--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:04:16 GMT 2020
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=500000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=1250
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=1250
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/8res/ML2178/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -345.32 -349.68
2 -345.30 -348.75
--------------------------------------
TOTAL -345.31 -349.32
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.885705 0.092484 0.338404 1.464076 0.855680 627.84 689.42 1.000
r(A<->C){all} 0.184728 0.022356 0.000016 0.479051 0.144886 61.30 72.02 0.999
r(A<->G){all} 0.145308 0.015846 0.000053 0.405833 0.109802 99.17 191.21 1.000
r(A<->T){all} 0.170039 0.018241 0.000108 0.435959 0.139657 42.34 57.12 1.013
r(C<->G){all} 0.174342 0.020047 0.000039 0.467396 0.138761 45.41 98.09 0.999
r(C<->T){all} 0.168198 0.021004 0.000554 0.468900 0.128542 87.99 95.87 1.018
r(G<->T){all} 0.157386 0.018794 0.000142 0.428352 0.120143 80.58 98.07 0.999
pi(A){all} 0.241811 0.000699 0.191487 0.295980 0.241242 634.18 654.45 1.000
pi(C){all} 0.209655 0.000649 0.160903 0.261671 0.208761 667.78 692.99 0.999
pi(G){all} 0.268161 0.000753 0.212079 0.320966 0.268145 624.88 670.87 1.001
pi(T){all} 0.280373 0.000814 0.227532 0.336602 0.280500 528.68 610.80 1.000
alpha{1,2} 0.408676 0.204578 0.000219 1.285184 0.261923 450.04 499.05 1.001
alpha{3} 0.454787 0.234482 0.000347 1.396780 0.299020 601.72 676.36 1.000
pinvar{all} 0.993636 0.000061 0.978982 0.999994 0.996183 702.50 726.75 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -330.506378
Model 2: PositiveSelection -330.506331
Model 0: one-ratio -330.506603
Model 3: discrete -330.506331
Model 7: beta -330.506331
Model 8: beta&w>1 -330.506331
Model 0 vs 1 4.500000000007276E-4
Model 2 vs 1 9.399999999004649E-5
Model 8 vs 7 0.0
>C1
MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
>C2
MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
>C3
MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
>C4
MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
>C5
MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
>C6
MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=83
C1 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
C2 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
C3 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
C4 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
C5 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
C6 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
**************************************************
C1 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
C2 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
C3 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
C4 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
C5 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
C6 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
*********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2490]--->[2490]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.449 Mb, Max= 30.604 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
C2 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
C3 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
C4 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
C5 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
C6 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
**************************************************
C1 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
C2 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
C3 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
C4 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
C5 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
C6 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
*********************************
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC
C2 ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC
C3 ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC
C4 ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC
C5 ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC
C6 ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC
**************************************************
C1 TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC
C2 TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC
C3 TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC
C4 TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC
C5 TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC
C6 TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC
**************************************************
C1 CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT
C2 CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT
C3 CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT
C4 CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT
C5 CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT
C6 CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT
**************************************************
C1 GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC
C2 GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC
C3 GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC
C4 GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC
C5 GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC
C6 GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC
**************************************************
C1 TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG
C2 TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG
C3 TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG
C4 TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG
C5 TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG
C6 TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG
*************************************************
>C1
ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC
TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC
CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT
GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC
TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG
>C2
ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC
TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC
CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT
GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC
TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG
>C3
ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC
TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC
CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT
GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC
TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG
>C4
ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC
TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC
CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT
GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC
TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG
>C5
ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC
TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC
CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT
GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC
TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG
>C6
ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC
TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC
CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT
GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC
TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG
>C1
MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
>C2
MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
>C3
MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
>C4
MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
>C5
MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
>C6
MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 249 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856600
Setting output file names to "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 164529861
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 500000
Running Markov chain
MCMC stamp = 5720264416
Seed = 468683103
Swapseed = 1579856600
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -557.273936 -- -24.965149
Chain 2 -- -557.273904 -- -24.965149
Chain 3 -- -557.273936 -- -24.965149
Chain 4 -- -557.273936 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -557.273851 -- -24.965149
Chain 2 -- -557.273936 -- -24.965149
Chain 3 -- -557.273904 -- -24.965149
Chain 4 -- -557.273851 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (500000 generations requested):
0 -- [-557.274] (-557.274) (-557.274) (-557.274) * [-557.274] (-557.274) (-557.274) (-557.274)
500 -- [-349.993] (-359.292) (-356.258) (-360.149) * (-361.336) [-358.787] (-353.836) (-351.861) -- 0:00:00
1000 -- [-349.602] (-356.087) (-354.057) (-361.332) * (-353.939) (-355.438) [-354.025] (-355.631) -- 0:00:00
1500 -- (-354.377) (-354.765) (-361.804) [-356.578] * [-358.089] (-354.408) (-359.122) (-349.980) -- 0:00:00
2000 -- (-351.993) [-361.227] (-355.645) (-356.470) * [-351.650] (-355.213) (-351.681) (-358.868) -- 0:00:00
2500 -- (-356.715) (-355.965) [-354.110] (-353.526) * (-352.726) (-363.539) (-354.113) [-352.535] -- 0:00:00
3000 -- (-357.328) (-353.770) [-354.879] (-359.606) * (-356.270) (-362.095) [-349.760] (-355.429) -- 0:00:00
3500 -- (-357.955) (-351.344) [-351.768] (-357.034) * [-351.426] (-354.607) (-356.052) (-354.499) -- 0:00:00
4000 -- (-358.770) (-360.076) (-361.086) [-355.815] * (-352.802) [-349.498] (-353.769) (-355.344) -- 0:00:00
4500 -- (-360.050) (-356.064) (-356.910) [-350.473] * [-352.184] (-350.994) (-359.157) (-356.782) -- 0:00:00
5000 -- [-353.135] (-353.131) (-358.701) (-363.229) * (-355.837) [-352.778] (-351.105) (-355.849) -- 0:00:00
Average standard deviation of split frequencies: 0.065473
5500 -- (-357.971) (-360.506) [-358.163] (-356.517) * [-353.636] (-359.999) (-356.439) (-361.400) -- 0:00:00
6000 -- (-357.437) (-366.910) [-354.339] (-352.847) * (-374.475) (-357.381) (-364.214) [-354.832] -- 0:00:00
6500 -- (-357.513) [-361.103] (-358.493) (-364.249) * (-350.737) (-350.938) (-354.790) [-352.237] -- 0:00:00
7000 -- (-356.456) [-355.354] (-348.896) (-363.346) * (-358.846) (-350.861) [-358.435] (-358.543) -- 0:01:10
7500 -- [-348.783] (-353.124) (-355.367) (-353.933) * [-351.312] (-363.205) (-357.711) (-364.044) -- 0:01:05
8000 -- (-359.135) [-352.843] (-357.561) (-355.573) * (-359.445) [-360.096] (-358.903) (-360.621) -- 0:01:01
8500 -- (-356.383) [-349.509] (-354.587) (-359.487) * [-352.473] (-354.290) (-357.477) (-355.763) -- 0:00:57
9000 -- (-355.207) (-348.949) (-359.258) [-345.244] * (-354.152) (-355.212) (-354.699) [-350.581] -- 0:00:54
9500 -- (-354.533) (-364.130) (-357.277) [-345.006] * (-357.202) [-351.795] (-345.402) (-361.988) -- 0:00:51
10000 -- (-361.636) (-364.324) (-353.758) [-344.567] * [-354.481] (-360.508) (-344.508) (-360.767) -- 0:00:49
Average standard deviation of split frequencies: 0.081410
10500 -- (-359.607) (-352.515) (-355.734) [-344.663] * [-358.785] (-360.918) (-346.087) (-354.828) -- 0:00:46
11000 -- (-355.173) (-357.093) [-356.904] (-347.866) * [-357.077] (-359.750) (-346.207) (-353.203) -- 0:00:44
11500 -- [-354.004] (-351.347) (-352.367) (-345.524) * (-353.031) [-360.078] (-350.445) (-362.489) -- 0:00:42
12000 -- (-365.529) [-357.399] (-356.830) (-346.495) * (-361.459) (-357.194) (-346.665) [-354.374] -- 0:00:40
12500 -- (-350.518) (-349.164) [-356.051] (-349.392) * (-350.906) [-356.834] (-346.415) (-356.569) -- 0:00:39
13000 -- [-360.237] (-354.115) (-359.790) (-349.806) * (-352.857) [-352.862] (-346.170) (-354.872) -- 0:00:37
13500 -- [-356.485] (-352.144) (-354.194) (-350.011) * [-358.958] (-356.524) (-345.791) (-352.702) -- 0:00:36
14000 -- [-354.978] (-355.792) (-357.218) (-351.970) * (-354.182) (-358.503) [-345.209] (-355.424) -- 0:00:34
14500 -- (-354.756) (-359.713) [-354.389] (-346.681) * (-353.781) [-353.031] (-344.453) (-356.348) -- 0:00:33
15000 -- (-359.698) (-365.571) (-356.216) [-346.929] * [-352.903] (-364.526) (-348.530) (-360.882) -- 0:00:32
Average standard deviation of split frequencies: 0.080204
15500 -- (-367.091) (-364.097) (-361.980) [-346.020] * (-351.411) [-350.162] (-344.473) (-360.210) -- 0:00:31
16000 -- (-356.069) (-361.412) [-354.282] (-350.157) * (-350.588) [-350.975] (-344.095) (-352.241) -- 0:00:30
16500 -- (-356.240) (-350.397) [-356.047] (-348.905) * (-358.005) (-361.286) (-348.747) [-346.650] -- 0:00:29
17000 -- (-357.085) (-345.672) (-354.047) [-346.240] * (-350.813) [-356.950] (-346.419) (-346.809) -- 0:00:28
17500 -- (-355.274) [-344.581] (-354.528) (-346.901) * (-353.037) (-356.641) (-345.723) [-347.022] -- 0:00:27
18000 -- (-352.479) (-345.859) (-349.756) [-346.274] * (-360.000) (-359.106) (-346.068) [-348.420] -- 0:00:26
18500 -- (-358.689) (-346.161) [-350.318] (-344.947) * (-357.207) (-354.216) (-345.128) [-347.164] -- 0:00:26
19000 -- (-353.658) [-346.498] (-351.895) (-347.663) * [-354.199] (-354.806) (-345.444) (-345.984) -- 0:00:25
19500 -- (-362.589) (-347.168) [-353.458] (-347.059) * (-361.077) (-349.891) [-347.758] (-347.258) -- 0:00:24
20000 -- (-356.704) (-343.979) (-357.208) [-346.238] * (-362.361) (-356.083) (-346.567) [-344.717] -- 0:00:24
Average standard deviation of split frequencies: 0.069697
20500 -- (-354.076) (-349.785) (-353.314) [-345.159] * (-355.345) (-355.399) (-344.279) [-344.766] -- 0:00:23
21000 -- (-355.528) [-346.964] (-357.756) (-347.176) * (-362.983) (-349.858) (-346.104) [-348.805] -- 0:00:22
21500 -- (-356.442) (-351.172) [-360.581] (-346.337) * (-352.220) [-351.781] (-344.718) (-346.265) -- 0:00:22
22000 -- (-352.414) [-346.532] (-355.555) (-347.467) * (-353.830) [-351.663] (-345.881) (-346.178) -- 0:00:21
22500 -- (-353.628) (-348.188) [-350.612] (-346.042) * [-349.645] (-355.749) (-345.469) (-345.202) -- 0:00:21
23000 -- (-356.087) [-344.420] (-357.202) (-346.225) * (-357.987) [-350.513] (-345.449) (-347.050) -- 0:00:20
23500 -- (-356.233) [-345.552] (-351.246) (-346.154) * (-358.011) (-352.425) [-344.737] (-344.264) -- 0:00:20
24000 -- [-351.278] (-345.271) (-357.508) (-345.701) * (-358.384) (-358.636) (-346.087) [-347.568] -- 0:00:39
24500 -- (-353.309) (-345.881) (-355.508) [-344.073] * (-354.538) (-352.554) (-345.810) [-346.317] -- 0:00:38
25000 -- (-355.015) [-346.893] (-356.185) (-345.305) * (-353.023) (-362.937) (-349.275) [-347.026] -- 0:00:38
Average standard deviation of split frequencies: 0.054393
25500 -- (-356.054) [-345.472] (-354.760) (-345.639) * (-360.412) [-359.118] (-346.540) (-344.978) -- 0:00:37
26000 -- (-357.086) [-345.331] (-352.946) (-349.302) * (-347.939) (-357.195) (-349.152) [-345.990] -- 0:00:36
26500 -- (-360.354) (-344.591) [-360.256] (-347.940) * (-345.162) (-362.735) [-345.188] (-345.013) -- 0:00:35
27000 -- [-362.509] (-344.167) (-362.332) (-346.668) * [-344.495] (-350.193) (-344.341) (-348.656) -- 0:00:35
27500 -- (-364.480) (-345.209) [-357.310] (-346.476) * (-345.185) [-346.738] (-348.396) (-345.769) -- 0:00:34
28000 -- (-355.754) (-344.300) [-351.819] (-349.118) * (-345.516) (-345.893) (-349.823) [-345.790] -- 0:00:33
28500 -- (-359.091) (-344.462) [-352.797] (-349.574) * [-344.812] (-347.751) (-344.977) (-344.489) -- 0:00:33
29000 -- [-350.384] (-348.276) (-355.397) (-344.579) * [-344.730] (-349.514) (-347.655) (-345.489) -- 0:00:32
29500 -- (-346.954) (-347.276) (-361.742) [-347.365] * (-345.371) (-345.042) [-345.953] (-345.490) -- 0:00:31
30000 -- (-346.348) (-350.860) (-359.305) [-346.861] * [-346.807] (-346.602) (-345.747) (-344.018) -- 0:00:31
Average standard deviation of split frequencies: 0.046116
30500 -- (-348.155) (-346.579) (-357.257) [-349.519] * (-347.090) (-346.851) [-344.829] (-344.427) -- 0:00:30
31000 -- (-344.193) (-348.285) (-352.627) [-346.288] * (-348.102) (-350.858) (-344.957) [-347.801] -- 0:00:30
31500 -- (-344.969) (-344.821) (-351.586) [-345.991] * (-345.335) (-345.352) (-349.718) [-345.814] -- 0:00:29
32000 -- (-350.405) (-344.945) (-356.427) [-349.600] * (-344.944) [-345.443] (-346.927) (-346.146) -- 0:00:29
32500 -- (-345.275) (-345.647) (-355.612) [-352.242] * (-348.481) (-347.785) [-346.885] (-349.470) -- 0:00:28
33000 -- (-348.280) (-345.873) [-353.340] (-347.328) * [-346.177] (-347.505) (-347.016) (-348.983) -- 0:00:28
33500 -- (-345.544) (-349.955) [-369.390] (-348.405) * (-344.731) [-345.871] (-345.428) (-347.370) -- 0:00:27
34000 -- (-344.508) (-348.141) [-355.136] (-348.323) * (-345.220) (-351.921) (-344.517) [-347.552] -- 0:00:27
34500 -- [-344.571] (-345.473) (-355.511) (-346.171) * (-349.744) (-346.211) (-345.410) [-350.396] -- 0:00:26
35000 -- (-345.227) [-344.984] (-369.204) (-348.128) * (-346.399) [-346.202] (-346.203) (-347.176) -- 0:00:26
Average standard deviation of split frequencies: 0.042260
35500 -- (-345.018) [-346.357] (-359.257) (-348.386) * (-345.417) (-346.657) [-344.926] (-346.418) -- 0:00:26
