAAACTACTGGCCTTCGC AGTCAGCCACGGTGATGAGCAACTCAATCAGGCAATCGAGTTTTGCCACG GTGACGAACCTACCGTGGATCTTCTCCGCGTGATCGCCGAGCAACGTCCG GTGAAAGTTCTCAGTTGCGTGCTGACCGATGCCGAAGAGATCGTGCTTAA TACTTCTATCGCTACGACGCCCTATACATCGGAACCAGTTTGCTCAACAC AGTCC
>NC_011896_1_WP_010908748_1_2325_MLBR_RS11015 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS >NC_002677_1_NP_302428_1_1300_ML2176 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS >NZ_LVXE01000030_1_WP_010908748_1_1398_A3216_RS08860 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS >NZ_LYPH01000066_1_WP_010908748_1_2323_A8144_RS11135 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS >NZ_CP029543_1_WP_010908748_1_2343_DIJ64_RS11915 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS >NZ_AP014567_1_WP_010908748_1_2410_JK2ML_RS12250 VSGPVYDPSVVKLLAFAVSHGDEQLNQAIEFCHGDEPTVDLLRVIAEQRP VKVLSCVLTDAEEIVLNTSIATTPYTSEPVCSTQS
#NEXUS
[ID: 5115369853]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908748_1_2325_MLBR_RS11015
NC_002677_1_NP_302428_1_1300_ML2176
NZ_LVXE01000030_1_WP_010908748_1_1398_A3216_RS08860
NZ_LYPH01000066_1_WP_010908748_1_2323_A8144_RS11135
NZ_CP029543_1_WP_010908748_1_2343_DIJ64_RS11915
NZ_AP014567_1_WP_010908748_1_2410_JK2ML_RS12250
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908748_1_2325_MLBR_RS11015,
2 NC_002677_1_NP_302428_1_1300_ML2176,
3 NZ_LVXE01000030_1_WP_010908748_1_1398_A3216_RS08860,
4 NZ_LYPH01000066_1_WP_010908748_1_2323_A8144_RS11135,
5 NZ_CP029543_1_WP_010908748_1_2343_DIJ64_RS11915,
6 NZ_AP014567_1_WP_010908748_1_2410_JK2ML_RS12250
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07158922,2:0.07182492,3:0.07001165,4:0.07281165,5:0.06306603,6:0.06771408);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07158922,2:0.07182492,3:0.07001165,4:0.07281165,5:0.06306603,6:0.06771408);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -353.81 -356.97
2 -353.78 -358.11
--------------------------------------
TOTAL -353.79 -357.69
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2176/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902798 0.096390 0.300389 1.470746 0.880071 613.22 682.11 1.001
r(A<->C){all} 0.160510 0.016336 0.000031 0.410524 0.135244 104.19 121.04 1.004
r(A<->G){all} 0.168778 0.019632 0.000027 0.436942 0.133099 64.73 86.96 1.001
r(A<->T){all} 0.161413 0.020453 0.000179 0.456322 0.121854 66.64 71.93 1.001
r(C<->G){all} 0.176883 0.021012 0.000033 0.484876 0.136256 162.92 166.64 1.013
r(C<->T){all} 0.161531 0.020227 0.000073 0.460411 0.119452 74.53 77.25 1.002
r(G<->T){all} 0.170884 0.019906 0.000083 0.444165 0.135226 20.54 59.57 1.007
pi(A){all} 0.223595 0.000671 0.173323 0.272403 0.222989 631.76 691.38 1.001
pi(C){all} 0.293134 0.000847 0.234124 0.346060 0.291736 618.95 684.98 1.001
pi(G){all} 0.252149 0.000724 0.198689 0.300618 0.252005 624.62 638.24 1.005
pi(T){all} 0.231122 0.000683 0.178899 0.279634 0.230479 506.07 552.28 0.999
alpha{1,2} 0.428932 0.246679 0.000343 1.350393 0.253785 353.67 427.23 1.003
alpha{3} 0.461477 0.234895 0.000308 1.408474 0.297966 417.77 454.54 1.000
pinvar{all} 0.993697 0.000053 0.980174 0.999995 0.995974 588.79 635.01 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML2176/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 85
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 1 1 1 1 1 1 | TAC 1 1 1 1 1 1 | TGC 3 3 3 3 3 3
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 3 3 3 3 3 3 | CCC 2 2 2 2 2 2 | CAC 2 2 2 2 2 2 | CGC 1 1 1 1 1 1