36000 -- (-345.643) (-351.484) (-352.849) [-346.205] * [-345.475] (-347.635) (-345.279) (-345.294) -- 0:00:25
36500 -- (-345.267) (-346.718) (-357.466) [-345.912] * [-345.309] (-345.965) (-343.951) (-346.189) -- 0:00:25
37000 -- (-348.933) (-346.224) [-351.265] (-344.611) * (-346.971) (-349.690) (-345.069) [-345.059] -- 0:00:25
37500 -- (-348.768) (-347.977) (-354.494) [-344.473] * (-345.146) (-344.363) [-344.493] (-346.044) -- 0:00:24
38000 -- (-345.527) [-344.379] (-361.030) (-345.536) * (-347.180) (-345.888) [-351.739] (-350.436) -- 0:00:24
38500 -- (-345.844) [-345.123] (-357.418) (-346.436) * [-346.942] (-345.417) (-349.849) (-344.717) -- 0:00:23
39000 -- (-347.882) (-344.970) [-358.412] (-345.704) * (-346.539) (-345.640) (-350.388) [-344.684] -- 0:00:23
39500 -- [-347.235] (-344.381) (-354.442) (-345.773) * (-348.619) [-347.127] (-347.010) (-345.527) -- 0:00:23
40000 -- (-344.279) [-345.662] (-356.376) (-344.677) * (-344.558) (-343.970) [-344.105] (-346.406) -- 0:00:23
Average standard deviation of split frequencies: 0.045788
40500 -- (-344.862) [-350.048] (-353.544) (-346.414) * [-349.273] (-348.614) (-345.845) (-346.107) -- 0:00:22
41000 -- [-347.879] (-345.453) (-366.876) (-345.373) * (-350.446) (-345.808) (-347.544) [-345.243] -- 0:00:33
41500 -- (-353.007) (-344.340) (-352.382) [-345.106] * (-346.773) (-346.046) [-348.463] (-344.752) -- 0:00:33
42000 -- (-346.891) [-347.668] (-352.774) (-348.228) * (-348.350) [-346.299] (-350.226) (-345.559) -- 0:00:32
42500 -- (-346.273) (-345.024) (-350.282) [-345.948] * [-348.650] (-345.455) (-353.024) (-345.213) -- 0:00:32
43000 -- [-343.916] (-347.843) (-356.354) (-345.655) * (-346.667) [-345.958] (-352.424) (-348.131) -- 0:00:31
43500 -- [-346.325] (-346.598) (-353.411) (-346.778) * (-345.633) [-345.830] (-344.703) (-345.973) -- 0:00:31
44000 -- (-348.368) (-346.044) (-364.454) [-345.315] * [-344.972] (-345.152) (-345.207) (-346.023) -- 0:00:31
44500 -- [-347.036] (-346.924) (-361.028) (-348.000) * (-346.082) (-347.696) [-344.357] (-344.799) -- 0:00:30
45000 -- (-345.509) (-346.478) (-352.181) [-344.708] * (-345.065) [-348.149] (-347.333) (-348.449) -- 0:00:30
Average standard deviation of split frequencies: 0.034936
45500 -- [-344.703] (-350.189) (-351.260) (-345.983) * (-345.065) (-347.046) [-345.623] (-344.650) -- 0:00:29
46000 -- (-349.749) (-350.187) [-345.698] (-345.028) * (-346.473) [-348.456] (-353.162) (-345.461) -- 0:00:29
46500 -- (-347.334) (-346.142) (-347.000) [-348.112] * (-347.708) (-344.235) [-345.283] (-347.161) -- 0:00:29
47000 -- (-349.419) [-345.739] (-346.000) (-347.239) * (-346.493) [-344.357] (-344.486) (-345.163) -- 0:00:28
47500 -- (-347.334) (-344.357) (-345.718) [-344.841] * (-345.473) [-347.497] (-344.356) (-345.845) -- 0:00:28
48000 -- (-346.069) (-346.439) (-345.226) [-345.739] * (-345.372) (-345.863) (-343.837) [-348.650] -- 0:00:28
48500 -- [-348.807] (-345.818) (-348.077) (-346.471) * (-345.067) (-345.052) [-343.917] (-347.758) -- 0:00:27
49000 -- (-349.535) [-347.662] (-346.267) (-345.393) * (-350.023) [-344.706] (-347.591) (-347.079) -- 0:00:27
49500 -- (-349.765) [-347.064] (-348.661) (-346.390) * (-346.874) [-344.702] (-346.025) (-345.580) -- 0:00:27
50000 -- (-348.343) (-345.144) [-344.489] (-347.638) * [-346.527] (-344.545) (-344.921) (-345.680) -- 0:00:27
Average standard deviation of split frequencies: 0.034425
50500 -- [-349.221] (-346.094) (-345.591) (-344.735) * [-346.992] (-347.546) (-348.240) (-346.583) -- 0:00:26
51000 -- (-347.341) [-344.488] (-344.831) (-347.467) * (-347.640) (-345.126) (-344.990) [-344.412] -- 0:00:26
51500 -- [-348.890] (-347.331) (-349.168) (-345.018) * (-347.084) (-344.859) (-344.446) [-344.317] -- 0:00:26
52000 -- [-344.889] (-345.253) (-348.067) (-346.197) * (-347.049) [-348.375] (-349.391) (-349.453) -- 0:00:25
52500 -- (-346.543) [-348.132] (-345.326) (-347.033) * (-354.234) [-345.789] (-349.111) (-348.424) -- 0:00:25
53000 -- (-350.195) (-346.116) (-348.894) [-346.671] * (-345.443) (-344.746) (-344.437) [-344.202] -- 0:00:25
53500 -- (-348.657) (-344.641) (-344.879) [-346.064] * (-346.303) (-349.046) [-344.853] (-345.297) -- 0:00:25
54000 -- (-345.566) (-345.561) [-345.296] (-349.329) * (-347.302) (-344.000) (-351.024) [-343.944] -- 0:00:24
54500 -- (-346.391) (-351.184) [-347.073] (-346.396) * (-350.225) (-346.181) [-344.438] (-347.482) -- 0:00:24
55000 -- (-344.465) (-348.751) (-344.707) [-344.552] * (-345.142) [-344.488] (-345.919) (-346.103) -- 0:00:24
Average standard deviation of split frequencies: 0.031900
55500 -- (-348.013) (-343.752) (-349.468) [-345.096] * (-345.303) (-349.269) (-345.289) [-344.665] -- 0:00:24
56000 -- [-345.911] (-344.641) (-345.284) (-345.580) * (-346.438) [-347.647] (-352.281) (-347.709) -- 0:00:23
56500 -- (-347.799) (-345.343) [-346.593] (-348.142) * [-343.972] (-348.355) (-345.819) (-346.649) -- 0:00:23
57000 -- (-345.513) (-349.077) (-346.839) [-345.802] * (-348.282) (-345.154) [-344.304] (-345.994) -- 0:00:31
57500 -- (-346.614) (-345.514) (-346.623) [-345.347] * (-346.640) (-345.461) (-345.673) [-345.222] -- 0:00:30
58000 -- (-347.055) (-346.900) [-344.962] (-348.935) * (-344.505) [-344.808] (-348.988) (-344.380) -- 0:00:30
58500 -- (-347.014) [-345.203] (-351.498) (-349.272) * (-350.615) (-348.021) [-349.366] (-345.473) -- 0:00:30
59000 -- (-350.821) (-344.624) [-347.368] (-346.534) * (-349.429) (-343.831) [-346.109] (-349.767) -- 0:00:29
59500 -- [-345.188] (-347.111) (-346.613) (-345.236) * (-348.833) [-346.252] (-345.303) (-346.896) -- 0:00:29
60000 -- (-346.514) (-346.308) (-345.385) [-346.763] * (-351.210) (-346.687) (-344.562) [-344.658] -- 0:00:29
Average standard deviation of split frequencies: 0.030218
60500 -- [-347.771] (-345.749) (-345.267) (-348.077) * [-349.186] (-346.151) (-352.039) (-345.842) -- 0:00:29
61000 -- [-347.422] (-348.387) (-348.217) (-346.204) * (-346.256) (-344.938) [-345.245] (-344.745) -- 0:00:28
61500 -- (-346.299) (-345.783) (-351.054) [-345.117] * (-345.738) [-345.969] (-346.234) (-346.999) -- 0:00:28
62000 -- (-345.721) (-345.081) [-346.304] (-346.881) * (-346.556) (-344.799) [-345.469] (-345.756) -- 0:00:28
62500 -- [-348.941] (-347.138) (-346.402) (-346.114) * (-348.247) [-344.593] (-345.128) (-345.926) -- 0:00:28
63000 -- (-344.926) [-344.684] (-345.917) (-345.952) * (-347.877) (-347.037) (-345.670) [-346.842] -- 0:00:27
63500 -- (-345.291) [-344.776] (-347.853) (-344.806) * (-347.569) (-346.105) (-344.826) [-349.000] -- 0:00:27
64000 -- (-346.877) [-344.908] (-346.331) (-347.161) * (-346.741) (-346.974) [-346.053] (-347.584) -- 0:00:27
64500 -- (-344.891) [-347.364] (-347.338) (-352.755) * [-347.628] (-346.446) (-345.501) (-347.095) -- 0:00:27
65000 -- (-345.608) [-346.348] (-345.921) (-348.071) * [-346.557] (-347.568) (-344.643) (-344.784) -- 0:00:26
Average standard deviation of split frequencies: 0.026947
65500 -- (-344.469) (-348.372) [-344.524] (-347.857) * [-345.436] (-345.081) (-348.107) (-346.045) -- 0:00:26
66000 -- [-345.607] (-347.676) (-354.981) (-346.714) * (-345.162) [-345.580] (-345.181) (-345.918) -- 0:00:26
66500 -- (-345.350) (-344.145) [-346.387] (-346.394) * (-344.164) [-346.204] (-346.524) (-346.810) -- 0:00:26
67000 -- (-346.122) [-344.616] (-346.122) (-345.839) * (-344.512) (-349.762) (-345.717) [-346.614] -- 0:00:25
67500 -- (-346.950) [-346.447] (-345.811) (-347.778) * (-343.956) (-346.170) (-348.690) [-344.782] -- 0:00:25
68000 -- (-349.656) [-344.486] (-344.247) (-345.366) * [-345.072] (-344.093) (-344.347) (-346.409) -- 0:00:25
68500 -- (-347.227) (-345.797) (-344.234) [-344.530] * (-344.798) (-344.220) (-344.586) [-345.135] -- 0:00:25
69000 -- (-349.593) (-346.143) (-348.909) [-346.606] * (-344.737) (-344.983) (-345.434) [-344.395] -- 0:00:24
69500 -- (-346.525) (-344.199) [-346.580] (-348.959) * (-345.913) (-344.804) [-344.779] (-349.323) -- 0:00:24
70000 -- [-345.617] (-345.274) (-346.317) (-346.991) * (-346.298) (-348.932) (-344.912) [-346.331] -- 0:00:24
Average standard deviation of split frequencies: 0.028806
70500 -- [-346.926] (-344.981) (-348.289) (-344.197) * (-344.167) [-347.463] (-349.316) (-345.204) -- 0:00:24
71000 -- (-348.875) (-345.937) [-344.828] (-349.285) * (-345.248) (-345.462) (-349.909) [-344.729] -- 0:00:24
71500 -- (-345.046) (-347.812) [-344.460] (-348.093) * (-344.248) (-346.235) (-351.018) [-345.203] -- 0:00:23
72000 -- (-347.556) (-344.844) [-346.840] (-346.741) * (-345.578) (-348.818) (-351.484) [-346.585] -- 0:00:23
72500 -- (-347.872) (-346.807) [-345.903] (-346.332) * [-346.965] (-347.030) (-346.456) (-344.612) -- 0:00:23
73000 -- (-345.752) (-345.455) [-345.542] (-345.922) * [-347.150] (-349.420) (-349.746) (-344.877) -- 0:00:23
73500 -- (-345.756) (-349.894) (-345.598) [-346.121] * [-347.679] (-354.222) (-346.352) (-345.477) -- 0:00:23
74000 -- (-344.928) [-347.007] (-345.454) (-348.771) * (-343.932) (-348.106) [-347.748] (-348.959) -- 0:00:23
74500 -- (-345.514) [-348.421] (-345.074) (-344.695) * [-346.088] (-346.917) (-344.339) (-349.102) -- 0:00:28
75000 -- (-345.104) (-347.988) (-345.802) [-345.294] * (-346.477) (-346.026) [-345.261] (-348.149) -- 0:00:28
Average standard deviation of split frequencies: 0.024501
75500 -- (-350.006) (-346.419) [-349.119] (-349.739) * [-345.575] (-344.375) (-345.368) (-349.811) -- 0:00:28
76000 -- (-346.790) [-344.276] (-351.276) (-346.264) * (-344.922) (-345.572) [-345.485] (-346.811) -- 0:00:27
76500 -- (-347.110) (-344.823) (-348.515) [-346.633] * (-347.405) (-344.576) [-344.324] (-345.521) -- 0:00:27
77000 -- (-344.694) (-346.592) (-347.858) [-344.623] * [-344.858] (-346.891) (-345.184) (-345.414) -- 0:00:27
77500 -- (-350.228) (-347.782) [-347.404] (-345.676) * (-348.098) [-345.565] (-346.238) (-346.058) -- 0:00:27
78000 -- (-345.063) (-346.153) (-344.135) [-345.496] * (-348.195) [-344.047] (-348.151) (-346.359) -- 0:00:27
78500 -- (-345.299) (-346.351) [-346.281] (-345.805) * [-345.098] (-350.407) (-350.176) (-344.981) -- 0:00:26
79000 -- (-345.482) (-346.998) (-344.633) [-347.002] * [-344.490] (-346.028) (-351.602) (-348.119) -- 0:00:26
79500 -- [-346.318] (-346.326) (-345.021) (-346.444) * [-346.842] (-348.694) (-346.337) (-346.601) -- 0:00:26
80000 -- (-344.959) [-344.497] (-345.337) (-348.437) * (-346.244) (-348.686) [-344.524] (-345.789) -- 0:00:26
Average standard deviation of split frequencies: 0.022000
80500 -- (-346.179) (-344.770) (-344.782) [-345.769] * (-347.429) (-349.798) (-345.296) [-345.993] -- 0:00:26
81000 -- (-346.928) (-343.966) [-344.534] (-348.795) * (-347.850) [-349.066] (-346.960) (-345.717) -- 0:00:25
81500 -- (-350.881) [-345.324] (-345.828) (-348.429) * [-345.989] (-344.836) (-346.946) (-346.026) -- 0:00:25
82000 -- (-350.490) (-347.438) [-345.162] (-346.531) * (-344.305) [-346.080] (-344.536) (-347.713) -- 0:00:25
82500 -- [-346.809] (-344.602) (-347.029) (-344.879) * (-348.052) [-345.331] (-344.462) (-345.003) -- 0:00:25
83000 -- (-345.073) (-345.908) [-345.446] (-344.352) * (-345.391) [-344.928] (-347.459) (-344.625) -- 0:00:25
83500 -- [-347.213] (-347.631) (-345.719) (-346.478) * (-346.223) [-348.079] (-349.108) (-346.859) -- 0:00:24
84000 -- (-347.232) (-345.304) (-346.034) [-345.385] * [-346.061] (-346.970) (-347.035) (-344.859) -- 0:00:24
84500 -- (-344.392) [-346.993] (-345.965) (-345.576) * (-347.387) (-345.903) [-345.475] (-346.035) -- 0:00:24
85000 -- [-348.241] (-349.133) (-344.273) (-347.157) * (-346.667) [-345.797] (-344.642) (-347.394) -- 0:00:24
Average standard deviation of split frequencies: 0.019490
85500 -- (-351.651) (-347.052) (-345.192) [-345.473] * (-344.342) (-345.724) (-346.522) [-347.100] -- 0:00:24
86000 -- (-349.817) (-345.380) (-345.342) [-344.430] * (-348.643) (-344.264) [-346.345] (-344.682) -- 0:00:24
86500 -- (-344.784) (-346.560) (-344.995) [-346.539] * [-346.171] (-346.532) (-346.008) (-344.413) -- 0:00:23
87000 -- (-345.602) [-344.887] (-346.323) (-347.225) * (-348.070) [-345.173] (-344.143) (-345.580) -- 0:00:23
87500 -- [-345.734] (-344.706) (-344.835) (-346.640) * [-344.571] (-346.336) (-350.591) (-348.028) -- 0:00:23
88000 -- (-348.184) (-344.062) (-346.169) [-347.279] * (-346.449) [-345.777] (-349.730) (-346.054) -- 0:00:23
88500 -- (-344.324) [-344.051] (-345.451) (-344.682) * (-344.629) [-346.162] (-347.758) (-346.501) -- 0:00:23
89000 -- (-346.451) (-346.202) [-347.311] (-346.945) * (-345.399) (-348.025) [-348.365] (-344.703) -- 0:00:23
89500 -- [-346.668] (-346.615) (-347.876) (-345.835) * (-344.474) [-345.953] (-348.155) (-350.127) -- 0:00:22
90000 -- (-347.271) [-348.768] (-346.296) (-344.248) * (-346.130) (-345.580) (-347.162) [-345.920] -- 0:00:22
Average standard deviation of split frequencies: 0.020797
90500 -- (-347.833) (-345.061) (-348.030) [-345.826] * (-345.475) (-345.401) [-352.006] (-345.219) -- 0:00:22
91000 -- (-346.495) [-346.129] (-345.728) (-347.131) * (-345.376) [-346.103] (-346.725) (-349.492) -- 0:00:22
91500 -- (-347.678) (-344.858) [-347.287] (-351.411) * [-344.464] (-348.157) (-347.503) (-343.858) -- 0:00:26
92000 -- (-347.924) (-349.128) [-345.320] (-346.051) * [-345.891] (-347.906) (-348.637) (-344.915) -- 0:00:26
92500 -- (-347.172) (-345.952) (-345.915) [-348.775] * (-345.476) (-349.801) [-347.405] (-345.261) -- 0:00:26
93000 -- (-346.664) (-347.606) [-344.988] (-344.268) * [-345.199] (-346.877) (-345.197) (-347.562) -- 0:00:26
93500 -- (-347.819) (-346.313) [-346.918] (-351.187) * (-346.957) (-345.815) [-344.125] (-348.903) -- 0:00:26
94000 -- [-345.996] (-348.206) (-348.477) (-347.043) * (-347.083) [-346.073] (-344.297) (-344.198) -- 0:00:25
94500 -- (-349.116) (-344.552) (-345.814) [-344.574] * [-346.922] (-347.018) (-344.211) (-345.126) -- 0:00:25
95000 -- (-352.652) [-346.196] (-346.912) (-345.173) * (-345.675) (-347.231) [-344.792] (-345.644) -- 0:00:25
Average standard deviation of split frequencies: 0.020417
95500 -- (-348.654) (-345.676) [-346.389] (-345.946) * [-345.027] (-351.243) (-344.757) (-345.127) -- 0:00:25
96000 -- (-346.217) [-346.963] (-346.061) (-345.359) * [-345.185] (-348.946) (-346.455) (-349.335) -- 0:00:25
96500 -- [-345.142] (-344.776) (-347.398) (-350.499) * (-344.949) [-346.701] (-349.075) (-344.802) -- 0:00:25
97000 -- (-345.173) (-344.897) [-347.087] (-344.575) * [-344.295] (-349.958) (-344.976) (-347.068) -- 0:00:24
97500 -- [-346.349] (-345.139) (-345.874) (-347.681) * (-346.947) (-345.698) (-347.025) [-345.003] -- 0:00:24
98000 -- [-345.449] (-347.723) (-344.718) (-346.610) * (-345.393) [-345.876] (-345.908) (-345.037) -- 0:00:24
98500 -- [-345.512] (-346.563) (-348.196) (-346.039) * (-344.711) (-344.019) (-344.361) [-345.550] -- 0:00:24
99000 -- (-345.866) (-346.650) (-349.217) [-346.326] * (-346.417) (-347.529) [-346.678] (-345.223) -- 0:00:24
99500 -- (-347.462) (-344.863) (-345.651) [-349.705] * (-344.424) (-349.689) [-345.830] (-345.326) -- 0:00:24
100000 -- [-344.397] (-345.019) (-345.052) (-346.869) * (-345.551) (-343.926) [-347.313] (-344.926) -- 0:00:24
Average standard deviation of split frequencies: 0.019007
100500 -- [-350.614] (-345.558) (-344.476) (-344.888) * (-347.792) [-344.494] (-345.344) (-343.948) -- 0:00:23
101000 -- [-345.716] (-345.630) (-348.414) (-346.439) * (-348.139) [-344.393] (-345.149) (-345.763) -- 0:00:23
101500 -- (-345.236) [-344.722] (-348.144) (-346.199) * (-346.991) [-345.816] (-347.747) (-348.553) -- 0:00:23
102000 -- (-344.123) (-346.265) [-344.675] (-348.083) * (-344.873) [-345.849] (-344.796) (-346.502) -- 0:00:23
102500 -- (-346.866) (-349.758) [-344.635] (-346.176) * (-348.676) (-345.925) [-344.751] (-344.212) -- 0:00:23
103000 -- (-345.237) (-346.978) (-346.964) [-345.375] * (-348.338) (-348.251) [-345.690] (-344.243) -- 0:00:23
103500 -- (-348.232) (-348.443) [-346.301] (-348.280) * (-345.414) [-346.058] (-348.087) (-346.291) -- 0:00:22
104000 -- (-350.936) (-347.364) (-344.660) [-344.438] * (-346.611) [-345.261] (-347.205) (-345.288) -- 0:00:22
104500 -- [-345.878] (-345.690) (-346.323) (-345.586) * (-348.131) (-346.418) [-352.846] (-345.840) -- 0:00:22
105000 -- [-348.339] (-345.929) (-346.251) (-347.417) * [-348.227] (-349.410) (-346.944) (-347.946) -- 0:00:22
Average standard deviation of split frequencies: 0.020666
105500 -- (-350.461) [-345.605] (-345.130) (-346.225) * (-345.013) (-348.212) [-346.862] (-344.686) -- 0:00:22
106000 -- (-346.163) [-345.035] (-346.289) (-346.743) * [-344.599] (-348.933) (-345.096) (-343.762) -- 0:00:22
106500 -- (-347.077) (-344.744) (-344.655) [-346.172] * (-345.348) (-346.471) [-347.607] (-343.988) -- 0:00:22
107000 -- (-344.688) (-350.562) [-345.752] (-347.421) * [-346.142] (-346.789) (-347.266) (-346.645) -- 0:00:22
107500 -- (-347.489) (-348.593) [-348.458] (-346.290) * (-349.392) (-346.155) (-345.203) [-346.176] -- 0:00:21
108000 -- (-348.057) [-345.873] (-352.807) (-344.149) * (-344.389) (-345.449) [-344.312] (-346.823) -- 0:00:21
108500 -- [-348.270] (-354.095) (-345.975) (-346.114) * (-346.802) (-345.962) [-344.821] (-351.411) -- 0:00:25