CTA 1 1 1 1 1 1 | CCA 1 1 1 1 1 1 | Gln CAA 2 2 2 2 2 2 | CGA 0 0 0 0 0 0
CTG 2 2 2 2 2 2 | CCG 1 1 1 1 1 1 | CAG 2 2 2 2 2 2 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 1 1 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 4 4 4 4 4 4 | ACC 2 2 2 2 2 2 | AAC 0 0 0 0 0 0 | AGC 3 3 3 3 3 3
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 0 0 0 0 0 0 | ACG 2 2 2 2 2 2 | AAG 0 0 0 0 0 0 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 1 1 1 1 1 1 | Asp GAT 3 3 3 3 3 3 | Gly GGT 3 3 3 3 3 3
GTC 2 2 2 2 2 2 | GCC 3 3 3 3 3 3 | GAC 2 2 2 2 2 2 | GGC 0 0 0 0 0 0
GTA 0 0 0 0 0 0 | GCA 2 2 2 2 2 2 | Glu GAA 3 3 3 3 3 3 | GGA 0 0 0 0 0 0
GTG 7 7 7 7 7 7 | GCG 0 0 0 0 0 0 | GAG 4 4 4 4 4 4 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908748_1_2325_MLBR_RS11015
position 1: T:0.12941 C:0.25882 A:0.22353 G:0.38824
position 2: T:0.30588 C:0.27059 A:0.28235 G:0.14118
position 3: T:0.25882 C:0.35294 A:0.16471 G:0.22353
Average T:0.23137 C:0.29412 A:0.22353 G:0.25098
#2: NC_002677_1_NP_302428_1_1300_ML2176
position 1: T:0.12941 C:0.25882 A:0.22353 G:0.38824
position 2: T:0.30588 C:0.27059 A:0.28235 G:0.14118
position 3: T:0.25882 C:0.35294 A:0.16471 G:0.22353
Average T:0.23137 C:0.29412 A:0.22353 G:0.25098
#3: NZ_LVXE01000030_1_WP_010908748_1_1398_A3216_RS08860
position 1: T:0.12941 C:0.25882 A:0.22353 G:0.38824
position 2: T:0.30588 C:0.27059 A:0.28235 G:0.14118
position 3: T:0.25882 C:0.35294 A:0.16471 G:0.22353
Average T:0.23137 C:0.29412 A:0.22353 G:0.25098
#4: NZ_LYPH01000066_1_WP_010908748_1_2323_A8144_RS11135
position 1: T:0.12941 C:0.25882 A:0.22353 G:0.38824
position 2: T:0.30588 C:0.27059 A:0.28235 G:0.14118
position 3: T:0.25882 C:0.35294 A:0.16471 G:0.22353
Average T:0.23137 C:0.29412 A:0.22353 G:0.25098
#5: NZ_CP029543_1_WP_010908748_1_2343_DIJ64_RS11915
position 1: T:0.12941 C:0.25882 A:0.22353 G:0.38824
position 2: T:0.30588 C:0.27059 A:0.28235 G:0.14118
position 3: T:0.25882 C:0.35294 A:0.16471 G:0.22353
Average T:0.23137 C:0.29412 A:0.22353 G:0.25098
#6: NZ_AP014567_1_WP_010908748_1_2410_JK2ML_RS12250
position 1: T:0.12941 C:0.25882 A:0.22353 G:0.38824
position 2: T:0.30588 C:0.27059 A:0.28235 G:0.14118
position 3: T:0.25882 C:0.35294 A:0.16471 G:0.22353
Average T:0.23137 C:0.29412 A:0.22353 G:0.25098
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 6 | TCC 6 | TAC 6 | TGC 18
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 6 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 12 | His H CAT 0 | Arg R CGT 6
CTC 18 | CCC 12 | CAC 12 | CGC 6
CTA 6 | CCA 6 | Gln Q CAA 12 | CGA 0
CTG 12 | CCG 6 | CAG 12 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 6 | Asn N AAT 12 | Ser S AGT 6
ATC 24 | ACC 12 | AAC 0 | AGC 18
ATA 0 | ACA 12 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 0 | ACG 12 | AAG 0 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 6 | Asp D GAT 18 | Gly G GGT 18
GTC 12 | GCC 18 | GAC 12 | GGC 0
GTA 0 | GCA 12 | Glu E GAA 18 | GGA 0
GTG 42 | GCG 0 | GAG 24 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12941 C:0.25882 A:0.22353 G:0.38824
position 2: T:0.30588 C:0.27059 A:0.28235 G:0.14118
position 3: T:0.25882 C:0.35294 A:0.16471 G:0.22353
Average T:0.23137 C:0.29412 A:0.22353 G:0.25098
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -339.845821 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 720.481171 37.920605