109000 -- (-347.905) [-344.728] (-346.668) (-344.266) * (-345.446) (-346.334) [-348.669] (-349.198) -- 0:00:25
109500 -- [-348.058] (-347.321) (-343.745) (-343.937) * (-345.219) (-346.752) [-348.409] (-345.591) -- 0:00:24
110000 -- (-347.610) (-348.257) (-344.595) [-343.925] * (-345.330) [-346.192] (-347.496) (-347.188) -- 0:00:24
Average standard deviation of split frequencies: 0.019544
110500 -- (-346.121) (-347.740) (-346.831) [-344.868] * [-345.556] (-346.101) (-345.977) (-346.055) -- 0:00:24
111000 -- (-343.943) [-345.892] (-346.644) (-344.076) * [-347.755] (-348.483) (-349.639) (-345.240) -- 0:00:24
111500 -- (-344.513) (-345.040) [-349.151] (-345.616) * (-349.637) (-344.751) [-347.017] (-346.485) -- 0:00:24
112000 -- (-344.926) [-352.078] (-346.308) (-345.079) * (-354.524) (-345.560) (-345.027) [-347.769] -- 0:00:24
112500 -- (-344.169) [-344.937] (-345.773) (-346.637) * (-360.413) [-344.344] (-349.355) (-348.785) -- 0:00:24
113000 -- (-344.193) [-344.888] (-344.606) (-344.330) * (-349.084) [-346.047] (-349.378) (-347.315) -- 0:00:23
113500 -- [-345.445] (-346.559) (-348.653) (-345.958) * (-343.975) (-345.982) [-347.637] (-346.714) -- 0:00:23
114000 -- (-346.183) (-344.576) [-346.553] (-348.771) * (-346.184) (-347.636) (-347.015) [-345.101] -- 0:00:23
114500 -- [-344.407] (-347.623) (-346.307) (-351.368) * (-347.688) [-344.985] (-345.832) (-346.812) -- 0:00:23
115000 -- [-345.652] (-345.548) (-344.710) (-349.425) * (-344.598) [-346.752] (-344.861) (-350.778) -- 0:00:23
Average standard deviation of split frequencies: 0.021222
115500 -- (-345.289) (-343.869) (-346.897) [-347.855] * [-344.920] (-344.542) (-345.267) (-346.205) -- 0:00:23
116000 -- [-345.239] (-350.367) (-344.432) (-347.060) * (-347.282) (-351.202) [-345.366] (-345.195) -- 0:00:23
116500 -- (-348.140) (-354.329) [-346.138] (-347.765) * (-346.042) [-347.177] (-345.901) (-343.983) -- 0:00:23
117000 -- (-344.351) [-345.229] (-351.185) (-345.163) * (-349.256) (-346.801) (-346.044) [-344.217] -- 0:00:22
117500 -- (-345.245) (-346.683) [-349.540] (-343.816) * (-346.285) [-344.648] (-346.084) (-343.782) -- 0:00:22
118000 -- (-346.674) (-344.607) [-347.335] (-344.092) * (-347.247) [-343.848] (-345.147) (-347.807) -- 0:00:22
118500 -- (-347.655) (-345.545) (-345.332) [-343.826] * (-346.989) (-344.899) (-344.789) [-345.103] -- 0:00:22
119000 -- (-344.951) [-344.928] (-346.642) (-350.219) * (-346.681) [-346.580] (-347.315) (-344.479) -- 0:00:22
119500 -- (-351.734) [-344.875] (-344.060) (-347.600) * (-343.836) (-347.296) (-348.177) [-345.030] -- 0:00:22
120000 -- (-346.280) (-345.494) [-344.300] (-345.035) * [-346.288] (-348.322) (-344.495) (-347.099) -- 0:00:22
Average standard deviation of split frequencies: 0.020184
120500 -- (-344.962) (-345.761) (-344.871) [-347.277] * (-347.446) [-346.913] (-346.083) (-346.447) -- 0:00:22
121000 -- (-344.680) [-343.958] (-345.640) (-347.438) * (-344.615) [-345.435] (-345.957) (-347.331) -- 0:00:21
121500 -- (-344.717) (-346.282) (-345.748) [-346.598] * (-346.862) (-344.113) (-344.665) [-344.177] -- 0:00:21
122000 -- (-345.826) [-347.563] (-346.523) (-349.286) * (-344.067) (-344.523) [-345.232] (-351.079) -- 0:00:21
122500 -- [-348.099] (-352.500) (-345.068) (-345.034) * (-346.267) (-344.773) (-344.028) [-345.846] -- 0:00:21
123000 -- (-348.106) [-349.797] (-346.845) (-344.959) * (-345.818) (-344.203) (-344.672) [-347.173] -- 0:00:21
123500 -- (-349.470) (-350.739) [-346.214] (-343.819) * [-347.082] (-345.971) (-349.467) (-350.135) -- 0:00:21
124000 -- (-347.175) (-346.757) (-345.576) [-345.125] * (-344.456) (-346.062) (-350.275) [-346.326] -- 0:00:21
124500 -- [-350.266] (-346.337) (-345.243) (-347.796) * [-343.810] (-347.028) (-345.770) (-345.835) -- 0:00:21
125000 -- [-348.648] (-348.866) (-344.936) (-344.672) * (-344.645) [-346.449] (-345.143) (-347.372) -- 0:00:21
Average standard deviation of split frequencies: 0.018519
125500 -- (-349.309) [-347.198] (-344.483) (-349.840) * [-346.207] (-345.207) (-347.454) (-345.214) -- 0:00:23
126000 -- (-351.703) [-344.282] (-345.384) (-347.519) * (-346.679) (-346.934) (-346.615) [-343.898] -- 0:00:23
126500 -- [-347.014] (-344.096) (-345.909) (-346.009) * (-349.894) (-345.349) [-346.973] (-345.066) -- 0:00:23
127000 -- (-346.786) (-344.980) [-345.524] (-350.171) * (-353.803) [-344.989] (-346.328) (-345.383) -- 0:00:23
127500 -- (-348.052) (-346.829) (-345.832) [-344.984] * (-346.000) (-350.218) (-345.297) [-343.924] -- 0:00:23
128000 -- (-348.165) (-351.299) [-344.364] (-344.467) * [-345.259] (-350.970) (-345.243) (-344.144) -- 0:00:23
128500 -- (-344.035) (-354.415) [-343.897] (-346.041) * (-347.208) (-347.115) [-348.035] (-345.128) -- 0:00:23
129000 -- (-348.679) (-345.172) (-344.790) [-345.476] * [-347.815] (-347.340) (-347.907) (-346.981) -- 0:00:23
129500 -- [-346.831] (-345.409) (-344.353) (-349.129) * [-344.540] (-345.240) (-344.579) (-346.063) -- 0:00:22
130000 -- (-346.292) (-343.728) [-345.760] (-349.840) * (-345.451) (-344.443) (-347.064) [-346.273] -- 0:00:22
Average standard deviation of split frequencies: 0.018640
130500 -- (-348.395) [-344.644] (-345.774) (-345.442) * [-346.235] (-345.485) (-351.264) (-347.754) -- 0:00:22
131000 -- (-348.202) (-345.003) [-344.522] (-346.310) * (-347.541) (-346.008) [-345.973] (-344.676) -- 0:00:22
131500 -- (-345.410) [-345.835] (-344.466) (-346.277) * [-346.266] (-345.705) (-352.054) (-345.205) -- 0:00:22
132000 -- (-344.578) [-345.560] (-346.288) (-344.053) * (-345.194) (-344.293) (-347.478) [-345.833] -- 0:00:22
132500 -- [-344.538] (-345.962) (-344.874) (-345.976) * (-344.591) (-344.936) [-347.746] (-345.453) -- 0:00:22
133000 -- [-344.283] (-348.736) (-345.571) (-345.856) * [-344.894] (-344.353) (-346.743) (-344.042) -- 0:00:22
133500 -- (-347.939) (-347.726) (-346.197) [-344.654] * (-346.479) (-346.797) (-344.527) [-344.082] -- 0:00:21
134000 -- [-347.114] (-348.156) (-344.291) (-345.618) * (-344.934) (-344.042) (-346.946) [-346.020] -- 0:00:21
134500 -- [-346.045] (-346.921) (-347.348) (-345.977) * (-345.929) (-346.454) [-347.758] (-346.562) -- 0:00:21
135000 -- [-347.586] (-347.549) (-344.219) (-348.393) * (-346.452) [-346.408] (-346.467) (-346.072) -- 0:00:21
Average standard deviation of split frequencies: 0.020797
135500 -- (-347.761) (-349.124) [-346.309] (-349.034) * (-344.908) (-347.488) [-347.174] (-345.339) -- 0:00:21
136000 -- [-349.474] (-348.252) (-346.726) (-346.425) * (-344.385) (-345.876) [-345.010] (-345.891) -- 0:00:21
136500 -- (-349.217) (-346.636) [-345.800] (-349.916) * [-344.804] (-351.057) (-344.917) (-344.354) -- 0:00:21
137000 -- (-344.682) (-346.454) (-348.180) [-345.394] * [-346.714] (-346.837) (-350.336) (-347.923) -- 0:00:21
137500 -- (-346.581) (-347.079) (-345.162) [-346.823] * (-349.215) (-348.335) (-344.758) [-345.402] -- 0:00:21
138000 -- (-344.250) [-346.261] (-344.774) (-349.588) * (-346.195) (-344.811) (-346.113) [-345.544] -- 0:00:20
138500 -- [-344.550] (-347.861) (-345.051) (-352.885) * (-347.022) (-345.590) (-348.546) [-344.720] -- 0:00:20
139000 -- [-345.883] (-346.485) (-346.490) (-350.006) * (-347.594) [-344.170] (-346.514) (-348.468) -- 0:00:20
139500 -- (-346.133) (-350.685) [-345.784] (-344.498) * (-347.201) [-346.418] (-347.446) (-344.610) -- 0:00:20
140000 -- (-347.020) (-346.715) [-346.743] (-344.623) * [-347.075] (-344.226) (-345.852) (-346.008) -- 0:00:20
Average standard deviation of split frequencies: 0.019363
140500 -- [-350.900] (-348.824) (-346.310) (-347.129) * [-347.067] (-347.069) (-345.425) (-347.879) -- 0:00:20
141000 -- [-350.099] (-345.293) (-345.877) (-345.009) * (-346.561) (-346.649) (-345.897) [-346.637] -- 0:00:20
141500 -- (-345.669) [-348.177] (-347.740) (-343.917) * [-345.287] (-344.624) (-345.422) (-349.998) -- 0:00:22
142000 -- [-345.510] (-353.713) (-345.275) (-344.348) * (-347.183) [-343.916] (-345.007) (-348.292) -- 0:00:22
142500 -- [-344.612] (-346.661) (-346.501) (-344.576) * (-344.593) [-344.136] (-346.417) (-345.530) -- 0:00:22
143000 -- (-344.643) [-345.267] (-346.262) (-347.022) * (-345.665) (-344.349) [-344.791] (-344.240) -- 0:00:22
143500 -- [-346.996] (-346.070) (-345.099) (-350.485) * (-344.985) (-343.939) (-346.439) [-350.819] -- 0:00:22
144000 -- [-344.981] (-348.982) (-347.742) (-345.207) * (-346.506) [-347.502] (-344.988) (-348.488) -- 0:00:22
144500 -- (-344.872) (-349.432) (-347.628) [-345.226] * [-349.512] (-345.159) (-343.959) (-346.261) -- 0:00:22
145000 -- (-345.329) (-347.607) (-348.684) [-348.716] * [-345.567] (-347.963) (-347.825) (-346.208) -- 0:00:22
Average standard deviation of split frequencies: 0.018353
145500 -- (-348.242) (-349.049) (-347.644) [-345.844] * (-348.645) (-348.925) (-346.792) [-345.782] -- 0:00:21
146000 -- (-352.504) (-345.804) [-344.663] (-345.902) * (-346.836) (-348.781) [-347.633] (-349.370) -- 0:00:21
146500 -- (-347.510) (-346.723) [-350.468] (-344.745) * [-344.332] (-347.688) (-347.047) (-346.159) -- 0:00:21
147000 -- (-345.885) (-349.679) [-345.770] (-345.066) * (-345.192) (-344.723) (-347.022) [-345.070] -- 0:00:21
147500 -- (-344.311) (-344.323) (-345.225) [-346.303] * (-346.317) [-344.455] (-344.620) (-346.056) -- 0:00:21
148000 -- (-344.157) [-344.466] (-346.533) (-344.950) * (-344.439) (-348.316) (-345.021) [-346.129] -- 0:00:21
148500 -- (-346.650) (-344.256) [-347.216] (-345.957) * (-344.739) (-345.869) (-345.724) [-347.735] -- 0:00:21
149000 -- (-346.850) (-347.923) [-345.543] (-347.776) * (-345.658) (-345.891) (-346.253) [-347.015] -- 0:00:21
149500 -- (-345.045) (-344.279) [-346.040] (-347.463) * (-344.748) (-347.945) (-349.420) [-346.659] -- 0:00:21
150000 -- (-346.951) [-343.979] (-347.378) (-345.557) * (-346.648) [-345.352] (-343.839) (-345.219) -- 0:00:21
Average standard deviation of split frequencies: 0.019509
150500 -- (-345.913) [-344.002] (-345.241) (-345.042) * (-345.163) [-346.850] (-345.326) (-345.136) -- 0:00:20
151000 -- (-345.691) (-344.220) [-347.186] (-344.377) * (-344.282) (-345.440) [-344.416] (-345.177) -- 0:00:20
151500 -- (-346.536) (-344.218) (-346.731) [-345.185] * [-350.179] (-344.656) (-348.502) (-344.055) -- 0:00:20
152000 -- (-345.822) (-345.578) (-347.701) [-349.312] * [-344.959] (-345.385) (-344.429) (-344.764) -- 0:00:20
152500 -- (-346.476) (-344.873) [-349.134] (-347.928) * [-346.178] (-345.931) (-344.797) (-345.302) -- 0:00:20
153000 -- [-344.361] (-348.268) (-347.465) (-347.854) * [-344.638] (-347.567) (-345.859) (-345.626) -- 0:00:20
153500 -- (-343.829) (-346.420) [-344.915] (-348.945) * (-346.911) (-344.831) (-344.932) [-344.696] -- 0:00:20
154000 -- (-344.492) (-344.711) (-346.727) [-345.197] * [-348.086] (-344.850) (-344.557) (-347.501) -- 0:00:20
154500 -- (-346.332) [-348.845] (-346.635) (-345.022) * [-345.585] (-346.968) (-344.347) (-350.062) -- 0:00:20
155000 -- (-345.698) (-344.155) (-348.085) [-343.994] * [-345.216] (-349.638) (-344.449) (-346.120) -- 0:00:20
Average standard deviation of split frequencies: 0.019403
155500 -- (-347.997) [-345.670] (-345.677) (-347.055) * (-344.649) [-347.862] (-349.380) (-348.099) -- 0:00:19
156000 -- (-347.280) [-345.762] (-346.682) (-345.477) * (-345.160) (-346.274) (-345.931) [-350.964] -- 0:00:19
156500 -- (-350.859) [-344.737] (-347.897) (-344.751) * (-344.556) (-345.232) (-346.560) [-343.843] -- 0:00:19
157000 -- (-348.168) (-345.331) (-347.780) [-344.589] * (-344.419) [-344.384] (-345.849) (-349.190) -- 0:00:19
157500 -- (-344.837) (-346.490) (-346.431) [-347.030] * (-345.972) [-346.413] (-345.554) (-345.790) -- 0:00:19
158000 -- [-346.894] (-346.510) (-349.788) (-345.928) * (-347.345) [-346.278] (-345.738) (-346.867) -- 0:00:19
158500 -- [-346.172] (-344.641) (-349.131) (-350.617) * (-347.268) (-346.070) (-345.833) [-343.747] -- 0:00:19
159000 -- (-347.422) (-347.616) [-346.835] (-344.828) * (-343.839) (-346.761) [-344.039] (-344.147) -- 0:00:21
159500 -- (-346.349) [-346.861] (-344.023) (-344.784) * (-346.462) (-346.078) (-346.458) [-344.895] -- 0:00:21
160000 -- (-344.276) (-345.815) (-344.235) [-345.275] * (-349.455) [-346.066] (-344.580) (-344.531) -- 0:00:21
Average standard deviation of split frequencies: 0.018908
160500 -- (-344.194) (-347.423) [-347.346] (-347.097) * (-344.230) (-344.886) [-348.205] (-346.135) -- 0:00:21
161000 -- (-345.864) (-347.481) (-347.296) [-346.388] * (-345.396) [-345.166] (-346.783) (-347.882) -- 0:00:21
161500 -- (-346.834) [-344.196] (-346.572) (-347.787) * (-346.919) [-345.958] (-344.109) (-346.367) -- 0:00:20
162000 -- (-345.169) (-344.050) [-345.981] (-347.181) * (-344.032) (-345.700) [-344.933] (-346.327) -- 0:00:20
162500 -- [-345.573] (-349.880) (-345.977) (-346.252) * (-347.062) (-347.963) (-344.415) [-345.358] -- 0:00:20
163000 -- (-346.532) (-345.361) [-346.256] (-345.218) * (-346.315) (-346.924) [-344.583] (-351.790) -- 0:00:20
163500 -- [-346.514] (-345.751) (-350.415) (-347.822) * (-346.231) (-345.446) [-346.945] (-346.074) -- 0:00:20
164000 -- (-347.593) (-346.594) (-345.367) [-344.862] * [-346.410] (-348.285) (-348.794) (-346.349) -- 0:00:20
164500 -- (-347.148) (-345.891) [-346.784] (-347.368) * (-348.567) [-346.619] (-346.869) (-345.510) -- 0:00:20
165000 -- (-352.543) (-347.033) [-344.206] (-344.542) * (-344.149) (-347.079) [-347.067] (-347.158) -- 0:00:20
Average standard deviation of split frequencies: 0.018143
165500 -- (-344.559) (-347.256) [-345.074] (-354.549) * [-345.104] (-348.856) (-344.629) (-347.106) -- 0:00:20
166000 -- (-344.268) [-344.359] (-345.405) (-347.501) * (-345.052) [-344.695] (-344.960) (-346.052) -- 0:00:20
166500 -- (-346.304) (-343.761) (-345.960) [-348.246] * [-346.134] (-347.780) (-348.402) (-345.691) -- 0:00:20
167000 -- [-347.515] (-344.903) (-348.994) (-346.997) * (-346.059) (-345.094) [-344.356] (-348.580) -- 0:00:19
167500 -- (-348.536) [-346.343] (-347.210) (-345.589) * (-345.100) (-347.485) (-347.320) [-345.934] -- 0:00:19
168000 -- [-349.943] (-346.882) (-346.519) (-345.059) * (-350.448) (-349.769) (-345.692) [-346.507] -- 0:00:19
168500 -- (-345.360) (-348.932) (-346.877) [-347.388] * [-344.854] (-351.477) (-344.610) (-344.818) -- 0:00:19
169000 -- [-346.541] (-349.105) (-343.901) (-345.820) * (-345.856) [-346.675] (-346.120) (-344.497) -- 0:00:19
169500 -- (-345.038) (-346.345) [-343.807] (-345.969) * (-345.090) [-346.045] (-344.375) (-350.835) -- 0:00:19
170000 -- [-343.904] (-348.729) (-344.101) (-346.040) * (-347.505) (-345.175) [-346.279] (-347.431) -- 0:00:19
Average standard deviation of split frequencies: 0.018568
170500 -- [-345.647] (-347.542) (-346.587) (-348.638) * (-345.718) (-344.636) [-346.754] (-347.140) -- 0:00:19
171000 -- (-347.701) (-348.099) [-344.760] (-347.366) * (-344.551) (-345.053) [-348.179] (-347.625) -- 0:00:19
171500 -- (-344.841) (-347.350) [-346.974] (-345.806) * [-349.242] (-346.331) (-347.928) (-345.059) -- 0:00:19
172000 -- (-344.561) (-348.210) [-345.247] (-346.298) * (-344.449) [-346.982] (-348.315) (-348.696) -- 0:00:19
172500 -- [-347.005] (-350.671) (-346.100) (-345.818) * (-344.992) (-346.499) (-350.418) [-345.612] -- 0:00:18
173000 -- (-351.976) [-346.496] (-346.084) (-346.403) * (-349.200) (-345.202) [-346.078] (-345.510) -- 0:00:18
173500 -- (-355.453) (-346.855) (-348.037) [-343.973] * [-346.687] (-348.284) (-346.085) (-348.072) -- 0:00:18
174000 -- (-346.183) (-347.938) [-346.297] (-344.108) * (-348.108) [-345.986] (-344.500) (-348.475) -- 0:00:18
174500 -- (-346.056) (-346.279) (-345.658) [-344.553] * (-344.880) (-344.155) [-348.540] (-345.408) -- 0:00:18
175000 -- (-345.773) (-344.362) [-344.862] (-345.671) * (-347.725) [-350.710] (-350.042) (-347.275) -- 0:00:18
Average standard deviation of split frequencies: 0.017621
175500 -- (-346.440) [-344.954] (-345.914) (-344.905) * [-344.800] (-345.381) (-345.069) (-347.448) -- 0:00:20
176000 -- (-345.740) (-346.306) [-344.783] (-344.285) * (-344.545) (-346.754) (-344.868) [-352.719] -- 0:00:20
176500 -- [-345.513] (-343.832) (-346.580) (-344.795) * (-345.924) (-346.181) [-344.268] (-346.933) -- 0:00:20
177000 -- (-345.615) (-347.864) (-344.791) [-346.196] * (-346.537) (-346.422) [-345.349] (-349.807) -- 0:00:20
177500 -- [-346.825] (-344.262) (-346.492) (-345.594) * [-345.167] (-347.795) (-345.210) (-346.544) -- 0:00:19
178000 -- (-346.463) (-347.856) [-347.268] (-345.668) * [-344.093] (-343.958) (-344.575) (-345.386) -- 0:00:19
178500 -- [-344.982] (-345.164) (-346.233) (-344.180) * [-344.083] (-348.095) (-345.170) (-348.160) -- 0:00:19
179000 -- (-346.157) (-346.687) (-345.180) [-345.903] * [-346.660] (-346.211) (-349.075) (-347.980) -- 0:00:19
179500 -- [-345.636] (-351.728) (-344.021) (-346.486) * [-346.733] (-348.510) (-349.411) (-346.814) -- 0:00:19
180000 -- (-348.088) (-345.858) (-346.509) [-344.405] * (-346.061) [-345.941] (-346.740) (-345.672) -- 0:00:19
Average standard deviation of split frequencies: 0.018555
180500 -- [-346.627] (-348.463) (-345.790) (-346.263) * (-347.561) [-345.578] (-346.349) (-346.593) -- 0:00:19
181000 -- (-351.666) [-345.723] (-345.668) (-346.627) * (-348.690) (-348.793) (-345.600) [-346.356] -- 0:00:19