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908748_1_2325_MLBR_RS11015: 0.000004, NC_002677_1_NP_302428_1_1300_ML2176: 0.000004, NZ_LVXE01000030_1_WP_010908748_1_1398_A3216_RS08860: 0.000004, NZ_LYPH01000066_1_WP_010908748_1_2323_A8144_RS11135: 0.000004, NZ_CP029543_1_WP_010908748_1_2343_DIJ64_RS11915: 0.000004, NZ_AP014567_1_WP_010908748_1_2410_JK2ML_RS12250: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 720.48117
omega (dN/dS) = 37.92060
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 164.5 90.5 37.9206 0.0000 0.0000 0.0 0.0
7..2 0.000 164.5 90.5 37.9206 0.0000 0.0000 0.0 0.0
7..3 0.000 164.5 90.5 37.9206 0.0000 0.0000 0.0 0.0
7..4 0.000 164.5 90.5 37.9206 0.0000 0.0000 0.0 0.0
7..5 0.000 164.5 90.5 37.9206 0.0000 0.0000 0.0 0.0
7..6 0.000 164.5 90.5 37.9206 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -339.845833 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 720.067252 0.000010 0.218547
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908748_1_2325_MLBR_RS11015: 0.000004, NC_002677_1_NP_302428_1_1300_ML2176: 0.000004, NZ_LVXE01000030_1_WP_010908748_1_1398_A3216_RS08860: 0.000004, NZ_LYPH01000066_1_WP_010908748_1_2323_A8144_RS11135: 0.000004, NZ_CP029543_1_WP_010908748_1_2343_DIJ64_RS11915: 0.000004, NZ_AP014567_1_WP_010908748_1_2410_JK2ML_RS12250: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 720.06725
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.21855 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 164.5 90.5 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 164.5 90.5 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 164.5 90.5 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 164.5 90.5 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 164.5 90.5 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 164.5 90.5 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -339.845825 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 720.067254 0.774091 0.150410 0.000001 43.567665
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908748_1_2325_MLBR_RS11015: 0.000004, NC_002677_1_NP_302428_1_1300_ML2176: 0.000004, NZ_LVXE01000030_1_WP_010908748_1_1398_A3216_RS08860: 0.000004, NZ_LYPH01000066_1_WP_010908748_1_2323_A8144_RS11135: 0.000004, NZ_CP029543_1_WP_010908748_1_2343_DIJ64_RS11915: 0.000004, NZ_AP014567_1_WP_010908748_1_2410_JK2ML_RS12250: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 720.06725
MLEs of dN/dS (w) for site classes (K=3)
p: 0.77409 0.15041 0.07550
w: 0.00000 1.00000 43.56767
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 164.5 90.5 3.4397 0.0000 0.0000 0.0 0.0
7..2 0.000 164.5 90.5 3.4397 0.0000 0.0000 0.0 0.0
7..3 0.000 164.5 90.5 3.4397 0.0000 0.0000 0.0 0.0
7..4 0.000 164.5 90.5 3.4397 0.0000 0.0000 0.0 0.0
7..5 0.000 164.5 90.5 3.4397 0.0000 0.0000 0.0 0.0
7..6 0.000 164.5 90.5 3.4397 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908748_1_2325_MLBR_RS11015)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908748_1_2325_MLBR_RS11015)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 12): -339.845821 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 720.067254 0.267853 0.527510 18.960276 40.342166 67.473366
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908748_1_2325_MLBR_RS11015: 0.000004, NC_002677_1_NP_302428_1_1300_ML2176: 0.000004, NZ_LVXE01000030_1_WP_010908748_1_1398_A3216_RS08860: 0.000004, NZ_LYPH01000066_1_WP_010908748_1_2323_A8144_RS11135: 0.000004, NZ_CP029543_1_WP_010908748_1_2343_DIJ64_RS11915: 0.000004, NZ_AP014567_1_WP_010908748_1_2410_JK2ML_RS12250: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 720.06725