181500 -- (-345.937) (-346.335) [-347.909] (-346.177) * [-345.079] (-345.385) (-348.852) (-348.289) -- 0:00:19
182000 -- (-348.628) (-345.323) [-344.568] (-347.819) * [-346.857] (-350.491) (-347.606) (-346.867) -- 0:00:19
182500 -- (-344.643) [-345.714] (-348.897) (-353.602) * (-344.832) [-347.536] (-346.524) (-347.480) -- 0:00:19
183000 -- (-345.673) [-346.379] (-348.221) (-351.695) * (-350.879) (-344.425) (-346.250) [-347.729] -- 0:00:19
183500 -- (-345.982) [-346.114] (-348.903) (-347.011) * (-349.202) [-345.790] (-344.742) (-348.482) -- 0:00:18
184000 -- (-344.322) [-344.286] (-346.466) (-344.162) * (-347.339) [-348.825] (-348.875) (-345.655) -- 0:00:18
184500 -- (-346.339) (-344.308) (-348.488) [-347.910] * [-350.606] (-347.269) (-349.018) (-346.214) -- 0:00:18
185000 -- (-345.713) (-350.724) (-346.441) [-349.851] * [-346.101] (-345.904) (-347.063) (-348.900) -- 0:00:18
Average standard deviation of split frequencies: 0.014221
185500 -- (-345.327) (-347.577) [-346.417] (-345.668) * (-345.770) (-352.572) [-345.940] (-348.511) -- 0:00:18
186000 -- (-346.405) [-346.186] (-345.104) (-346.626) * (-347.417) [-346.141] (-346.521) (-346.068) -- 0:00:18
186500 -- (-346.499) [-348.245] (-344.851) (-346.543) * (-348.791) (-346.741) [-347.901] (-346.189) -- 0:00:18
187000 -- (-346.433) [-344.328] (-345.360) (-345.644) * [-345.982] (-346.530) (-346.706) (-345.601) -- 0:00:18
187500 -- (-346.283) (-345.848) (-347.190) [-345.229] * (-344.754) (-347.399) (-346.831) [-343.805] -- 0:00:18
188000 -- (-348.969) [-345.349] (-346.045) (-345.896) * (-345.376) (-351.804) [-346.906] (-346.700) -- 0:00:18
188500 -- (-344.571) [-346.064] (-346.637) (-347.623) * [-346.203] (-346.936) (-347.163) (-346.531) -- 0:00:18
189000 -- (-346.148) (-345.556) [-346.804] (-346.361) * (-343.798) [-346.558] (-349.328) (-344.838) -- 0:00:18
189500 -- (-346.493) (-347.582) (-347.088) [-346.327] * (-345.400) (-345.860) [-345.388] (-346.872) -- 0:00:18
190000 -- (-347.707) [-355.167] (-344.787) (-345.702) * (-345.814) (-345.944) [-346.532] (-349.672) -- 0:00:17
Average standard deviation of split frequencies: 0.013525
190500 -- (-347.733) (-345.514) [-345.727] (-345.628) * (-345.329) (-345.557) (-346.747) [-345.141] -- 0:00:17
191000 -- (-345.298) (-346.433) (-348.254) [-344.761] * (-344.860) (-350.650) (-344.826) [-344.749] -- 0:00:17
191500 -- (-344.585) (-346.658) (-344.823) [-345.932] * (-344.570) (-344.573) [-351.616] (-345.005) -- 0:00:17
192000 -- (-345.090) (-345.102) [-345.356] (-345.912) * (-346.539) [-346.428] (-346.808) (-345.430) -- 0:00:17
192500 -- (-345.783) (-347.031) (-345.473) [-347.067] * [-347.455] (-346.589) (-347.978) (-344.811) -- 0:00:17
193000 -- (-349.199) [-350.750] (-344.400) (-348.079) * (-346.470) (-346.581) (-350.833) [-344.103] -- 0:00:19
193500 -- [-348.534] (-346.909) (-348.579) (-347.223) * [-344.370] (-346.842) (-346.826) (-347.917) -- 0:00:19
194000 -- (-345.791) (-347.329) [-344.905] (-346.733) * (-351.113) (-348.769) [-344.128] (-347.909) -- 0:00:18
194500 -- [-344.242] (-344.653) (-345.231) (-348.127) * (-347.818) (-346.919) [-346.215] (-346.119) -- 0:00:18
195000 -- [-344.699] (-346.373) (-345.854) (-348.676) * (-353.689) (-347.594) [-344.394] (-344.704) -- 0:00:18
Average standard deviation of split frequencies: 0.013763
195500 -- (-346.017) [-345.009] (-347.710) (-345.729) * (-348.701) [-345.748] (-344.885) (-347.002) -- 0:00:18
196000 -- [-345.438] (-349.509) (-346.777) (-346.391) * (-352.917) (-347.053) (-345.678) [-345.539] -- 0:00:18
196500 -- [-348.706] (-345.227) (-346.134) (-344.310) * (-353.325) (-349.457) (-345.234) [-347.410] -- 0:00:18
197000 -- (-346.372) [-346.871] (-345.137) (-346.931) * [-345.184] (-345.956) (-347.354) (-348.034) -- 0:00:18
197500 -- (-345.553) (-347.852) (-345.468) [-346.831] * [-345.486] (-343.984) (-348.429) (-346.140) -- 0:00:18
198000 -- [-349.988] (-348.687) (-347.831) (-349.601) * (-347.847) [-345.422] (-346.160) (-346.168) -- 0:00:18
198500 -- [-344.320] (-348.704) (-347.003) (-345.650) * (-347.131) (-344.955) (-347.132) [-346.218] -- 0:00:18
199000 -- [-345.327] (-345.940) (-348.698) (-344.839) * [-347.458] (-344.429) (-346.935) (-346.529) -- 0:00:18
199500 -- (-345.618) (-346.270) [-345.353] (-346.279) * [-345.675] (-345.571) (-346.338) (-345.357) -- 0:00:18
200000 -- (-347.312) [-348.205] (-346.570) (-347.380) * (-345.584) (-344.297) [-345.825] (-345.277) -- 0:00:18
Average standard deviation of split frequencies: 0.016197
200500 -- (-345.617) [-345.181] (-346.869) (-345.366) * (-347.813) [-345.460] (-345.741) (-346.191) -- 0:00:17
201000 -- (-347.200) (-343.711) (-348.335) [-344.965] * [-344.151] (-349.902) (-347.540) (-346.184) -- 0:00:17
201500 -- (-347.625) [-346.364] (-346.170) (-345.629) * (-349.608) (-348.404) (-344.997) [-348.033] -- 0:00:17
202000 -- (-347.381) (-350.440) (-345.399) [-344.506] * [-349.021] (-347.376) (-345.768) (-345.444) -- 0:00:17
202500 -- (-344.822) (-346.453) (-348.996) [-344.864] * (-348.057) [-346.249] (-347.590) (-347.794) -- 0:00:17
203000 -- (-345.704) (-345.748) [-345.889] (-349.213) * [-347.863] (-345.545) (-348.860) (-345.069) -- 0:00:17
203500 -- [-345.303] (-350.361) (-347.003) (-350.188) * (-345.040) (-352.043) (-346.414) [-344.702] -- 0:00:17
204000 -- (-344.403) (-350.075) (-348.572) [-345.742] * (-345.729) (-347.967) (-344.826) [-345.972] -- 0:00:17
204500 -- (-346.536) (-348.794) [-344.613] (-347.060) * (-345.788) (-345.913) [-345.406] (-346.684) -- 0:00:17
205000 -- (-346.387) (-347.624) [-344.634] (-345.420) * [-345.629] (-348.315) (-344.498) (-346.596) -- 0:00:17
Average standard deviation of split frequencies: 0.015416
205500 -- [-347.360] (-344.548) (-349.994) (-347.710) * (-344.851) [-346.659] (-345.598) (-345.297) -- 0:00:17
206000 -- (-345.023) (-345.246) (-348.676) [-344.434] * [-345.873] (-344.850) (-345.680) (-349.544) -- 0:00:17
206500 -- [-345.874] (-346.006) (-346.173) (-345.355) * (-344.055) (-344.520) [-346.599] (-346.346) -- 0:00:17
207000 -- (-344.750) (-346.093) (-347.463) [-345.744] * (-346.038) (-345.871) [-344.068] (-345.694) -- 0:00:16
207500 -- (-347.463) (-352.767) [-347.378] (-344.501) * (-345.389) [-346.814] (-347.414) (-347.916) -- 0:00:16
208000 -- [-350.275] (-347.155) (-343.918) (-343.923) * (-344.264) [-348.683] (-347.471) (-346.802) -- 0:00:16
208500 -- [-347.719] (-348.177) (-344.981) (-345.611) * [-344.296] (-345.072) (-345.316) (-348.286) -- 0:00:16
209000 -- (-345.226) (-348.940) [-346.406] (-347.114) * (-346.360) [-346.421] (-353.037) (-346.383) -- 0:00:16
209500 -- (-344.803) (-345.313) (-347.032) [-346.679] * (-346.022) (-350.373) (-347.774) [-345.543] -- 0:00:16
210000 -- (-349.934) (-347.440) [-345.602] (-344.017) * [-344.892] (-348.696) (-347.419) (-344.837) -- 0:00:17
Average standard deviation of split frequencies: 0.015042
210500 -- (-345.315) (-345.327) (-345.159) [-344.010] * (-345.378) (-345.715) (-345.477) [-345.251] -- 0:00:17
211000 -- (-346.639) (-349.096) (-347.841) [-344.705] * (-348.608) (-346.944) [-348.507] (-351.058) -- 0:00:17
211500 -- (-346.539) [-346.865] (-348.573) (-347.021) * (-345.465) [-347.423] (-346.316) (-344.349) -- 0:00:17
212000 -- (-344.264) (-344.719) [-344.587] (-350.670) * (-347.706) [-346.017] (-346.203) (-348.016) -- 0:00:17
212500 -- (-347.263) [-345.590] (-345.851) (-346.606) * (-348.430) [-345.168] (-344.242) (-349.875) -- 0:00:17
213000 -- (-346.089) (-344.132) [-344.916] (-346.799) * (-344.754) (-345.384) (-346.325) [-346.233] -- 0:00:17
213500 -- (-345.714) (-345.525) [-346.617] (-347.714) * (-348.849) [-346.404] (-344.263) (-346.538) -- 0:00:17
214000 -- (-349.998) (-344.367) [-347.686] (-347.030) * (-344.733) (-345.878) [-347.003] (-344.387) -- 0:00:17
214500 -- (-352.373) (-346.014) (-345.091) [-344.385] * [-346.002] (-347.681) (-346.832) (-345.969) -- 0:00:17
215000 -- (-348.280) [-346.792] (-345.812) (-349.846) * (-345.291) [-350.199] (-346.598) (-345.177) -- 0:00:17
Average standard deviation of split frequencies: 0.016196
215500 -- [-343.770] (-347.312) (-345.039) (-348.308) * [-344.646] (-348.328) (-345.871) (-344.695) -- 0:00:17
216000 -- (-345.755) (-346.985) (-346.458) [-345.443] * [-345.505] (-346.099) (-345.841) (-344.235) -- 0:00:17
216500 -- (-346.677) (-349.496) [-347.300] (-345.427) * (-345.418) (-345.202) [-345.452] (-349.736) -- 0:00:17
217000 -- [-346.312] (-346.413) (-344.871) (-348.323) * (-345.016) [-344.409] (-345.484) (-346.073) -- 0:00:16
217500 -- (-345.809) [-344.978] (-346.040) (-346.129) * (-344.380) (-348.106) [-344.806] (-348.302) -- 0:00:16
218000 -- (-350.773) (-346.534) (-347.752) [-344.083] * [-343.997] (-345.578) (-346.437) (-347.345) -- 0:00:16
218500 -- [-348.435] (-347.415) (-344.939) (-344.865) * (-344.910) (-347.774) [-347.728] (-352.415) -- 0:00:16
219000 -- (-349.899) (-345.315) [-345.092] (-350.427) * (-344.030) (-350.166) [-347.682] (-351.736) -- 0:00:16
219500 -- (-347.258) [-345.955] (-345.742) (-345.631) * [-343.935] (-345.504) (-347.706) (-346.756) -- 0:00:16
220000 -- (-347.793) (-346.760) [-345.483] (-345.065) * (-349.463) (-351.025) (-351.085) [-345.063] -- 0:00:16
Average standard deviation of split frequencies: 0.014153
220500 -- (-344.561) [-345.180] (-348.634) (-345.494) * (-344.919) [-345.146] (-347.962) (-346.216) -- 0:00:16
221000 -- (-345.728) (-345.185) (-348.850) [-345.339] * (-347.137) (-345.875) (-344.917) [-343.724] -- 0:00:16
221500 -- [-346.233] (-346.347) (-346.163) (-346.187) * [-344.108] (-346.589) (-348.967) (-344.341) -- 0:00:16
222000 -- [-346.315] (-348.887) (-346.000) (-345.385) * (-346.145) (-346.208) (-347.240) [-345.247] -- 0:00:16
222500 -- [-345.289] (-349.129) (-348.448) (-346.219) * (-345.204) (-345.501) [-345.238] (-344.284) -- 0:00:16
223000 -- (-352.722) [-346.307] (-344.235) (-344.489) * [-345.289] (-345.419) (-355.107) (-346.243) -- 0:00:16
223500 -- (-345.631) (-348.038) [-344.279] (-346.902) * (-344.648) (-345.379) (-350.111) [-344.745] -- 0:00:16
224000 -- [-343.949] (-346.053) (-346.934) (-347.300) * (-344.001) (-344.566) (-354.429) [-346.632] -- 0:00:16
224500 -- [-345.484] (-354.012) (-347.097) (-345.048) * (-344.557) [-345.132] (-346.237) (-349.532) -- 0:00:15
225000 -- (-345.353) (-348.610) (-346.539) [-348.415] * (-346.226) (-346.045) [-345.956] (-344.640) -- 0:00:15
Average standard deviation of split frequencies: 0.013790
225500 -- (-347.993) (-346.542) [-345.214] (-346.589) * (-346.667) [-345.408] (-346.344) (-345.966) -- 0:00:15
226000 -- (-346.684) [-345.812] (-344.568) (-344.649) * (-345.555) (-346.783) [-350.751] (-345.509) -- 0:00:15
226500 -- (-347.702) (-344.568) (-345.799) [-344.867] * (-348.330) (-349.176) (-347.761) [-345.958] -- 0:00:15
227000 -- (-348.119) (-349.764) [-344.073] (-345.896) * [-345.021] (-351.334) (-344.386) (-349.646) -- 0:00:16
227500 -- (-348.708) (-347.728) (-344.327) [-346.674] * [-344.775] (-346.457) (-345.157) (-347.296) -- 0:00:16
228000 -- (-349.084) [-346.418] (-348.461) (-347.084) * (-347.437) (-346.879) (-347.691) [-345.858] -- 0:00:16
228500 -- (-347.105) (-347.847) [-348.032] (-345.338) * (-344.647) [-345.147] (-345.097) (-344.148) -- 0:00:16
229000 -- (-347.023) (-345.838) [-344.620] (-345.547) * (-350.138) (-345.878) (-348.127) [-346.137] -- 0:00:16
229500 -- (-347.672) (-350.564) [-345.975] (-344.804) * (-347.984) (-348.750) [-345.705] (-351.492) -- 0:00:16
230000 -- (-344.858) [-354.216] (-345.149) (-347.183) * (-349.482) [-348.029] (-348.671) (-345.024) -- 0:00:16
Average standard deviation of split frequencies: 0.013057
230500 -- (-344.699) (-346.466) (-345.150) [-344.450] * [-344.751] (-348.002) (-346.642) (-351.130) -- 0:00:16
231000 -- [-349.836] (-347.011) (-345.564) (-346.379) * [-345.109] (-345.221) (-344.873) (-350.076) -- 0:00:16
231500 -- (-344.135) [-344.719] (-349.466) (-345.329) * (-344.805) (-349.828) [-346.852] (-346.751) -- 0:00:16
232000 -- (-347.743) [-348.926] (-345.673) (-344.038) * [-344.902] (-345.128) (-348.059) (-344.960) -- 0:00:16
232500 -- [-345.929] (-346.553) (-344.767) (-345.605) * (-347.341) [-344.795] (-350.816) (-345.107) -- 0:00:16
233000 -- (-344.536) (-348.468) (-345.411) [-344.423] * (-347.769) (-348.043) (-344.496) [-344.768] -- 0:00:16
233500 -- (-345.166) (-344.415) (-345.998) [-345.341] * (-345.468) (-346.374) (-344.501) [-345.597] -- 0:00:15
234000 -- (-345.948) [-344.751] (-344.971) (-345.936) * (-347.421) [-344.850] (-345.830) (-344.022) -- 0:00:15
234500 -- [-346.218] (-345.585) (-346.303) (-344.690) * (-348.659) [-346.465] (-346.195) (-344.334) -- 0:00:15
235000 -- (-348.854) (-344.536) (-348.099) [-345.040] * (-346.176) (-346.283) (-344.722) [-348.607] -- 0:00:15
Average standard deviation of split frequencies: 0.010209
235500 -- [-346.599] (-345.231) (-346.201) (-347.059) * (-346.641) (-345.590) [-344.899] (-346.186) -- 0:00:15
236000 -- (-347.545) (-347.773) [-347.966] (-348.597) * (-345.718) (-346.309) [-348.130] (-344.404) -- 0:00:15
236500 -- (-345.290) (-348.407) [-347.427] (-345.794) * (-348.484) (-350.070) [-344.569] (-349.799) -- 0:00:15
237000 -- (-346.867) [-346.224] (-344.667) (-344.588) * (-344.973) (-349.856) (-346.038) [-347.419] -- 0:00:15
237500 -- (-346.324) [-344.804] (-344.276) (-345.449) * (-344.589) (-349.622) [-345.772] (-348.859) -- 0:00:15
238000 -- (-346.371) [-345.727] (-348.756) (-346.254) * [-348.085] (-347.981) (-346.803) (-347.057) -- 0:00:15
238500 -- (-344.589) (-348.123) [-352.268] (-346.206) * (-344.900) [-346.567] (-346.243) (-347.455) -- 0:00:15
239000 -- (-345.008) [-346.380] (-345.288) (-345.722) * [-344.476] (-346.304) (-346.953) (-349.732) -- 0:00:15
239500 -- (-344.848) [-346.043] (-345.736) (-346.133) * (-346.462) (-346.306) [-349.162] (-349.535) -- 0:00:15
240000 -- [-346.073] (-346.709) (-344.820) (-347.636) * (-344.792) (-346.199) (-345.856) [-345.783] -- 0:00:15
Average standard deviation of split frequencies: 0.010773
240500 -- [-345.169] (-346.777) (-345.153) (-348.411) * [-345.613] (-344.402) (-346.711) (-344.866) -- 0:00:15
241000 -- (-344.630) (-353.404) [-348.248] (-344.722) * (-346.231) (-347.263) [-347.340] (-345.716) -- 0:00:15
241500 -- [-344.812] (-350.329) (-347.933) (-346.332) * (-346.453) (-346.412) (-344.232) [-344.819] -- 0:00:14
242000 -- (-344.901) (-350.184) (-345.213) [-345.599] * (-345.930) (-346.579) [-347.209] (-345.012) -- 0:00:14
242500 -- (-354.282) (-347.546) (-344.012) [-345.509] * [-345.785] (-345.941) (-346.186) (-345.086) -- 0:00:14
243000 -- (-346.936) (-349.493) (-346.858) [-347.027] * (-346.580) (-346.566) (-346.821) [-344.877] -- 0:00:14
243500 -- (-346.331) (-352.912) [-346.975] (-345.643) * (-345.256) [-345.275] (-344.497) (-346.558) -- 0:00:14
244000 -- (-347.677) (-345.122) (-346.437) [-346.111] * [-346.041] (-344.977) (-345.329) (-347.774) -- 0:00:14
244500 -- (-346.513) (-347.167) [-346.518] (-348.776) * (-349.349) [-344.478] (-344.255) (-347.861) -- 0:00:15
245000 -- (-350.900) (-345.407) [-345.772] (-349.506) * [-345.598] (-347.070) (-344.643) (-350.537) -- 0:00:15
Average standard deviation of split frequencies: 0.011296
245500 -- (-345.575) (-344.543) (-346.911) [-347.128] * (-345.445) [-345.943] (-346.053) (-348.546) -- 0:00:15
246000 -- (-345.788) [-346.067] (-344.868) (-345.102) * (-346.104) (-344.760) [-345.512] (-344.828) -- 0:00:15
246500 -- (-344.527) [-346.937] (-347.552) (-349.595) * (-346.679) [-344.376] (-348.568) (-347.054) -- 0:00:15
247000 -- (-346.939) (-345.558) [-346.687] (-344.292) * [-345.072] (-344.222) (-354.827) (-344.287) -- 0:00:15
247500 -- [-349.232] (-348.323) (-346.630) (-346.635) * [-348.599] (-345.969) (-347.780) (-345.717) -- 0:00:15
248000 -- (-349.664) (-343.937) (-346.707) [-345.301] * (-347.384) (-348.035) (-346.968) [-346.247] -- 0:00:15
248500 -- [-349.946] (-345.558) (-344.934) (-344.896) * (-345.111) (-346.070) [-346.765] (-345.545) -- 0:00:15
249000 -- (-347.672) [-349.840] (-347.014) (-345.070) * [-344.601] (-349.763) (-344.707) (-345.742) -- 0:00:15
249500 -- (-345.123) (-345.440) [-345.986] (-346.713) * (-346.356) (-345.709) [-348.067] (-345.357) -- 0:00:15
250000 -- [-344.236] (-344.170) (-347.708) (-346.167) * (-346.546) (-346.715) (-345.845) [-345.576] -- 0:00:15
Average standard deviation of split frequencies: 0.012273
250500 -- (-346.076) (-347.227) (-345.530) [-346.086] * (-347.161) (-349.053) [-345.031] (-346.682) -- 0:00:14
251000 -- (-344.529) [-344.873] (-344.995) (-347.392) * (-345.709) (-351.440) (-344.312) [-348.600] -- 0:00:14
251500 -- (-351.014) (-346.499) [-347.594] (-346.255) * (-347.353) (-350.747) [-344.792] (-349.967) -- 0:00:14
252000 -- (-345.508) [-354.682] (-345.620) (-345.262) * (-352.684) (-351.458) [-349.364] (-346.111) -- 0:00:14
252500 -- (-346.288) (-346.486) (-348.671) [-344.971] * (-346.526) (-346.186) [-344.839] (-348.101) -- 0:00:14
253000 -- [-346.194] (-346.963) (-347.432) (-345.950) * (-344.739) (-350.025) [-344.732] (-345.942) -- 0:00:14
253500 -- (-346.208) (-347.590) (-344.972) [-344.731] * [-348.498] (-347.403) (-343.905) (-345.628) -- 0:00:14