MLEs of dN/dS (w) for site classes (K=3)
p: 0.26785 0.52751 0.20464
w: 18.96028 40.34217 67.47337
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 164.5 90.5 40.1670 0.0000 0.0000 0.0 0.0
7..2 0.000 164.5 90.5 40.1670 0.0000 0.0000 0.0 0.0
7..3 0.000 164.5 90.5 40.1670 0.0000 0.0000 0.0 0.0
7..4 0.000 164.5 90.5 40.1670 0.0000 0.0000 0.0 0.0
7..5 0.000 164.5 90.5 40.1670 0.0000 0.0000 0.0 0.0
7..6 0.000 164.5 90.5 40.1670 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908748_1_2325_MLBR_RS11015)
Pr(w>1) post mean +- SE for w
1 V 1.000** 40.167
2 S 1.000** 40.167
3 G 1.000** 40.167
4 P 1.000** 40.167
5 V 1.000** 40.167
6 Y 1.000** 40.167
7 D 1.000** 40.167
8 P 1.000** 40.167
9 S 1.000** 40.167
10 V 1.000** 40.167
11 V 1.000** 40.167
12 K 1.000** 40.167
13 L 1.000** 40.167
14 L 1.000** 40.167
15 A 1.000** 40.167
16 F 1.000** 40.167
17 A 1.000** 40.167
18 V 1.000** 40.167
19 S 1.000** 40.167
20 H 1.000** 40.167
21 G 1.000** 40.167
22 D 1.000** 40.167
23 E 1.000** 40.167
24 Q 1.000** 40.167
25 L 1.000** 40.167
26 N 1.000** 40.167
27 Q 1.000** 40.167
28 A 1.000** 40.167
29 I 1.000** 40.167
30 E 1.000** 40.167
31 F 1.000** 40.167
32 C 1.000** 40.167
33 H 1.000** 40.167
34 G 1.000** 40.167
35 D 1.000** 40.167
36 E 1.000** 40.167
37 P 1.000** 40.167
38 T 1.000** 40.167
39 V 1.000** 40.167
40 D 1.000** 40.167
41 L 1.000** 40.167
42 L 1.000** 40.167
43 R 1.000** 40.167
44 V 1.000** 40.167
45 I 1.000** 40.167
46 A 1.000** 40.167
47 E 1.000** 40.167
48 Q 1.000** 40.167
49 R 1.000** 40.167
50 P 1.000** 40.167
51 V 1.000** 40.167
52 K 1.000** 40.167
53 V 1.000** 40.167
54 L 1.000** 40.167
55 S 1.000** 40.167
56 C 1.000** 40.167
57 V 1.000** 40.167
58 L 1.000** 40.167
59 T 1.000** 40.167
60 D 1.000** 40.167
61 A 1.000** 40.167
62 E 1.000** 40.167
63 E 1.000** 40.167
64 I 1.000** 40.167
65 V 1.000** 40.167
66 L 1.000** 40.167
67 N 1.000** 40.167
68 T 1.000** 40.167
69 S 1.000** 40.167
70 I 1.000** 40.167
71 A 1.000** 40.167
72 T 1.000** 40.167
73 T 1.000** 40.167
74 P 1.000** 40.167
75 Y 1.000** 40.167
76 T 1.000** 40.167
77 S 1.000** 40.167
78 E 1.000** 40.167
79 P 1.000** 40.167
80 V 1.000** 40.167
81 C 1.000** 40.167
82 S 1.000** 40.167
83 T 1.000** 40.167
84 Q 1.000** 40.167
85 S 1.000** 40.167
Note: more than one w>1. Check rst for details
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -339.845845 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 720.067254 0.363356 1.069788
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908748_1_2325_MLBR_RS11015: 0.000004, NC_002677_1_NP_302428_1_1300_ML2176: 0.000004, NZ_LVXE01000030_1_WP_010908748_1_1398_A3216_RS08860: 0.000004, NZ_LYPH01000066_1_WP_010908748_1_2323_A8144_RS11135: 0.000004, NZ_CP029543_1_WP_010908748_1_2343_DIJ64_RS11915: 0.000004, NZ_AP014567_1_WP_010908748_1_2410_JK2ML_RS12250: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 720.06725
Parameters in M7 (beta):
p = 0.36336 q = 1.06979
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00024 0.00495 0.02020 0.05107 0.10226 0.17840 0.28430 0.42539 0.60862 0.84607
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 164.5 90.5 0.2521 0.0000 0.0000 0.0 0.0
7..2 0.000 164.5 90.5 0.2521 0.0000 0.0000 0.0 0.0
7..3 0.000 164.5 90.5 0.2521 0.0000 0.0000 0.0 0.0
7..4 0.000 164.5 90.5 0.2521 0.0000 0.0000 0.0 0.0
7..5 0.000 164.5 90.5 0.2521 0.0000 0.0000 0.0 0.0