254000 -- (-346.446) (-348.556) [-345.006] (-348.881) * [-344.110] (-346.703) (-346.713) (-347.927) -- 0:00:14
254500 -- (-347.032) (-344.913) [-344.915] (-349.404) * (-347.306) (-350.802) [-345.595] (-345.058) -- 0:00:14
255000 -- [-345.125] (-344.896) (-348.322) (-349.561) * (-347.141) (-348.674) [-343.976] (-344.643) -- 0:00:14
Average standard deviation of split frequencies: 0.011590
255500 -- (-346.603) (-346.631) (-344.022) [-348.581] * (-345.873) [-344.422] (-345.345) (-346.409) -- 0:00:14
256000 -- (-346.244) (-347.423) (-347.986) [-345.459] * [-346.283] (-345.744) (-345.400) (-346.265) -- 0:00:14
256500 -- (-346.659) (-349.420) (-346.024) [-345.685] * (-349.538) [-346.013] (-352.510) (-346.850) -- 0:00:14
257000 -- (-346.883) [-345.675] (-344.238) (-347.173) * (-350.571) (-350.212) [-344.404] (-346.212) -- 0:00:14
257500 -- (-345.780) (-345.074) [-346.117] (-350.950) * (-347.355) [-351.963] (-347.386) (-346.777) -- 0:00:14
258000 -- (-346.041) [-345.614] (-347.797) (-347.694) * (-350.801) (-344.618) (-346.298) [-346.368] -- 0:00:14
258500 -- [-345.059] (-345.891) (-345.642) (-345.067) * (-345.254) [-344.681] (-344.870) (-347.754) -- 0:00:14
259000 -- (-343.895) (-345.951) (-345.564) [-347.038] * [-344.524] (-346.377) (-347.130) (-346.828) -- 0:00:13
259500 -- (-344.887) (-347.561) [-344.327] (-352.406) * (-346.470) (-347.199) [-346.889] (-350.032) -- 0:00:13
260000 -- (-346.227) (-345.048) [-345.520] (-348.060) * [-347.376] (-345.558) (-345.499) (-347.997) -- 0:00:13
Average standard deviation of split frequencies: 0.011064
260500 -- (-346.081) [-349.087] (-347.275) (-346.571) * (-347.217) (-345.460) (-346.086) [-346.753] -- 0:00:13
261000 -- (-348.479) [-346.429] (-347.160) (-345.916) * [-344.772] (-344.390) (-346.746) (-347.383) -- 0:00:13
261500 -- (-344.634) [-345.729] (-349.583) (-349.415) * [-347.686] (-344.865) (-345.859) (-348.332) -- 0:00:14
262000 -- (-346.980) [-344.366] (-347.995) (-349.404) * (-347.441) [-344.993] (-347.903) (-348.439) -- 0:00:14
262500 -- (-343.916) (-347.820) [-345.793] (-346.113) * [-344.070] (-344.358) (-345.425) (-352.464) -- 0:00:14
263000 -- [-344.438] (-346.374) (-346.609) (-345.333) * (-348.707) (-347.709) [-348.991] (-349.208) -- 0:00:14
263500 -- (-347.077) (-348.289) [-346.512] (-344.503) * (-350.324) [-345.175] (-350.766) (-352.069) -- 0:00:14
264000 -- (-346.699) (-345.148) (-346.396) [-345.669] * (-345.458) (-346.097) (-347.805) [-345.549] -- 0:00:14
264500 -- (-346.846) [-343.940] (-346.817) (-348.852) * (-345.086) (-346.938) (-346.154) [-344.532] -- 0:00:14
265000 -- (-347.750) [-343.800] (-346.123) (-345.033) * (-346.514) (-344.104) [-345.991] (-345.618) -- 0:00:14
Average standard deviation of split frequencies: 0.012405
265500 -- (-345.735) (-343.869) (-346.972) [-345.291] * (-347.470) [-345.347] (-347.306) (-347.168) -- 0:00:14
266000 -- (-346.466) (-344.407) [-346.494] (-346.729) * (-344.268) (-345.847) (-344.410) [-343.740] -- 0:00:14
266500 -- (-345.906) [-345.078] (-345.232) (-346.235) * [-344.153] (-345.370) (-344.814) (-346.222) -- 0:00:14
267000 -- (-346.839) (-347.773) [-348.689] (-347.964) * (-348.699) [-345.348] (-345.638) (-346.170) -- 0:00:13
267500 -- [-343.980] (-347.977) (-347.570) (-347.636) * (-345.735) [-346.309] (-347.176) (-346.066) -- 0:00:13
268000 -- (-346.779) (-346.081) [-345.092] (-346.234) * (-345.169) (-350.888) (-345.274) [-345.027] -- 0:00:13
268500 -- (-344.612) [-345.212] (-352.432) (-343.959) * (-346.387) (-348.057) (-345.981) [-344.571] -- 0:00:13
269000 -- (-344.430) (-344.325) [-347.997] (-345.317) * (-350.247) (-346.021) [-345.747] (-345.721) -- 0:00:13
269500 -- (-346.142) (-346.335) (-345.712) [-354.815] * (-346.744) (-344.139) (-344.086) [-344.243] -- 0:00:13
270000 -- [-346.388] (-344.363) (-347.617) (-347.361) * (-344.273) [-346.856] (-347.887) (-344.162) -- 0:00:13
Average standard deviation of split frequencies: 0.012845
270500 -- (-347.010) [-344.332] (-344.809) (-347.842) * (-346.464) (-345.300) (-344.993) [-344.537] -- 0:00:13
271000 -- (-344.687) (-344.576) [-346.363] (-345.061) * (-344.067) (-343.636) [-344.806] (-344.878) -- 0:00:13
271500 -- (-344.582) (-345.849) (-348.189) [-347.119] * [-345.593] (-344.172) (-348.365) (-344.760) -- 0:00:13
272000 -- [-344.450] (-345.488) (-344.112) (-348.652) * (-347.038) [-349.631] (-348.270) (-346.177) -- 0:00:13
272500 -- [-346.141] (-345.601) (-347.353) (-348.551) * [-346.546] (-345.160) (-346.361) (-343.978) -- 0:00:13
273000 -- (-345.334) (-347.840) (-347.595) [-344.717] * (-347.194) [-347.480] (-346.376) (-344.913) -- 0:00:13
273500 -- (-348.958) (-345.438) (-344.541) [-343.914] * (-349.392) (-346.551) (-346.662) [-344.222] -- 0:00:13
274000 -- (-351.660) (-345.204) [-346.506] (-350.096) * (-346.038) (-348.226) [-345.445] (-344.495) -- 0:00:13
274500 -- (-346.222) (-347.777) [-347.790] (-348.969) * (-345.289) (-348.102) (-346.082) [-348.170] -- 0:00:13
275000 -- (-344.150) (-346.263) (-345.823) [-345.764] * [-346.226] (-349.184) (-345.193) (-345.222) -- 0:00:13
Average standard deviation of split frequencies: 0.011422
275500 -- [-348.936] (-345.021) (-347.982) (-345.887) * (-347.533) [-344.909] (-347.938) (-345.349) -- 0:00:13
276000 -- (-348.351) (-347.035) (-346.116) [-345.050] * [-348.409] (-344.160) (-346.046) (-347.420) -- 0:00:12
276500 -- [-345.755] (-346.480) (-345.685) (-347.106) * [-349.169] (-347.972) (-345.582) (-346.031) -- 0:00:12
277000 -- [-346.290] (-346.828) (-345.335) (-347.926) * (-348.620) [-346.351] (-345.544) (-345.465) -- 0:00:12
277500 -- [-343.840] (-346.491) (-347.606) (-346.974) * (-346.637) (-345.716) (-346.868) [-347.409] -- 0:00:12
278000 -- (-350.471) (-352.477) (-346.126) [-348.386] * (-347.928) (-344.318) (-350.931) [-346.385] -- 0:00:12
278500 -- [-348.733] (-347.958) (-345.281) (-346.606) * [-350.159] (-344.761) (-346.947) (-344.206) -- 0:00:12
279000 -- (-348.540) (-345.705) [-346.980] (-346.926) * (-347.991) (-345.224) (-346.158) [-344.714] -- 0:00:13
279500 -- (-344.725) [-344.045] (-346.762) (-345.234) * [-346.434] (-344.300) (-344.725) (-346.963) -- 0:00:13
280000 -- (-344.990) (-343.977) (-344.734) [-345.863] * (-347.913) (-345.586) [-346.562] (-347.743) -- 0:00:13
Average standard deviation of split frequencies: 0.012251
280500 -- (-346.157) (-344.722) [-346.215] (-348.214) * (-345.982) [-346.730] (-349.240) (-344.873) -- 0:00:13
281000 -- (-346.238) [-344.297] (-345.744) (-349.366) * (-344.900) (-343.860) [-347.332] (-345.004) -- 0:00:13
281500 -- [-345.076] (-348.455) (-344.898) (-347.866) * [-344.749] (-344.062) (-345.671) (-345.663) -- 0:00:13
282000 -- (-350.321) (-347.422) (-345.549) [-344.875] * (-346.553) (-345.156) (-347.761) [-345.724] -- 0:00:13
282500 -- (-349.242) (-345.045) [-347.699] (-345.755) * (-346.995) (-345.809) (-348.007) [-345.621] -- 0:00:13
283000 -- (-351.242) (-347.781) [-344.472] (-347.443) * (-350.699) (-347.803) [-346.258] (-345.642) -- 0:00:13
283500 -- (-347.259) (-348.954) (-344.879) [-344.124] * (-344.761) (-346.895) (-344.325) [-345.249] -- 0:00:12
284000 -- (-348.757) (-349.212) (-345.444) [-344.828] * (-346.858) (-346.251) [-344.304] (-347.945) -- 0:00:12
284500 -- [-345.709] (-345.199) (-344.841) (-345.664) * [-346.164] (-344.820) (-344.145) (-344.977) -- 0:00:12
285000 -- (-345.032) [-346.599] (-348.373) (-345.868) * (-344.866) (-349.577) [-348.718] (-344.430) -- 0:00:12
Average standard deviation of split frequencies: 0.011629
285500 -- [-347.214] (-346.497) (-349.478) (-344.884) * (-346.226) (-344.580) (-347.213) [-345.027] -- 0:00:12
286000 -- [-344.921] (-345.882) (-344.008) (-346.219) * (-354.021) (-347.087) [-344.257] (-344.622) -- 0:00:12
286500 -- (-345.123) (-344.472) [-348.902] (-346.759) * (-348.212) [-345.235] (-345.413) (-344.723) -- 0:00:12
287000 -- (-347.158) (-344.401) (-354.398) [-346.486] * [-346.714] (-349.740) (-345.150) (-345.348) -- 0:00:12
287500 -- (-346.688) (-344.290) [-346.398] (-346.240) * (-344.111) (-347.356) [-344.921] (-344.843) -- 0:00:12
288000 -- [-346.300] (-346.569) (-347.331) (-350.423) * (-351.236) (-346.103) (-345.974) [-344.199] -- 0:00:12
288500 -- (-348.487) (-345.984) (-345.678) [-345.724] * [-347.709] (-344.548) (-345.172) (-346.518) -- 0:00:12
289000 -- (-346.921) (-344.129) [-348.873] (-345.208) * (-346.570) (-348.140) (-345.307) [-346.514] -- 0:00:12
289500 -- (-347.298) (-344.409) (-347.973) [-345.909] * (-346.020) (-348.183) (-346.479) [-344.715] -- 0:00:12
290000 -- [-347.575] (-345.948) (-347.607) (-346.557) * [-345.599] (-345.754) (-346.935) (-345.717) -- 0:00:12
Average standard deviation of split frequencies: 0.011263
290500 -- (-345.351) [-344.849] (-345.639) (-344.996) * (-346.448) (-345.526) [-344.397] (-347.026) -- 0:00:12
291000 -- (-344.531) (-347.151) [-347.611] (-346.340) * (-349.135) [-346.222] (-346.863) (-347.678) -- 0:00:12
291500 -- (-348.244) (-344.439) [-344.334] (-348.526) * (-350.170) (-346.687) (-350.198) [-347.129] -- 0:00:12
292000 -- (-346.672) (-345.195) (-347.960) [-346.208] * (-349.101) (-350.118) [-344.972] (-350.204) -- 0:00:12
292500 -- (-355.825) (-350.381) (-346.332) [-347.095] * (-345.094) (-345.476) (-345.457) [-345.760] -- 0:00:12
293000 -- (-346.646) (-347.687) [-344.772] (-347.050) * [-345.474] (-343.965) (-348.931) (-345.429) -- 0:00:12
293500 -- [-345.888] (-344.986) (-345.598) (-346.106) * (-344.993) (-345.953) (-346.738) [-344.634] -- 0:00:11
294000 -- [-346.316] (-347.167) (-345.831) (-347.514) * [-344.822] (-345.823) (-344.824) (-346.401) -- 0:00:11
294500 -- [-345.157] (-345.713) (-349.796) (-349.253) * (-347.155) (-345.682) [-345.659] (-345.260) -- 0:00:11
295000 -- (-345.290) (-346.250) [-346.334] (-347.067) * [-345.801] (-348.094) (-345.015) (-347.179) -- 0:00:11
Average standard deviation of split frequencies: 0.010794
295500 -- [-346.299] (-344.020) (-345.456) (-344.220) * [-346.359] (-344.282) (-347.792) (-344.103) -- 0:00:11
296000 -- (-343.778) [-346.073] (-348.380) (-345.565) * (-351.032) [-344.919] (-346.837) (-344.847) -- 0:00:12
296500 -- [-348.741] (-345.450) (-347.649) (-345.292) * (-345.266) [-349.569] (-346.094) (-347.711) -- 0:00:12
297000 -- (-347.725) (-345.207) (-347.756) [-345.752] * (-345.956) (-348.239) [-346.944] (-347.028) -- 0:00:12
297500 -- (-345.715) (-344.912) (-345.729) [-346.512] * (-348.457) (-345.582) [-344.919] (-345.801) -- 0:00:12
298000 -- (-347.074) (-346.304) (-347.227) [-347.529] * (-345.325) (-344.976) (-344.856) [-347.372] -- 0:00:12
298500 -- (-344.578) [-344.805] (-344.651) (-346.023) * [-344.138] (-344.947) (-345.716) (-346.927) -- 0:00:12
299000 -- (-346.265) (-347.648) (-347.096) [-346.498] * (-350.236) [-344.861] (-347.426) (-347.547) -- 0:00:12
299500 -- [-345.471] (-348.243) (-348.181) (-346.592) * [-345.459] (-344.856) (-345.293) (-348.000) -- 0:00:12
300000 -- (-347.919) (-349.169) (-345.052) [-347.119] * (-346.005) (-344.262) (-344.503) [-346.530] -- 0:00:12
Average standard deviation of split frequencies: 0.012266
300500 -- (-350.127) (-345.265) [-346.079] (-344.413) * (-346.379) [-343.794] (-346.850) (-347.274) -- 0:00:11
301000 -- (-346.458) (-344.857) (-345.576) [-347.870] * (-348.092) (-346.373) (-346.410) [-347.529] -- 0:00:11
301500 -- (-344.848) [-344.496] (-346.295) (-346.012) * (-345.947) (-348.113) [-343.975] (-349.040) -- 0:00:11
302000 -- (-344.771) [-343.901] (-344.308) (-344.813) * (-345.104) (-345.305) (-344.455) [-344.935] -- 0:00:11
302500 -- [-345.987] (-349.270) (-346.729) (-344.116) * [-346.178] (-348.549) (-345.169) (-344.288) -- 0:00:11
303000 -- [-345.819] (-350.154) (-347.489) (-344.205) * (-345.251) [-344.084] (-350.285) (-344.940) -- 0:00:11
303500 -- [-347.066] (-345.142) (-344.877) (-344.388) * (-347.318) [-344.580] (-344.688) (-347.544) -- 0:00:11
304000 -- [-346.085] (-344.875) (-348.684) (-345.249) * (-349.744) (-346.972) (-344.392) [-348.587] -- 0:00:11
304500 -- (-347.975) [-346.203] (-346.678) (-349.846) * (-346.644) (-352.560) (-346.003) [-348.687] -- 0:00:11
305000 -- (-347.884) (-345.254) (-346.468) [-344.928] * (-345.737) (-347.142) [-344.243] (-348.122) -- 0:00:11
Average standard deviation of split frequencies: 0.013522
305500 -- (-348.165) (-346.189) (-344.995) [-344.337] * (-347.847) [-345.788] (-347.348) (-344.905) -- 0:00:11
306000 -- [-346.052] (-348.192) (-349.219) (-345.588) * (-354.907) (-349.526) (-347.466) [-347.557] -- 0:00:11
306500 -- (-349.244) [-349.059] (-346.797) (-346.779) * [-346.997] (-345.153) (-344.974) (-345.183) -- 0:00:11
307000 -- (-346.979) [-345.001] (-346.434) (-346.761) * (-351.887) (-344.908) (-345.822) [-347.445] -- 0:00:11
307500 -- (-346.921) [-345.685] (-347.296) (-346.852) * (-346.978) (-345.932) (-345.714) [-344.794] -- 0:00:11
308000 -- (-345.831) (-344.167) [-344.345] (-345.188) * (-344.469) [-345.612] (-347.737) (-346.522) -- 0:00:11
308500 -- (-346.145) (-347.191) [-346.066] (-350.710) * (-344.691) [-348.211] (-346.004) (-349.413) -- 0:00:11
309000 -- [-348.257] (-344.405) (-346.873) (-344.811) * (-345.725) (-344.623) (-345.627) [-347.804] -- 0:00:11
309500 -- [-350.233] (-346.150) (-346.789) (-348.591) * (-346.221) (-345.881) [-345.665] (-345.273) -- 0:00:11
310000 -- (-348.035) [-345.773] (-347.562) (-348.262) * (-345.819) (-346.393) (-345.219) [-346.425] -- 0:00:11
Average standard deviation of split frequencies: 0.015258
310500 -- (-345.536) [-346.020] (-346.992) (-345.953) * (-348.724) (-346.656) (-345.139) [-345.898] -- 0:00:10
311000 -- (-344.414) [-348.558] (-349.265) (-344.913) * (-345.900) (-346.127) (-344.470) [-346.326] -- 0:00:10
311500 -- (-344.753) (-346.786) (-348.377) [-345.754] * (-348.331) (-349.846) [-344.235] (-344.134) -- 0:00:10
312000 -- [-345.729] (-344.712) (-345.808) (-344.466) * (-355.491) (-351.479) (-347.866) [-350.364] -- 0:00:10
312500 -- (-344.188) (-345.094) (-345.363) [-344.612] * (-350.335) (-346.699) [-345.171] (-348.633) -- 0:00:10
313000 -- (-344.065) (-345.907) (-350.127) [-344.203] * (-352.014) (-347.781) (-345.396) [-349.654] -- 0:00:11
313500 -- (-344.274) (-345.552) (-350.550) [-345.045] * (-347.725) (-347.478) [-345.099] (-344.264) -- 0:00:11
314000 -- [-343.708] (-347.327) (-347.286) (-345.253) * (-348.010) (-345.185) [-347.558] (-345.186) -- 0:00:11
314500 -- [-347.398] (-345.140) (-346.914) (-346.050) * (-346.571) (-347.685) [-347.132] (-346.549) -- 0:00:11
315000 -- (-345.354) (-345.441) (-347.200) [-345.633] * (-345.370) [-351.005] (-348.046) (-347.775) -- 0:00:11
Average standard deviation of split frequencies: 0.015093
315500 -- (-348.425) (-344.486) (-346.493) [-344.842] * (-346.941) (-350.099) [-345.606] (-345.134) -- 0:00:11
316000 -- (-346.614) (-347.882) [-344.460] (-345.730) * (-345.091) (-349.789) [-344.714] (-346.756) -- 0:00:11
316500 -- (-346.962) (-344.954) (-347.735) [-345.190] * (-346.630) [-346.461] (-351.198) (-346.787) -- 0:00:11
317000 -- [-345.354] (-347.342) (-346.103) (-347.419) * (-349.080) (-346.277) (-348.255) [-345.042] -- 0:00:10
317500 -- (-346.075) (-346.918) (-348.671) [-345.685] * (-348.870) (-345.471) (-345.937) [-345.582] -- 0:00:10
318000 -- (-344.428) [-344.355] (-345.353) (-344.935) * (-343.777) (-346.912) (-349.728) [-346.680] -- 0:00:10
318500 -- (-347.850) (-347.860) (-346.837) [-347.400] * (-346.452) (-345.756) (-346.355) [-345.021] -- 0:00:10
319000 -- (-347.058) [-345.558] (-345.960) (-346.015) * [-346.095] (-345.801) (-345.509) (-348.543) -- 0:00:10
319500 -- [-345.741] (-344.772) (-346.993) (-346.475) * (-345.895) [-345.049] (-346.625) (-348.503) -- 0:00:10
320000 -- (-344.198) [-345.830] (-354.559) (-344.590) * (-346.660) [-344.349] (-345.471) (-345.424) -- 0:00:10
Average standard deviation of split frequencies: 0.015109
320500 -- (-344.380) (-345.886) (-346.681) [-345.934] * (-350.647) (-346.022) (-344.249) [-345.315] -- 0:00:10
321000 -- (-345.918) [-344.190] (-345.885) (-349.046) * [-348.127] (-347.122) (-345.846) (-349.370) -- 0:00:10
321500 -- [-344.580] (-345.343) (-348.265) (-349.474) * (-346.326) (-346.688) [-343.994] (-347.141) -- 0:00:10
322000 -- (-345.514) (-343.862) [-344.178] (-346.672) * (-348.161) (-345.299) [-344.703] (-348.893) -- 0:00:10
322500 -- (-354.682) (-348.931) [-344.520] (-346.913) * (-346.002) [-346.171] (-344.244) (-346.350) -- 0:00:10
323000 -- (-347.546) (-345.174) [-345.670] (-345.082) * (-345.130) (-349.732) (-349.187) [-345.257] -- 0:00:10
323500 -- [-346.231] (-345.031) (-346.390) (-346.823) * [-345.280] (-349.146) (-346.274) (-347.827) -- 0:00:10
324000 -- (-346.873) (-346.645) (-345.767) [-344.978] * [-344.908] (-349.630) (-347.861) (-348.765) -- 0:00:10
324500 -- (-348.024) [-344.001] (-345.195) (-345.450) * [-348.336] (-345.038) (-346.363) (-347.183) -- 0:00:10
325000 -- (-348.762) (-343.953) [-347.874] (-343.892) * (-345.451) [-348.116] (-345.393) (-345.165) -- 0:00:10
Average standard deviation of split frequencies: 0.015424
325500 -- (-346.060) [-343.755] (-345.317) (-345.364) * (-346.683) (-349.086) (-346.870) [-347.834] -- 0:00:10
326000 -- (-347.631) (-345.873) [-344.957] (-346.103) * (-345.998) (-348.724) [-344.448] (-348.312) -- 0:00:10
326500 -- (-347.208) (-345.294) [-346.565] (-350.962) * (-347.139) [-344.691] (-344.372) (-346.775) -- 0:00:10
327000 -- (-346.689) [-348.588] (-345.711) (-344.635) * (-347.031) [-345.042] (-346.507) (-345.906) -- 0:00:10
327500 -- (-353.933) (-345.529) (-346.390) [-345.272] * (-345.120) (-344.567) (-344.410) [-346.170] -- 0:00:10
328000 -- (-349.008) (-346.025) [-346.974] (-348.885) * (-345.226) [-345.438] (-344.834) (-346.534) -- 0:00:09
328500 -- (-350.303) (-345.367) [-346.831] (-344.632) * (-344.441) (-345.051) [-347.737] (-347.526) -- 0:00:09
329000 -- [-349.635] (-348.052) (-346.758) (-346.882) * (-349.353) (-345.946) (-348.263) [-351.359] -- 0:00:09
329500 -- (-345.559) [-345.201] (-345.099) (-346.759) * (-345.018) [-347.593] (-350.001) (-348.637) -- 0:00:09
330000 -- [-346.346] (-344.319) (-345.599) (-348.323) * (-344.347) [-346.336] (-346.111) (-351.704) -- 0:00:09
Average standard deviation of split frequencies: 0.015682
330500 -- (-350.447) (-348.945) (-344.778) [-344.595] * [-343.996] (-350.792) (-346.421) (-346.981) -- 0:00:10
331000 -- [-344.440] (-347.794) (-348.579) (-346.432) * [-346.629] (-347.093) (-344.863) (-349.852) -- 0:00:10
331500 -- (-350.008) (-345.605) (-344.604) [-346.238] * [-345.558] (-346.322) (-348.318) (-345.602) -- 0:00:10
332000 -- [-344.807] (-345.424) (-346.246) (-345.462) * (-345.948) (-344.183) (-346.080) [-344.030] -- 0:00:10
332500 -- (-343.996) (-345.904) (-346.907) [-346.501] * (-347.797) [-344.650] (-346.732) (-345.257) -- 0:00:10
333000 -- [-344.046] (-345.990) (-350.218) (-345.730) * (-348.129) (-345.863) (-344.522) [-347.573] -- 0:00:10
333500 -- (-346.531) [-346.927] (-349.232) (-344.369) * [-344.850] (-346.118) (-344.419) (-346.307) -- 0:00:09
334000 -- (-346.592) (-347.627) [-345.047] (-347.872) * (-346.266) [-348.651] (-348.813) (-344.520) -- 0:00:09
334500 -- (-344.365) [-348.263] (-344.855) (-346.210) * [-346.240] (-345.890) (-347.425) (-344.946) -- 0:00:09
335000 -- (-344.376) (-344.724) (-348.267) [-345.198] * (-345.106) (-346.284) [-346.133] (-344.317) -- 0:00:09
Average standard deviation of split frequencies: 0.015043
335500 -- (-344.094) (-343.710) [-344.612] (-345.837) * (-344.517) (-346.129) [-344.292] (-346.361) -- 0:00:09
336000 -- [-346.706] (-347.753) (-344.255) (-348.473) * (-346.758) (-349.014) [-346.470] (-345.655) -- 0:00:09
336500 -- (-344.744) (-347.172) (-346.490) [-347.185] * (-345.571) (-348.984) [-346.262] (-345.300) -- 0:00:09
337000 -- (-344.333) [-346.834] (-347.246) (-346.413) * (-346.684) [-345.986] (-345.240) (-347.420) -- 0:00:09
337500 -- (-345.575) [-344.159] (-349.260) (-346.285) * (-347.807) [-346.103] (-344.945) (-347.140) -- 0:00:09
338000 -- (-344.237) [-344.184] (-344.228) (-348.269) * (-343.902) [-344.315] (-344.758) (-350.064) -- 0:00:09
338500 -- [-344.225] (-345.633) (-344.719) (-349.536) * [-345.687] (-345.323) (-344.990) (-346.634) -- 0:00:09
339000 -- (-345.058) (-346.349) [-346.358] (-344.897) * (-343.717) [-348.811] (-344.634) (-345.625) -- 0:00:09
339500 -- [-346.307] (-345.476) (-344.958) (-347.704) * (-347.226) (-346.649) (-346.493) [-344.322] -- 0:00:09
340000 -- (-345.107) [-347.535] (-345.851) (-348.798) * (-346.461) [-346.152] (-345.535) (-345.699) -- 0:00:09
Average standard deviation of split frequencies: 0.014453
340500 -- [-345.013] (-346.834) (-344.794) (-350.453) * [-345.911] (-347.442) (-352.775) (-351.118) -- 0:00:09
341000 -- (-345.438) (-346.405) (-344.241) [-344.520] * (-346.211) (-349.673) [-346.276] (-349.855) -- 0:00:09
341500 -- (-346.154) (-345.172) [-345.452] (-344.462) * (-350.175) [-348.295] (-343.949) (-345.563) -- 0:00:09
342000 -- (-345.474) (-347.563) [-345.509] (-345.422) * (-348.493) (-344.507) (-344.909) [-346.813] -- 0:00:09
342500 -- [-344.423] (-346.221) (-345.216) (-346.710) * (-347.335) [-345.308] (-345.108) (-349.105) -- 0:00:09
343000 -- (-345.148) [-347.109] (-347.742) (-344.932) * [-344.658] (-345.866) (-345.684) (-346.301) -- 0:00:09
343500 -- (-345.888) [-344.224] (-346.203) (-346.319) * (-344.826) [-344.237] (-346.760) (-349.422) -- 0:00:09
344000 -- (-345.327) (-345.983) [-347.001] (-347.633) * (-348.667) [-347.604] (-345.513) (-343.868) -- 0:00:09
344500 -- (-347.019) (-347.148) [-345.382] (-348.843) * (-345.968) (-346.983) (-347.568) [-344.794] -- 0:00:09
345000 -- [-344.721] (-348.225) (-344.735) (-347.377) * (-345.153) (-347.593) [-344.862] (-345.162) -- 0:00:08
Average standard deviation of split frequencies: 0.013481
345500 -- (-345.418) [-347.095] (-346.587) (-348.306) * [-344.978] (-350.366) (-345.240) (-344.011) -- 0:00:08
346000 -- (-344.410) [-344.990] (-346.876) (-348.466) * [-344.112] (-346.294) (-345.626) (-344.578) -- 0:00:08
346500 -- [-348.351] (-346.060) (-347.702) (-346.734) * (-347.109) (-346.824) (-347.282) [-345.297] -- 0:00:08
347000 -- (-345.477) [-346.288] (-345.052) (-346.397) * (-344.730) (-345.035) (-346.773) [-345.417] -- 0:00:08
347500 -- (-345.053) (-344.803) [-347.408] (-344.378) * (-344.591) (-351.975) (-344.977) [-345.662] -- 0:00:09
348000 -- (-346.150) (-345.101) (-344.410) [-345.052] * [-345.749] (-346.158) (-346.074) (-350.074) -- 0:00:09
348500 -- [-345.792] (-345.269) (-347.419) (-344.538) * (-345.992) (-345.613) (-347.423) [-346.031] -- 0:00:09
349000 -- (-347.110) (-350.070) [-345.771] (-345.722) * (-347.874) (-345.748) [-348.608] (-347.857) -- 0:00:09
349500 -- [-345.973] (-344.901) (-345.340) (-347.882) * (-346.432) (-350.564) [-346.289] (-349.350) -- 0:00:09
350000 -- [-349.290] (-346.464) (-345.515) (-345.849) * (-346.824) (-345.972) [-348.414] (-346.814) -- 0:00:09
Average standard deviation of split frequencies: 0.013797
350500 -- (-347.967) [-346.108] (-347.854) (-345.206) * (-349.593) [-345.750] (-348.428) (-349.725) -- 0:00:08
351000 -- [-346.198] (-349.388) (-346.727) (-346.208) * (-347.779) [-345.941] (-349.362) (-344.764) -- 0:00:08
351500 -- [-348.590] (-346.973) (-344.423) (-345.358) * (-347.332) (-345.377) (-346.102) [-345.816] -- 0:00:08
352000 -- [-348.698] (-349.801) (-345.379) (-346.316) * (-344.088) (-344.681) (-345.746) [-346.229] -- 0:00:08
352500 -- (-347.012) [-345.579] (-346.067) (-344.872) * (-344.637) [-348.037] (-347.349) (-344.454) -- 0:00:08
353000 -- (-349.698) [-344.510] (-344.928) (-345.711) * (-345.573) (-345.900) (-344.500) [-346.227] -- 0:00:08
353500 -- (-348.124) [-348.127] (-345.369) (-344.178) * [-347.928] (-344.394) (-344.128) (-346.977) -- 0:00:08
354000 -- [-345.043] (-347.023) (-347.142) (-344.537) * (-344.895) (-346.031) (-346.832) [-347.383] -- 0:00:08
354500 -- (-346.245) [-344.580] (-346.636) (-346.635) * (-348.689) (-345.691) [-347.650] (-344.609) -- 0:00:08
355000 -- (-346.385) [-345.605] (-344.872) (-346.566) * [-346.352] (-345.663) (-345.350) (-344.765) -- 0:00:08
Average standard deviation of split frequencies: 0.014124
355500 -- (-346.273) (-346.182) (-345.180) [-346.204] * (-345.692) (-346.910) [-347.450] (-345.777) -- 0:00:08
356000 -- [-346.075] (-345.204) (-346.792) (-346.885) * (-347.804) (-350.807) [-347.155] (-349.645) -- 0:00:08
356500 -- (-348.726) (-349.365) [-345.291] (-346.351) * [-345.065] (-349.279) (-344.787) (-345.725) -- 0:00:08
357000 -- (-346.628) (-346.487) (-345.420) [-346.031] * [-345.123] (-348.182) (-346.947) (-347.649) -- 0:00:08
357500 -- (-344.564) (-347.885) (-346.010) [-346.274] * (-347.153) [-343.961] (-345.350) (-345.588) -- 0:00:08
358000 -- (-345.855) (-347.040) [-347.750] (-349.098) * (-348.243) (-345.936) (-347.543) [-345.745] -- 0:00:08
358500 -- (-345.887) (-349.146) (-346.426) [-345.060] * [-344.559] (-346.420) (-344.689) (-351.114) -- 0:00:08
359000 -- (-345.149) (-347.826) (-349.582) [-344.988] * (-344.951) (-345.397) [-345.989] (-346.681) -- 0:00:08
359500 -- (-347.860) (-346.432) (-350.065) [-349.056] * [-346.422] (-345.125) (-351.015) (-348.845) -- 0:00:08
360000 -- [-344.904] (-348.453) (-346.102) (-345.827) * (-346.530) (-346.281) [-345.390] (-351.068) -- 0:00:08
Average standard deviation of split frequencies: 0.013942
360500 -- (-346.317) (-345.752) (-347.692) [-345.132] * (-345.162) (-347.012) [-346.714] (-347.713) -- 0:00:08
361000 -- (-349.052) [-344.779] (-348.105) (-348.662) * (-344.173) (-348.083) [-344.208] (-345.426) -- 0:00:08
361500 -- [-347.937] (-346.048) (-345.259) (-345.101) * (-345.694) (-349.316) [-345.426] (-343.961) -- 0:00:08
362000 -- (-345.565) [-344.772] (-347.547) (-346.985) * (-344.170) (-347.911) [-345.440] (-347.120) -- 0:00:08
362500 -- (-346.363) (-345.813) (-345.999) [-345.836] * (-344.201) (-347.034) (-347.727) [-346.166] -- 0:00:07
363000 -- (-349.443) (-346.420) (-346.575) [-345.245] * (-354.101) (-348.816) (-348.496) [-345.587] -- 0:00:07
363500 -- (-344.361) [-347.489] (-346.278) (-349.499) * [-345.427] (-344.685) (-346.071) (-344.802) -- 0:00:07
364000 -- (-344.425) (-344.598) [-346.898] (-345.250) * (-345.216) [-345.361] (-344.255) (-345.454) -- 0:00:07
364500 -- (-345.110) (-347.610) (-345.719) [-347.323] * (-345.680) (-344.436) [-344.202] (-345.724) -- 0:00:07
365000 -- (-345.629) [-348.933] (-345.047) (-345.175) * (-347.212) [-345.386] (-344.259) (-346.451) -- 0:00:08
Average standard deviation of split frequencies: 0.013287
365500 -- (-349.202) [-348.079] (-347.264) (-349.457) * [-346.717] (-346.578) (-346.134) (-345.061) -- 0:00:08
366000 -- (-345.518) [-345.318] (-344.709) (-345.780) * (-345.844) (-347.833) (-347.194) [-345.527] -- 0:00:08
366500 -- [-345.785] (-345.583) (-348.018) (-344.788) * (-346.944) [-345.923] (-345.978) (-349.114) -- 0:00:08
367000 -- (-346.379) [-346.704] (-345.434) (-344.931) * (-346.503) (-349.270) (-345.104) [-344.720] -- 0:00:07
367500 -- [-346.003] (-345.651) (-345.805) (-347.227) * (-350.682) (-347.199) [-349.594] (-345.161) -- 0:00:07
368000 -- (-348.350) (-344.955) [-344.774] (-348.102) * [-350.393] (-348.379) (-345.950) (-344.712) -- 0:00:07
368500 -- (-350.149) (-347.943) (-347.457) [-349.532] * [-346.902] (-347.730) (-346.263) (-347.910) -- 0:00:07
369000 -- (-347.158) (-346.160) (-345.877) [-344.216] * (-346.177) [-344.498] (-348.497) (-348.820) -- 0:00:07
369500 -- (-347.305) (-343.910) [-344.485] (-345.215) * [-349.714] (-346.634) (-345.516) (-347.517) -- 0:00:07
370000 -- (-348.644) [-346.481] (-345.346) (-345.297) * [-346.672] (-344.472) (-347.803) (-345.124) -- 0:00:07
Average standard deviation of split frequencies: 0.013722
370500 -- (-346.606) (-347.701) (-345.404) [-345.569] * (-348.527) (-346.998) (-346.149) [-346.426] -- 0:00:07
371000 -- (-347.790) (-346.859) [-345.096] (-344.416) * [-353.467] (-344.535) (-344.968) (-347.914) -- 0:00:07
371500 -- (-345.294) (-346.800) (-345.449) [-344.993] * [-345.085] (-346.233) (-345.069) (-346.477) -- 0:00:07
372000 -- (-346.061) (-346.530) [-344.733] (-345.358) * (-346.329) (-345.254) (-344.133) [-346.245] -- 0:00:07
372500 -- (-345.542) [-345.200] (-347.889) (-349.425) * [-346.339] (-347.812) (-344.237) (-349.374) -- 0:00:07
373000 -- (-347.361) (-350.840) [-346.141] (-345.146) * (-347.441) (-345.071) [-344.731] (-348.844) -- 0:00:07
373500 -- (-346.229) [-349.884] (-344.481) (-347.693) * (-344.173) [-344.647] (-345.904) (-348.409) -- 0:00:07
374000 -- (-348.088) (-345.901) [-344.887] (-347.028) * (-344.578) [-344.758] (-346.832) (-345.857) -- 0:00:07
374500 -- [-347.122] (-347.040) (-346.142) (-347.899) * (-347.809) [-345.813] (-348.422) (-344.697) -- 0:00:07
375000 -- (-351.026) [-346.064] (-345.586) (-346.252) * (-346.338) [-349.125] (-345.789) (-345.391) -- 0:00:07
Average standard deviation of split frequencies: 0.013923
375500 -- (-344.718) (-345.338) [-345.557] (-346.260) * (-344.575) [-346.453] (-344.841) (-350.302) -- 0:00:07
376000 -- [-346.149] (-345.431) (-344.257) (-349.992) * (-346.534) (-344.813) [-345.463] (-347.858) -- 0:00:07
376500 -- (-345.504) (-344.690) (-346.359) [-345.154] * (-352.702) [-345.732] (-348.054) (-344.986) -- 0:00:07
377000 -- [-345.827] (-346.950) (-344.892) (-345.888) * [-348.402] (-345.324) (-347.372) (-344.636) -- 0:00:07
377500 -- (-345.086) (-345.300) [-344.374] (-347.660) * (-348.802) (-347.773) [-345.029] (-345.858) -- 0:00:07
378000 -- (-346.187) (-344.949) [-344.119] (-345.035) * (-350.074) (-344.419) [-346.416] (-349.785) -- 0:00:07
378500 -- (-344.621) (-344.691) [-344.966] (-345.809) * (-344.789) [-345.688] (-345.832) (-349.687) -- 0:00:07
379000 -- (-346.110) (-345.133) [-346.213] (-346.648) * [-348.817] (-345.568) (-347.512) (-346.078) -- 0:00:07
379500 -- (-344.826) (-345.700) [-346.894] (-346.045) * (-348.699) (-346.784) [-344.598] (-348.492) -- 0:00:06
380000 -- (-346.523) (-345.038) [-345.365] (-347.462) * (-344.591) (-346.485) (-347.235) [-346.442] -- 0:00:06
Average standard deviation of split frequencies: 0.013101
380500 -- (-344.893) (-346.047) (-346.333) [-344.081] * [-347.459] (-343.935) (-346.861) (-345.130) -- 0:00:06
381000 -- (-344.989) [-346.059] (-346.856) (-345.560) * (-353.699) (-344.626) [-347.307] (-347.809) -- 0:00:06
381500 -- (-349.366) (-350.744) (-349.522) [-345.838] * [-346.560] (-348.393) (-349.555) (-348.442) -- 0:00:07
382000 -- [-347.855] (-345.368) (-345.222) (-351.441) * (-347.044) [-345.173] (-348.447) (-344.919) -- 0:00:07
382500 -- (-346.011) (-345.743) (-348.782) [-344.734] * [-345.462] (-346.652) (-344.721) (-346.688) -- 0:00:07
383000 -- (-346.292) (-345.994) (-344.389) [-345.524] * [-344.167] (-348.377) (-345.708) (-346.440) -- 0:00:07
383500 -- (-346.093) [-344.788] (-348.143) (-344.672) * (-345.610) (-346.003) [-346.236] (-346.590) -- 0:00:06
384000 -- [-345.453] (-344.960) (-345.079) (-344.672) * (-344.975) (-347.939) [-349.412] (-345.604) -- 0:00:06
384500 -- (-344.613) [-346.046] (-346.307) (-345.598) * [-345.563] (-346.473) (-347.575) (-347.147) -- 0:00:06
385000 -- [-345.827] (-347.468) (-346.820) (-349.437) * (-343.999) [-345.708] (-345.418) (-346.864) -- 0:00:06
Average standard deviation of split frequencies: 0.012945
385500 -- [-345.863] (-344.925) (-345.126) (-350.366) * (-346.097) [-345.117] (-346.065) (-344.463) -- 0:00:06
386000 -- (-347.036) [-346.943] (-344.628) (-345.197) * [-345.579] (-344.355) (-344.844) (-346.420) -- 0:00:06
386500 -- (-345.513) [-347.902] (-347.813) (-347.253) * (-345.935) (-346.530) (-348.595) [-347.368] -- 0:00:06
387000 -- (-348.383) (-348.066) (-345.189) [-346.870] * [-344.384] (-344.816) (-344.587) (-344.944) -- 0:00:06
387500 -- (-346.455) (-347.277) [-349.783] (-348.619) * (-348.569) (-347.675) (-346.169) [-346.480] -- 0:00:06
388000 -- (-345.002) (-347.696) [-349.593] (-347.178) * (-347.692) (-346.961) [-347.363] (-345.576) -- 0:00:06
388500 -- (-345.161) [-346.873] (-344.400) (-346.602) * [-344.273] (-346.137) (-347.136) (-345.332) -- 0:00:06
389000 -- [-345.244] (-347.168) (-344.815) (-346.167) * (-349.130) [-345.468] (-344.743) (-345.342) -- 0:00:06
389500 -- (-344.088) (-345.217) (-344.778) [-347.843] * [-348.155] (-345.533) (-346.130) (-347.159) -- 0:00:06
390000 -- (-345.921) (-344.411) (-345.963) [-345.528] * [-346.636] (-349.631) (-346.645) (-344.534) -- 0:00:06
Average standard deviation of split frequencies: 0.014212
390500 -- (-346.939) (-346.466) [-347.048] (-345.616) * (-347.851) [-346.974] (-348.479) (-348.102) -- 0:00:06
391000 -- (-344.351) (-345.297) [-344.121] (-344.592) * (-345.701) (-348.991) [-344.894] (-347.495) -- 0:00:06
391500 -- [-344.379] (-347.855) (-354.197) (-345.105) * (-345.579) (-347.667) (-345.668) [-345.813] -- 0:00:06
392000 -- (-349.337) (-347.499) (-348.236) [-345.345] * (-345.164) (-346.483) [-348.351] (-345.680) -- 0:00:06
392500 -- (-344.747) (-346.839) [-345.273] (-346.228) * (-345.254) [-345.069] (-344.467) (-347.581) -- 0:00:06
393000 -- (-345.395) (-347.432) [-347.082] (-344.789) * (-347.944) (-346.309) [-344.746] (-348.002) -- 0:00:06
393500 -- (-346.767) (-347.221) [-345.880] (-348.005) * [-344.569] (-345.862) (-345.679) (-347.096) -- 0:00:06
394000 -- (-345.787) (-346.383) [-345.829] (-345.939) * (-351.016) (-346.105) [-345.962] (-345.254) -- 0:00:06
394500 -- [-346.807] (-346.826) (-345.222) (-344.429) * (-344.792) [-346.960] (-344.033) (-350.349) -- 0:00:06
395000 -- (-347.596) [-344.682] (-344.544) (-345.400) * (-345.030) (-345.206) [-345.310] (-344.607) -- 0:00:06
Average standard deviation of split frequencies: 0.013425
395500 -- (-348.372) [-344.686] (-348.302) (-347.251) * [-343.718] (-345.595) (-345.262) (-344.426) -- 0:00:06
396000 -- (-347.089) (-345.018) [-343.841] (-348.151) * (-345.902) [-344.717] (-347.094) (-346.093) -- 0:00:06
396500 -- (-347.321) (-347.206) (-346.597) [-349.349] * (-350.109) [-344.083] (-347.282) (-345.220) -- 0:00:06
397000 -- (-345.702) (-346.068) (-345.131) [-347.782] * (-345.028) (-345.120) [-346.401] (-344.433) -- 0:00:05
397500 -- [-345.164] (-347.405) (-344.991) (-345.939) * (-344.489) (-345.580) (-345.752) [-344.540] -- 0:00:05
398000 -- (-344.819) (-347.026) [-345.532] (-345.358) * (-346.288) (-346.015) (-345.850) [-348.121] -- 0:00:06
398500 -- (-345.394) [-347.164] (-348.293) (-349.074) * (-351.997) (-345.160) (-346.836) [-346.273] -- 0:00:06