7..6 0.000 164.5 90.5 0.2521 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -339.845821 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 720.155692 0.000010 0.945214 0.005000 49.759447
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908748_1_2325_MLBR_RS11015: 0.000004, NC_002677_1_NP_302428_1_1300_ML2176: 0.000004, NZ_LVXE01000030_1_WP_010908748_1_1398_A3216_RS08860: 0.000004, NZ_LYPH01000066_1_WP_010908748_1_2323_A8144_RS11135: 0.000004, NZ_CP029543_1_WP_010908748_1_2343_DIJ64_RS11915: 0.000004, NZ_AP014567_1_WP_010908748_1_2410_JK2ML_RS12250: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 720.15569
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.94521 q = 0.00500
(p1 = 0.99999) w = 49.75945
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.99996 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 49.75945
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 164.5 90.5 49.7590 0.0000 0.0000 0.0 0.0
7..2 0.000 164.5 90.5 49.7590 0.0000 0.0000 0.0 0.0
7..3 0.000 164.5 90.5 49.7590 0.0000 0.0000 0.0 0.0
7..4 0.000 164.5 90.5 49.7590 0.0000 0.0000 0.0 0.0
7..5 0.000 164.5 90.5 49.7590 0.0000 0.0000 0.0 0.0
7..6 0.000 164.5 90.5 49.7590 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908748_1_2325_MLBR_RS11015)
Pr(w>1) post mean +- SE for w
1 V 1.000** 49.759
2 S 1.000** 49.759
3 G 1.000** 49.759
4 P 1.000** 49.759
5 V 1.000** 49.759
6 Y 1.000** 49.759
7 D 1.000** 49.759
8 P 1.000** 49.759
9 S 1.000** 49.759
10 V 1.000** 49.759
11 V 1.000** 49.759
12 K 1.000** 49.759
13 L 1.000** 49.759
14 L 1.000** 49.759
15 A 1.000** 49.759
16 F 1.000** 49.759
17 A 1.000** 49.759
18 V 1.000** 49.759
19 S 1.000** 49.759
20 H 1.000** 49.759
21 G 1.000** 49.759
22 D 1.000** 49.759
23 E 1.000** 49.759
24 Q 1.000** 49.759
25 L 1.000** 49.759
26 N 1.000** 49.759
27 Q 1.000** 49.759
28 A 1.000** 49.759
29 I 1.000** 49.759
30 E 1.000** 49.759
31 F 1.000** 49.759
32 C 1.000** 49.759
33 H 1.000** 49.759
34 G 1.000** 49.759
35 D 1.000** 49.759
36 E 1.000** 49.759
37 P 1.000** 49.759
38 T 1.000** 49.759
39 V 1.000** 49.759
40 D 1.000** 49.759
41 L 1.000** 49.759
42 L 1.000** 49.759
43 R 1.000** 49.759
44 V 1.000** 49.759
45 I 1.000** 49.759
46 A 1.000** 49.759
47 E 1.000** 49.759
48 Q 1.000** 49.759
49 R 1.000** 49.759
50 P 1.000** 49.759
51 V 1.000** 49.759
52 K 1.000** 49.759
53 V 1.000** 49.759
54 L 1.000** 49.759
55 S 1.000** 49.759
56 C 1.000** 49.759
57 V 1.000** 49.759
58 L 1.000** 49.759
59 T 1.000** 49.759
60 D 1.000** 49.759
61 A 1.000** 49.759
62 E 1.000** 49.759
63 E 1.000** 49.759
64 I 1.000** 49.759
65 V 1.000** 49.759
66 L 1.000** 49.759
67 N 1.000** 49.759
68 T 1.000** 49.759
69 S 1.000** 49.759
70 I 1.000** 49.759
71 A 1.000** 49.759
72 T 1.000** 49.759
73 T 1.000** 49.759
74 P 1.000** 49.759
75 Y 1.000** 49.759
76 T 1.000** 49.759
77 S 1.000** 49.759
78 E 1.000** 49.759
79 P 1.000** 49.759
80 V 1.000** 49.759
81 C 1.000** 49.759
82 S 1.000** 49.759
83 T 1.000** 49.759
84 Q 1.000** 49.759
85 S 1.000** 49.759
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908748_1_2325_MLBR_RS11015)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:14
Model 1: NearlyNeutral -339.845833 Model 2: PositiveSelection -339.845825 Model 0: one-ratio -339.845821 Model 3: discrete -339.845821 Model 7: beta -339.845845 Model 8: beta&w>1 -339.845821 Model 0 vs 1 2.4000000053092663E-5 Model 2 vs 1 1.600000007329072E-5 Model 8 vs 7 4.799999999249849E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