399000 -- [-346.023] (-346.272) (-349.129) (-344.833) * (-344.241) [-344.517] (-346.183) (-346.179) -- 0:00:06
399500 -- (-344.933) [-344.971] (-350.258) (-345.054) * (-345.232) [-344.045] (-347.837) (-348.002) -- 0:00:06
400000 -- (-345.680) [-344.385] (-348.237) (-346.191) * [-346.595] (-349.125) (-349.742) (-344.908) -- 0:00:06
Average standard deviation of split frequencies: 0.012873
400500 -- (-348.198) [-346.807] (-344.207) (-349.298) * (-349.327) [-344.628] (-346.611) (-352.120) -- 0:00:05
401000 -- (-347.567) (-346.585) [-346.298] (-344.775) * [-347.773] (-345.648) (-345.543) (-348.656) -- 0:00:05
401500 -- (-346.646) [-343.965] (-349.156) (-346.739) * (-349.760) [-348.488] (-344.188) (-344.843) -- 0:00:05
402000 -- [-346.098] (-347.802) (-345.476) (-349.661) * (-349.944) (-344.756) [-345.463] (-346.728) -- 0:00:05
402500 -- (-345.590) (-347.806) [-346.129] (-345.257) * (-350.861) (-345.219) (-345.345) [-345.175] -- 0:00:05
403000 -- [-346.216] (-356.991) (-345.306) (-344.386) * [-347.041] (-347.606) (-344.536) (-345.503) -- 0:00:05
403500 -- (-346.457) (-345.060) [-347.012] (-345.127) * (-345.664) [-344.671] (-344.597) (-345.069) -- 0:00:05
404000 -- [-346.474] (-347.241) (-349.115) (-345.171) * (-345.078) (-347.824) (-346.539) [-345.545] -- 0:00:05
404500 -- (-346.278) (-345.100) [-346.552] (-345.278) * (-345.523) (-346.767) (-344.511) [-346.094] -- 0:00:05
405000 -- (-346.332) [-344.313] (-346.247) (-352.460) * [-349.260] (-345.998) (-348.253) (-345.459) -- 0:00:05
Average standard deviation of split frequencies: 0.011489
405500 -- (-345.112) [-344.137] (-348.022) (-351.868) * (-346.691) [-344.545] (-345.771) (-345.566) -- 0:00:05
406000 -- (-346.973) [-346.119] (-351.879) (-350.355) * (-350.068) (-343.898) [-346.395] (-345.635) -- 0:00:05
406500 -- (-345.616) [-346.966] (-351.230) (-349.385) * (-347.340) (-345.447) [-345.561] (-346.645) -- 0:00:05
407000 -- (-344.733) (-346.920) [-345.875] (-347.420) * [-347.253] (-348.948) (-344.814) (-348.251) -- 0:00:05
407500 -- (-346.098) (-347.279) (-347.761) [-344.677] * (-350.715) (-349.740) (-345.162) [-344.454] -- 0:00:05
408000 -- (-345.640) (-344.865) [-344.739] (-345.652) * [-354.485] (-346.050) (-347.337) (-344.400) -- 0:00:05
408500 -- [-344.842] (-347.502) (-345.191) (-345.831) * (-345.244) (-347.518) [-347.151] (-345.836) -- 0:00:05
409000 -- (-348.166) (-346.867) [-345.540] (-344.444) * (-343.793) (-344.570) (-348.972) [-345.785] -- 0:00:05
409500 -- (-345.603) (-343.987) (-344.964) [-344.981] * (-347.766) (-345.577) [-348.031] (-352.542) -- 0:00:05
410000 -- (-348.000) [-346.964] (-348.307) (-344.418) * (-344.359) (-350.056) (-347.226) [-344.289] -- 0:00:05
Average standard deviation of split frequencies: 0.011842
410500 -- (-345.796) (-345.779) (-349.716) [-346.279] * (-344.279) [-348.392] (-345.117) (-344.757) -- 0:00:05
411000 -- (-349.705) [-344.800] (-344.703) (-345.800) * [-344.590] (-344.721) (-345.063) (-343.898) -- 0:00:05
411500 -- (-349.868) (-345.209) (-345.593) [-346.417] * (-346.401) (-345.324) (-349.161) [-348.138] -- 0:00:05
412000 -- (-348.887) (-345.659) [-344.845] (-351.303) * [-346.610] (-347.954) (-350.927) (-346.438) -- 0:00:05
412500 -- [-346.484] (-346.553) (-347.346) (-344.791) * [-344.991] (-349.228) (-348.878) (-351.103) -- 0:00:05
413000 -- (-346.650) [-348.399] (-346.592) (-348.272) * (-345.328) (-345.108) [-346.857] (-347.973) -- 0:00:05
413500 -- (-345.210) (-345.008) (-346.410) [-344.245] * [-344.461] (-346.433) (-350.845) (-347.818) -- 0:00:05
414000 -- (-344.074) (-344.899) [-345.116] (-346.804) * (-344.696) [-344.772] (-353.977) (-351.559) -- 0:00:05
414500 -- [-346.824] (-346.989) (-345.439) (-345.248) * (-345.695) (-349.074) (-345.241) [-346.353] -- 0:00:05
415000 -- [-347.931] (-346.739) (-349.404) (-347.071) * (-348.849) (-349.321) (-347.130) [-345.210] -- 0:00:05
Average standard deviation of split frequencies: 0.012167
415500 -- (-353.238) [-347.411] (-347.597) (-345.988) * (-344.716) (-346.445) [-349.462] (-346.503) -- 0:00:05
416000 -- [-345.256] (-346.756) (-345.729) (-345.478) * (-344.610) (-350.319) [-345.376] (-346.669) -- 0:00:05
416500 -- (-344.287) (-346.491) [-345.964] (-345.277) * (-345.700) (-344.400) (-347.781) [-345.590] -- 0:00:05
417000 -- [-345.402] (-349.997) (-351.345) (-346.309) * (-346.055) (-345.335) [-344.256] (-348.236) -- 0:00:04
417500 -- [-348.135] (-351.078) (-348.906) (-350.509) * [-347.500] (-344.475) (-347.320) (-345.855) -- 0:00:04
418000 -- (-346.823) (-347.442) [-348.526] (-352.660) * (-344.887) (-344.839) (-350.508) [-345.642] -- 0:00:04
418500 -- (-347.849) (-346.778) (-350.920) [-345.805] * (-347.403) (-345.254) [-347.897] (-344.395) -- 0:00:04
419000 -- (-348.061) [-346.925] (-344.449) (-345.722) * [-343.933] (-346.892) (-345.576) (-346.010) -- 0:00:04
419500 -- (-345.133) (-347.451) (-345.931) [-348.205] * (-345.132) (-345.612) (-344.352) [-346.457] -- 0:00:04
420000 -- (-346.276) [-345.449] (-347.163) (-346.457) * (-345.815) (-344.504) (-345.384) [-346.639] -- 0:00:04
Average standard deviation of split frequencies: 0.012504
420500 -- [-346.158] (-347.415) (-345.727) (-347.045) * (-348.772) [-344.367] (-344.004) (-346.791) -- 0:00:04
421000 -- (-346.277) [-346.180] (-344.861) (-346.016) * (-346.536) (-351.446) (-345.490) [-349.522] -- 0:00:04
421500 -- (-347.669) [-345.581] (-348.803) (-344.622) * (-344.637) (-345.896) [-345.906] (-346.085) -- 0:00:04
422000 -- (-345.725) [-344.747] (-345.077) (-343.986) * (-346.876) (-344.499) [-344.996] (-347.855) -- 0:00:04
422500 -- (-345.049) (-345.739) [-344.522] (-344.793) * (-348.006) [-344.811] (-346.414) (-346.671) -- 0:00:04
423000 -- (-345.184) [-346.152] (-346.140) (-346.074) * (-345.051) (-345.176) [-344.907] (-348.454) -- 0:00:04
423500 -- [-344.223] (-344.762) (-346.198) (-345.069) * (-345.554) [-344.548] (-346.386) (-344.505) -- 0:00:04
424000 -- [-345.226] (-345.130) (-347.113) (-347.960) * (-345.475) [-344.959] (-348.927) (-346.593) -- 0:00:04
424500 -- (-350.124) (-346.174) (-347.603) [-344.901] * (-347.857) [-344.885] (-346.683) (-353.017) -- 0:00:04
425000 -- (-348.027) [-345.346] (-343.980) (-344.162) * (-345.938) (-348.301) [-348.210] (-346.669) -- 0:00:04
Average standard deviation of split frequencies: 0.011998
425500 -- (-350.072) (-349.064) [-348.146] (-344.732) * (-345.895) [-350.619] (-344.168) (-346.598) -- 0:00:04
426000 -- [-348.701] (-346.777) (-345.258) (-345.434) * (-345.428) (-345.794) [-347.197] (-346.978) -- 0:00:04
426500 -- (-346.517) [-344.209] (-344.372) (-345.384) * (-345.640) (-345.000) (-344.382) [-346.094] -- 0:00:04
427000 -- [-345.967] (-346.634) (-347.017) (-348.138) * (-344.240) (-347.514) [-345.948] (-344.740) -- 0:00:04
427500 -- [-345.965] (-350.191) (-350.585) (-345.663) * (-345.948) [-345.288] (-344.572) (-345.652) -- 0:00:04
428000 -- (-344.957) [-348.537] (-354.149) (-350.534) * (-345.220) (-344.703) (-346.221) [-347.464] -- 0:00:04
428500 -- (-346.457) [-344.925] (-349.550) (-346.052) * [-348.344] (-347.150) (-345.735) (-346.318) -- 0:00:04
429000 -- (-347.854) [-344.474] (-347.252) (-349.142) * (-345.734) (-344.919) (-345.592) [-347.589] -- 0:00:04
429500 -- (-345.058) [-345.059] (-345.351) (-349.382) * (-348.555) [-345.535] (-345.252) (-346.794) -- 0:00:04
430000 -- (-345.198) [-350.555] (-344.553) (-346.199) * (-345.394) (-346.681) (-346.958) [-344.657] -- 0:00:04
Average standard deviation of split frequencies: 0.010831
430500 -- (-345.135) (-347.504) (-347.634) [-344.244] * (-345.516) (-345.246) (-346.405) [-348.825] -- 0:00:04
431000 -- (-344.498) (-349.865) (-345.490) [-344.587] * (-345.300) [-346.523] (-347.455) (-345.233) -- 0:00:04
431500 -- (-345.283) [-348.912] (-345.685) (-344.884) * (-349.345) (-346.420) [-347.160] (-344.560) -- 0:00:04
432000 -- (-344.643) [-350.892] (-346.953) (-344.636) * (-345.097) [-344.163] (-347.038) (-347.195) -- 0:00:04
432500 -- [-349.542] (-346.978) (-345.009) (-348.510) * (-345.962) (-344.478) [-347.807] (-346.344) -- 0:00:04
433000 -- (-346.963) [-344.826] (-345.065) (-346.374) * (-344.932) [-344.957] (-346.325) (-352.590) -- 0:00:04
433500 -- (-346.692) (-346.604) (-349.052) [-345.282] * (-348.305) [-344.489] (-346.298) (-344.998) -- 0:00:03
434000 -- (-346.064) (-345.242) (-344.646) [-344.198] * [-345.586] (-345.912) (-348.696) (-347.712) -- 0:00:03
434500 -- (-345.618) (-344.639) [-345.131] (-347.672) * (-344.669) (-345.561) [-344.653] (-346.012) -- 0:00:03
435000 -- (-345.799) (-354.033) (-345.155) [-345.630] * (-345.016) (-346.861) [-344.877] (-347.592) -- 0:00:03
Average standard deviation of split frequencies: 0.010755
435500 -- (-347.082) [-345.091] (-343.888) (-345.910) * [-345.329] (-345.091) (-344.685) (-344.489) -- 0:00:03
436000 -- [-345.300] (-344.447) (-350.289) (-346.428) * (-346.821) (-347.726) (-348.574) [-345.165] -- 0:00:03
436500 -- (-348.445) (-345.349) (-344.466) [-347.248] * (-346.201) (-344.192) [-344.070] (-345.567) -- 0:00:03
437000 -- (-343.892) (-345.864) [-344.663] (-346.887) * (-344.812) (-345.160) [-346.737] (-346.828) -- 0:00:03
437500 -- (-349.398) (-345.725) (-344.528) [-345.022] * (-346.752) (-348.851) [-345.183] (-345.095) -- 0:00:03
438000 -- (-347.661) (-345.092) [-346.333] (-345.938) * [-348.056] (-344.830) (-348.906) (-348.137) -- 0:00:03
438500 -- (-345.401) (-344.612) (-346.359) [-347.314] * (-347.243) [-349.735] (-344.741) (-345.584) -- 0:00:03
439000 -- [-344.899] (-343.991) (-345.135) (-345.622) * [-344.112] (-347.497) (-344.795) (-346.141) -- 0:00:03
439500 -- [-346.315] (-344.882) (-344.355) (-351.755) * (-346.333) [-344.071] (-352.408) (-346.562) -- 0:00:03
440000 -- (-346.139) (-344.755) (-349.565) [-345.325] * (-345.420) [-344.039] (-347.138) (-344.252) -- 0:00:03
Average standard deviation of split frequencies: 0.010858
440500 -- (-345.885) [-347.295] (-344.693) (-346.743) * (-345.109) (-345.211) [-348.659] (-350.012) -- 0:00:03
441000 -- (-349.195) (-352.546) [-349.374] (-348.931) * (-348.763) (-345.805) [-344.171] (-344.849) -- 0:00:03
441500 -- [-345.310] (-350.668) (-345.269) (-348.019) * [-349.443] (-346.099) (-344.621) (-345.924) -- 0:00:03
442000 -- [-348.660] (-345.024) (-349.307) (-345.182) * (-346.021) [-347.168] (-346.788) (-347.599) -- 0:00:03
442500 -- (-345.021) (-351.398) (-345.377) [-345.745] * [-345.623] (-349.122) (-350.560) (-351.771) -- 0:00:03
443000 -- (-345.151) (-345.029) (-345.898) [-346.243] * (-345.181) (-349.605) (-351.380) [-344.606] -- 0:00:03
443500 -- [-344.224] (-345.494) (-346.373) (-347.700) * (-345.914) [-349.779] (-345.008) (-346.528) -- 0:00:03
444000 -- [-346.329] (-346.581) (-350.530) (-345.624) * (-347.891) (-347.558) [-345.393] (-347.459) -- 0:00:03
444500 -- (-348.884) [-345.617] (-345.631) (-346.031) * (-346.694) (-346.948) [-346.944] (-347.533) -- 0:00:03
445000 -- (-344.845) (-348.559) [-344.729] (-348.372) * [-344.927] (-345.317) (-346.817) (-345.748) -- 0:00:03
Average standard deviation of split frequencies: 0.010403
445500 -- (-345.937) (-344.677) (-348.934) [-345.068] * (-345.080) (-347.847) [-347.094] (-346.257) -- 0:00:03
446000 -- (-346.963) [-346.291] (-346.496) (-346.217) * (-345.350) (-350.164) (-348.710) [-346.344] -- 0:00:03
446500 -- (-346.406) (-348.147) [-345.410] (-347.291) * (-347.905) (-348.009) (-346.135) [-344.384] -- 0:00:03
447000 -- (-345.739) (-345.548) [-349.109] (-349.152) * (-344.346) [-346.784] (-346.092) (-348.419) -- 0:00:03
447500 -- [-346.420] (-346.447) (-345.933) (-348.374) * [-347.298] (-345.239) (-346.954) (-346.349) -- 0:00:03
448000 -- [-344.747] (-344.672) (-348.537) (-348.794) * (-347.612) [-345.540] (-346.471) (-346.634) -- 0:00:03
448500 -- (-344.514) [-346.068] (-346.466) (-345.979) * (-349.763) (-346.116) [-348.265] (-345.251) -- 0:00:03
449000 -- [-344.860] (-345.829) (-344.216) (-345.537) * (-345.797) (-345.162) [-346.902] (-345.459) -- 0:00:03
449500 -- [-344.783] (-347.809) (-346.175) (-346.549) * (-346.461) (-349.658) (-346.787) [-345.038] -- 0:00:03
450000 -- (-348.236) (-347.100) [-348.382] (-347.552) * (-348.540) (-345.625) (-344.710) [-345.495] -- 0:00:03
Average standard deviation of split frequencies: 0.010576
450500 -- (-346.782) (-346.334) [-345.517] (-348.453) * (-346.934) (-345.386) [-347.418] (-347.525) -- 0:00:02
451000 -- (-346.844) [-343.842] (-344.832) (-346.732) * [-349.889] (-346.363) (-344.639) (-347.241) -- 0:00:02
451500 -- (-346.316) (-346.483) (-345.321) [-346.763] * (-351.285) (-347.759) [-345.347] (-353.691) -- 0:00:02
452000 -- (-344.644) [-348.151] (-348.608) (-351.108) * (-346.482) (-344.891) (-346.902) [-345.272] -- 0:00:02
452500 -- (-347.008) (-345.587) [-346.655] (-346.540) * [-347.417] (-344.411) (-346.025) (-348.366) -- 0:00:02
453000 -- (-344.674) [-344.673] (-346.633) (-346.853) * (-346.510) (-346.763) [-347.609] (-347.108) -- 0:00:02
453500 -- (-344.948) (-345.319) (-348.476) [-345.478] * (-347.111) (-345.402) (-346.088) [-346.705] -- 0:00:02
454000 -- (-351.999) (-346.112) (-346.738) [-346.114] * (-348.750) (-344.741) (-346.904) [-347.250] -- 0:00:02
454500 -- (-345.372) (-344.460) [-344.048] (-345.402) * [-345.545] (-345.694) (-346.905) (-347.015) -- 0:00:02
455000 -- [-346.798] (-344.802) (-345.382) (-344.473) * (-345.061) [-346.554] (-347.369) (-348.452) -- 0:00:02
Average standard deviation of split frequencies: 0.010034
455500 -- (-346.289) (-345.605) (-345.905) [-344.098] * (-345.541) (-346.286) [-343.940] (-350.418) -- 0:00:02
456000 -- (-345.043) [-345.752] (-347.530) (-344.158) * (-348.220) (-345.423) (-346.522) [-344.138] -- 0:00:02
456500 -- [-347.785] (-344.345) (-345.572) (-348.220) * (-345.907) (-348.225) [-348.770] (-346.071) -- 0:00:02
457000 -- (-346.606) [-347.190] (-345.676) (-344.778) * [-345.163] (-344.627) (-348.158) (-346.035) -- 0:00:02
457500 -- (-344.249) [-344.385] (-345.771) (-346.147) * (-351.909) (-344.289) [-344.391] (-345.121) -- 0:00:02
458000 -- (-351.037) (-345.766) (-351.696) [-348.565] * (-347.424) (-348.902) (-344.216) [-344.452] -- 0:00:02
458500 -- (-348.088) [-346.255] (-346.057) (-346.892) * (-345.428) [-346.508] (-347.452) (-345.283) -- 0:00:02
459000 -- (-345.458) [-345.999] (-347.135) (-345.881) * (-349.142) [-344.518] (-344.972) (-346.887) -- 0:00:02
459500 -- (-345.411) (-347.095) (-346.932) [-345.491] * (-351.080) [-345.182] (-348.037) (-347.733) -- 0:00:02
460000 -- (-349.481) [-346.649] (-344.987) (-344.927) * (-343.926) (-346.397) (-347.876) [-345.871] -- 0:00:02
Average standard deviation of split frequencies: 0.009992
460500 -- (-345.752) [-346.281] (-345.804) (-347.442) * (-344.601) [-345.934] (-345.325) (-344.733) -- 0:00:02
461000 -- (-345.412) (-348.265) [-345.117] (-346.863) * (-350.617) (-346.417) [-344.383] (-347.117) -- 0:00:02
461500 -- (-346.429) (-346.245) [-344.706] (-345.174) * (-349.976) [-346.233] (-344.563) (-351.600) -- 0:00:02
462000 -- (-349.098) (-344.648) (-345.776) [-346.157] * (-347.573) [-346.799] (-348.500) (-345.803) -- 0:00:02
462500 -- (-348.436) (-344.684) (-344.789) [-345.144] * [-344.275] (-346.472) (-347.683) (-345.350) -- 0:00:02
463000 -- (-345.551) [-343.993] (-349.593) (-344.565) * (-345.150) [-348.314] (-347.746) (-346.456) -- 0:00:02
463500 -- (-348.074) (-347.606) (-347.818) [-349.111] * (-344.624) (-346.891) (-345.554) [-345.516] -- 0:00:02
464000 -- [-345.057] (-344.794) (-346.464) (-348.889) * (-347.591) (-346.471) [-345.770] (-348.348) -- 0:00:02
464500 -- (-344.598) [-343.798] (-345.359) (-344.324) * (-347.955) [-346.035] (-348.031) (-344.561) -- 0:00:02
465000 -- (-347.580) [-345.662] (-344.509) (-345.771) * [-347.357] (-345.251) (-344.445) (-348.955) -- 0:00:02
Average standard deviation of split frequencies: 0.009937
465500 -- (-348.395) [-345.331] (-348.357) (-344.892) * (-345.604) (-347.127) [-345.488] (-345.193) -- 0:00:02
466000 -- (-346.289) (-346.465) (-351.377) [-344.859] * (-346.823) [-345.497] (-346.484) (-348.061) -- 0:00:02
466500 -- (-347.443) (-345.098) (-345.917) [-346.708] * (-348.149) (-345.597) [-343.865] (-346.916) -- 0:00:02
467000 -- (-347.787) (-346.550) [-346.645] (-345.109) * (-347.308) (-344.928) [-347.965] (-348.668) -- 0:00:01
467500 -- (-346.368) [-346.842] (-347.274) (-346.153) * (-350.125) (-345.687) (-344.672) [-344.588] -- 0:00:01
468000 -- (-344.259) [-348.764] (-344.582) (-346.716) * (-348.046) [-346.575] (-346.647) (-345.259) -- 0:00:01
468500 -- (-344.716) [-344.501] (-344.543) (-344.532) * [-345.600] (-345.343) (-346.534) (-344.850) -- 0:00:01
469000 -- [-344.922] (-345.779) (-349.549) (-344.617) * (-344.109) (-345.045) (-343.997) [-347.056] -- 0:00:01
469500 -- (-345.460) (-350.464) [-345.249] (-344.077) * (-343.972) (-347.555) (-344.376) [-344.959] -- 0:00:01
470000 -- (-346.499) (-350.528) [-346.606] (-344.163) * (-344.243) (-345.639) [-344.354] (-348.074) -- 0:00:01
Average standard deviation of split frequencies: 0.008764
470500 -- (-344.729) (-353.606) (-347.706) [-344.636] * (-346.554) [-344.319] (-345.924) (-348.549) -- 0:00:01
471000 -- [-350.192] (-348.977) (-349.659) (-346.741) * (-347.698) [-344.588] (-345.842) (-345.827) -- 0:00:01
471500 -- (-345.632) (-348.085) [-346.607] (-346.334) * (-347.912) (-345.652) (-352.095) [-347.793] -- 0:00:01
472000 -- (-347.832) (-344.797) [-346.408] (-346.137) * (-347.030) (-345.668) [-345.677] (-346.573) -- 0:00:01
472500 -- (-346.818) (-344.937) (-345.553) [-347.325] * (-344.667) (-345.990) (-344.002) [-345.838] -- 0:00:01
473000 -- (-344.286) (-345.640) [-344.678] (-349.027) * (-348.851) [-344.344] (-346.434) (-348.859) -- 0:00:01
473500 -- (-345.999) [-344.262] (-345.346) (-345.346) * (-349.772) (-347.752) [-345.051] (-348.741) -- 0:00:01
474000 -- (-347.658) (-345.543) (-345.521) [-346.153] * (-347.141) (-345.584) [-345.307] (-349.134) -- 0:00:01
474500 -- (-349.555) (-345.745) (-345.572) [-347.539] * (-344.820) (-349.681) (-347.372) [-345.768] -- 0:00:01
475000 -- (-345.404) (-344.898) (-344.962) [-344.677] * [-345.228] (-346.642) (-345.750) (-346.066) -- 0:00:01
Average standard deviation of split frequencies: 0.009161
475500 -- (-345.977) (-345.172) (-348.998) [-345.409] * [-345.408] (-347.621) (-344.649) (-347.072) -- 0:00:01
476000 -- (-346.149) (-345.126) [-345.035] (-346.605) * (-345.581) (-350.490) [-349.130] (-344.577) -- 0:00:01
476500 -- [-348.361] (-345.858) (-353.272) (-350.293) * (-346.783) (-346.298) [-347.409] (-344.650) -- 0:00:01
477000 -- (-345.234) [-344.944] (-345.694) (-346.587) * (-344.643) [-345.149] (-347.014) (-347.826) -- 0:00:01
477500 -- [-345.213] (-345.257) (-344.390) (-348.981) * (-344.246) (-344.478) [-346.847] (-344.678) -- 0:00:01
478000 -- (-344.843) (-346.575) [-344.359] (-348.802) * [-345.407] (-345.609) (-346.122) (-347.758) -- 0:00:01
478500 -- (-351.074) [-347.374] (-346.183) (-348.339) * [-350.125] (-346.167) (-346.062) (-345.168) -- 0:00:01
479000 -- (-348.721) (-347.555) [-345.747] (-347.799) * (-352.415) (-347.933) (-347.617) [-345.014] -- 0:00:01
479500 -- (-351.743) (-350.755) [-345.863] (-345.336) * [-344.753] (-347.793) (-346.139) (-351.192) -- 0:00:01
480000 -- (-347.424) (-348.174) [-345.277] (-344.140) * (-348.744) (-344.493) [-345.763] (-349.974) -- 0:00:01
Average standard deviation of split frequencies: 0.008765
480500 -- (-345.621) [-345.824] (-348.998) (-345.324) * (-348.951) (-344.571) [-348.187] (-354.558) -- 0:00:01
481000 -- [-347.791] (-346.041) (-347.576) (-349.312) * [-345.365] (-344.510) (-350.035) (-348.083) -- 0:00:01
481500 -- (-347.425) (-350.905) [-349.967] (-350.721) * [-348.689] (-344.492) (-347.965) (-345.952) -- 0:00:01
482000 -- (-348.053) (-354.461) (-348.039) [-345.953] * (-347.046) (-346.255) [-347.289] (-344.874) -- 0:00:01
482500 -- [-344.559] (-344.929) (-344.248) (-346.124) * (-346.969) (-345.554) (-348.647) [-345.316] -- 0:00:01
483000 -- [-344.583] (-346.924) (-345.043) (-346.256) * [-344.558] (-347.047) (-347.019) (-347.325) -- 0:00:01
483500 -- (-349.510) [-346.218] (-345.035) (-349.746) * (-345.733) (-346.409) [-345.989] (-349.170) -- 0:00:00
484000 -- (-350.366) [-345.926] (-347.386) (-344.546) * (-347.188) [-345.087] (-345.736) (-347.461) -- 0:00:00
484500 -- (-348.466) [-344.482] (-348.590) (-350.066) * (-348.273) (-349.948) [-346.553] (-347.524) -- 0:00:00
485000 -- [-345.914] (-345.895) (-347.319) (-345.807) * (-344.488) (-351.373) [-345.967] (-350.463) -- 0:00:00
Average standard deviation of split frequencies: 0.009186
485500 -- (-347.322) (-345.978) [-346.322] (-346.124) * (-347.354) (-348.424) (-343.894) [-349.933] -- 0:00:00
486000 -- (-347.188) [-346.137] (-345.043) (-345.855) * (-345.636) (-346.992) [-346.720] (-344.958) -- 0:00:00
486500 -- [-346.050] (-345.875) (-348.294) (-346.437) * (-344.968) [-347.314] (-348.200) (-346.169) -- 0:00:00
487000 -- (-346.501) (-344.175) [-346.897] (-344.695) * (-343.816) (-347.949) (-349.417) [-345.494] -- 0:00:00
487500 -- (-344.931) (-346.933) (-344.597) [-346.620] * (-345.150) (-345.952) [-346.881] (-345.764) -- 0:00:00
488000 -- (-345.320) [-345.192] (-345.746) (-344.820) * (-347.806) [-349.911] (-354.066) (-345.644) -- 0:00:00
488500 -- [-344.272] (-344.284) (-344.908) (-346.507) * (-347.595) (-346.123) [-348.641] (-347.200) -- 0:00:00
489000 -- (-348.767) (-346.096) [-345.640] (-345.287) * (-352.365) [-344.914] (-346.112) (-345.420) -- 0:00:00
489500 -- [-348.664] (-343.986) (-345.631) (-344.867) * (-350.461) (-347.702) [-344.745] (-347.582) -- 0:00:00
490000 -- (-351.798) (-345.245) [-347.718] (-347.863) * (-350.879) (-346.816) (-345.765) [-344.773] -- 0:00:00
Average standard deviation of split frequencies: 0.009768
490500 -- (-346.652) [-343.832] (-344.015) (-350.141) * (-344.752) [-345.298] (-345.832) (-346.859) -- 0:00:00
491000 -- (-344.858) (-343.995) [-346.447] (-347.909) * (-346.338) (-344.327) (-347.925) [-343.919] -- 0:00:00
491500 -- [-344.711] (-349.559) (-351.999) (-347.408) * [-346.526] (-345.263) (-346.664) (-346.192) -- 0:00:00
492000 -- [-348.650] (-347.932) (-351.474) (-344.531) * (-347.042) [-347.709] (-347.406) (-348.508) -- 0:00:00
492500 -- [-346.152] (-347.710) (-350.313) (-345.246) * (-347.209) [-345.319] (-345.222) (-345.934) -- 0:00:00
493000 -- [-348.642] (-345.466) (-346.391) (-345.097) * (-348.023) (-349.113) (-345.327) [-344.201] -- 0:00:00
493500 -- [-348.857] (-344.937) (-344.648) (-344.892) * (-346.042) (-347.135) [-345.387] (-345.175) -- 0:00:00
494000 -- (-344.986) [-345.484] (-344.232) (-347.463) * (-345.869) (-347.023) (-345.369) [-346.327] -- 0:00:00
494500 -- (-344.447) (-347.874) (-345.976) [-350.115] * (-344.021) (-345.086) [-345.390] (-346.118) -- 0:00:00
495000 -- (-345.128) (-346.020) [-347.323] (-347.762) * (-345.545) (-348.977) (-345.792) [-345.367] -- 0:00:00
Average standard deviation of split frequencies: 0.009346
495500 -- (-344.698) [-345.282] (-348.606) (-345.139) * (-344.675) (-348.328) (-347.766) [-344.121] -- 0:00:00
496000 -- (-345.050) [-346.148] (-347.430) (-346.710) * (-344.452) (-347.501) (-346.570) [-344.213] -- 0:00:00
496500 -- (-345.521) (-347.184) (-347.000) [-345.030] * (-345.618) (-346.576) (-345.009) [-345.632] -- 0:00:00
497000 -- (-346.155) (-347.694) [-349.205] (-346.474) * (-346.034) (-344.883) [-343.940] (-346.579) -- 0:00:00
497500 -- (-345.232) [-350.358] (-347.661) (-346.594) * (-347.487) [-344.246] (-345.507) (-344.103) -- 0:00:00
498000 -- [-345.500] (-346.047) (-344.808) (-348.159) * (-347.040) (-343.922) [-345.743] (-344.896) -- 0:00:00
498500 -- [-344.807] (-345.533) (-345.860) (-348.737) * (-346.168) [-345.798] (-347.537) (-345.356) -- 0:00:00
499000 -- [-344.343] (-346.610) (-346.058) (-345.665) * (-344.103) [-346.594] (-346.123) (-345.499) -- 0:00:00
499500 -- [-345.946] (-347.192) (-345.106) (-346.392) * [-344.902] (-348.810) (-346.891) (-344.777) -- 0:00:00
500000 -- [-344.671] (-344.980) (-345.948) (-348.029) * [-345.801] (-348.558) (-345.954) (-345.175) -- 0:00:00
Average standard deviation of split frequencies: 0.007474
Analysis completed in 30 seconds
Analysis used 28.96 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -343.65
Likelihood of best state for "cold" chain of run 2 was -343.65
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.6 % ( 78 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
48.1 % ( 42 %) Dirichlet(Pi{all})
49.2 % ( 41 %) Slider(Pi{all})
88.9 % ( 75 %) Multiplier(Alpha{1,2})
87.4 % ( 77 %) Multiplier(Alpha{3})
28.4 % ( 23 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 89 %) ParsSPR(Tau{all},V{all})
30.9 % ( 26 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
35.8 % ( 21 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
78.8 % ( 77 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
48.3 % ( 41 %) Dirichlet(Pi{all})
49.6 % ( 42 %) Slider(Pi{all})
88.5 % ( 84 %) Multiplier(Alpha{1,2})
87.9 % ( 78 %) Multiplier(Alpha{3})
27.9 % ( 21 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.1 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 89 %) ParsSPR(Tau{all},V{all})
30.6 % ( 25 %) Multiplier(V{all})
97.2 % ( 95 %) Nodeslider(V{all})
35.0 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83454 0.82 0.67
3 | 83150 83513 0.84
4 | 83163 82988 83732
Chain swap information for run 2:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83544 0.82 0.66
3 | 83694 83065 0.84
4 | 83006 83168 83523
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 1250
Summarizing parameters in files /data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -345.12
| 2 11 2|
| 2 * 1 2 2 |
| 1 1 1 2 2 2 |
|1 1 2 2 1 |
| 2 1 2 2 2 1 1 1 1 2 |
|2 2 1 21 1 2* 22 2 1 * 1 |
| * 11 1 2 22 2 1 1 21 2 2 |
| 2 1 21 1 1 1 |
| 1 2* 2 11 1 2 2 1 12 1 1 |
| 2 1 2 12 1 1 2 2 1|
| 2 1 1 2 2 1 2 1 2 21 |
| 1 1 * 2 |
| 1 1 |
| 2 2 2 |
| 21 1 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -347.16
^ ^
125000 500000
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -345.32 -349.68
2 -345.30 -348.75
--------------------------------------
TOTAL -345.31 -349.32
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.885705 0.092484 0.338404 1.464076 0.855680 627.84 689.42 1.000
r(A<->C){all} 0.184728 0.022356 0.000016 0.479051 0.144886 61.30 72.02 0.999
r(A<->G){all} 0.145308 0.015846 0.000053 0.405833 0.109802 99.17 191.21 1.000
r(A<->T){all} 0.170039 0.018241 0.000108 0.435959 0.139657 42.34 57.12 1.013
r(C<->G){all} 0.174342 0.020047 0.000039 0.467396 0.138761 45.41 98.09 0.999
r(C<->T){all} 0.168198 0.021004 0.000554 0.468900 0.128542 87.99 95.87 1.018
r(G<->T){all} 0.157386 0.018794 0.000142 0.428352 0.120143 80.58 98.07 0.999
pi(A){all} 0.241811 0.000699 0.191487 0.295980 0.241242 634.18 654.45 1.000
pi(C){all} 0.209655 0.000649 0.160903 0.261671 0.208761 667.78 692.99 0.999
pi(G){all} 0.268161 0.000753 0.212079 0.320966 0.268145 624.88 670.87 1.001
pi(T){all} 0.280373 0.000814 0.227532 0.336602 0.280500 528.68 610.80 1.000
alpha{1,2} 0.408676 0.204578 0.000219 1.285184 0.261923 450.04 499.05 1.001
alpha{3} 0.454787 0.234482 0.000347 1.396780 0.299020 601.72 676.36 1.000
pinvar{all} 0.993636 0.000061 0.978982 0.999994 0.996183 702.50 726.75 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 1250
Summarizing trees in files "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 2002 trees in 2 files (sampling 1502 of them)
(Each file contained 1001 trees of which 751 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*.*.
8 -- .***.*
9 -- .*.***
10 -- ....**
11 -- ...**.
12 -- .****.
13 -- ..**..
14 -- ..****
15 -- .**...
16 -- .*.*..
17 -- .**.**
18 -- ...*.*
19 -- ..*..*
20 -- .*...*
21 -- .*..*.
22 -- ..***.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 230 0.153129 0.003766 0.150466 0.155792 2
8 227 0.151132 0.002825 0.149134 0.153129 2
9 227 0.151132 0.004708 0.147803 0.154461 2
10 223 0.148469 0.006591 0.143808 0.153129 2
11 222 0.147803 0.009416 0.141145 0.154461 2
12 220 0.146471 0.015065 0.135819 0.157124 2
13 219 0.145806 0.017890 0.133156 0.158455 2
14 218 0.145140 0.001883 0.143808 0.146471 2
15 216 0.143808 0.020714 0.129161 0.158455 2
16 215 0.143142 0.004708 0.139814 0.146471 2
17 207 0.137816 0.000942 0.137150 0.138482 2
18 204 0.135819 0.015065 0.125166 0.146471 2
19 202 0.134487 0.000000 0.134487 0.134487 2
20 201 0.133822 0.000942 0.133156 0.134487 2
21 196 0.130493 0.000000 0.130493 0.130493 2
22 144 0.095872 0.015065 0.085220 0.106525 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098162 0.009866 0.000041 0.285702 0.065585 0.999 2
length{all}[2] 0.097191 0.009011 0.000292 0.285557 0.068013 0.999 2
length{all}[3] 0.094792 0.008818 0.000066 0.285371 0.065717 0.999 2
length{all}[4] 0.095833 0.009014 0.000045 0.275523 0.066640 0.999 2
length{all}[5] 0.100141 0.009551 0.000058 0.294799 0.068038 1.000 2
length{all}[6] 0.101168 0.009437 0.000015 0.279981 0.075115 1.000 2
length{all}[7] 0.091862 0.008056 0.000205 0.261311 0.063366 0.997 2
length{all}[8] 0.099014 0.010887 0.000640 0.291093 0.061938 0.996 2
length{all}[9] 0.101066 0.010652 0.000259 0.302799 0.070067 0.997 2
length{all}[10] 0.097621 0.009873 0.000118 0.282370 0.069543 1.003 2
length{all}[11] 0.105820 0.012658 0.000073 0.314672 0.071814 0.997 2
length{all}[12] 0.104570 0.009743 0.000496 0.315957 0.076270 1.000 2
length{all}[13] 0.094614 0.008283 0.000230 0.298696 0.070816 0.995 2
length{all}[14] 0.109994 0.012501 0.000199 0.331930 0.073827 0.999 2
length{all}[15] 0.105955 0.011915 0.000502 0.339753 0.073209 0.996 2
length{all}[16] 0.092950 0.007058 0.000127 0.269139 0.067611 1.001 2
length{all}[17] 0.103630 0.010321 0.000058 0.325663 0.070920 1.000 2
length{all}[18] 0.096484 0.009141 0.000167 0.283849 0.066894 0.998 2
length{all}[19] 0.084260 0.007054 0.000199 0.259341 0.060371 0.997 2
length{all}[20] 0.110185 0.015142 0.000039 0.368624 0.069667 1.007 2
length{all}[21] 0.094265 0.008183 0.000568 0.300144 0.060732 0.995 2
length{all}[22] 0.096173 0.009665 0.000753 0.283676 0.059636 0.994 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007474
Maximum standard deviation of split frequencies = 0.020714
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 42 trees
90 % credible set contains 88 trees
95 % credible set contains 96 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 249
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 45 patterns at 83 / 83 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 45 patterns at 83 / 83 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
43920 bytes for conP
3960 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.017797 0.063040 0.061564 0.016303 0.057401 0.045182 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -351.855067
Iterating by ming2
Initial: fx= 351.855067
x= 0.01780 0.06304 0.06156 0.01630 0.05740 0.04518 0.30000 1.30000
1 h-m-p 0.0000 0.0002 199.5675 +++ 343.913089 m 0.0002 14 | 1/8
2 h-m-p 0.0012 0.0230 29.1398 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 182.5111 ++ 343.304738 m 0.0000 45 | 2/8
4 h-m-p 0.0001 0.0297 24.4253 ----------.. | 2/8
5 h-m-p 0.0000 0.0003 163.0682 +++ 334.343635 m 0.0003 76 | 3/8
6 h-m-p 0.0024 0.0435 19.6975 ------------.. | 3/8
7 h-m-p 0.0000 0.0002 141.7819 ++ 331.318657 m 0.0002 108 | 4/8
8 h-m-p 0.0012 0.1010 14.9192 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 115.9713 ++ 330.628992 m 0.0001 139 | 5/8
10 h-m-p 0.0004 0.1495 10.1381 ----------.. | 5/8
11 h-m-p 0.0000 0.0000 82.0515 ++ 330.506603 m 0.0000 169 | 6/8
12 h-m-p 0.1243 8.0000 0.0000 --C 330.506603 0 0.0019 182 | 6/8
13 h-m-p 0.0966 8.0000 0.0000 +C 330.506603 0 0.3865 196
Out..
lnL = -330.506603
197 lfun, 197 eigenQcodon, 1182 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.018498 0.055710 0.087108 0.081821 0.090169 0.093142 0.299970 0.522787 0.443715
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.506607
np = 9
lnL0 = -364.183193
Iterating by ming2
Initial: fx= 364.183193
x= 0.01850 0.05571 0.08711 0.08182 0.09017 0.09314 0.29997 0.52279 0.44372
1 h-m-p 0.0000 0.0002 188.1638 +++ 355.674170 m 0.0002 15 | 1/9
2 h-m-p 0.0002 0.0009 162.6637 ++ 340.868829 m 0.0009 27 | 2/9
3 h-m-p 0.0000 0.0001 798.1622 ++ 332.579541 m 0.0001 39 | 3/9
4 h-m-p 0.0002 0.0012 41.2335 ++ 331.209992 m 0.0012 51 | 4/9
5 h-m-p 0.0000 0.0000 414148.6921 ++ 330.727763 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 3148.5244 ++ 330.506573 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 330.506572 m 8.0000 87 | 6/9
8 h-m-p 0.0017 0.3324 0.6561 ++++ 330.506544 m 0.3324 104 | 7/9
9 h-m-p 0.6176 4.1870 0.1800 --------------Y 330.506544 0 0.0000 133 | 7/9
10 h-m-p 0.0160 8.0000 0.0004 +++++ 330.506544 m 8.0000 150 | 7/9
11 h-m-p 0.0085 4.2681 0.3519 -------------.. | 7/9
12 h-m-p 0.0160 8.0000 0.0002 +++++ 330.506543 m 8.0000 192 | 7/9
13 h-m-p 0.0067 3.2227 0.2332 ------------.. | 7/9
14 h-m-p 0.0160 8.0000 0.0002 +++++ 330.506543 m 8.0000 233 | 7/9
15 h-m-p 0.0067 3.2261 0.2334 ----------Y 330.506543 0 0.0000 257 | 7/9
16 h-m-p 0.0160 8.0000 0.0019 +++++ 330.506540 m 8.0000 274 | 7/9
17 h-m-p 0.0630 3.0507 0.2386 -----------C 330.506540 0 0.0000 299 | 7/9
18 h-m-p 0.0160 8.0000 0.0002 +++++ 330.506540 m 8.0000 316 | 7/9
19 h-m-p 0.0064 3.1995 0.2279 ------------.. | 7/9
20 h-m-p 0.0160 8.0000 0.0002 +++++ 330.506540 m 8.0000 357 | 7/9
21 h-m-p 0.0075 3.4280 0.2249 -----------N 330.506540 0 0.0000 382 | 7/9
22 h-m-p 0.0002 0.0886 3.2061 +++++ 330.506379 m 0.0886 399 | 8/9
23 h-m-p 0.7873 8.0000 0.1151 -------------C 330.506379 0 0.0000 424 | 8/9
24 h-m-p 0.0160 8.0000 0.0000 +++++ 330.506379 m 8.0000 440 | 8/9
25 h-m-p 0.0160 8.0000 0.0812 -------------.. | 8/9
26 h-m-p 0.0160 8.0000 0.0003 +++++ 330.506379 m 8.0000 480 | 8/9
27 h-m-p 0.0160 8.0000 0.5069 ------------Y 330.506379 0 0.0000 505 | 8/9
28 h-m-p 0.0160 8.0000 0.0000 +++++ 330.506378 m 8.0000 521 | 8/9
29 h-m-p 0.0160 8.0000 0.5149 ------------Y 330.506378 0 0.0000 546 | 8/9
30 h-m-p 0.0160 8.0000 0.0000 +++++ 330.506378 m 8.0000 562 | 8/9
31 h-m-p 0.0160 8.0000 0.5019 ------------N 330.506378 0 0.0000 587 | 8/9
32 h-m-p 0.0160 8.0000 0.0000 -----N 330.506378 0 0.0000 605 | 8/9
33 h-m-p 0.0160 8.0000 0.0000 ----N 330.506378 0 0.0000 622
Out..
lnL = -330.506378
623 lfun, 1869 eigenQcodon, 7476 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.022729 0.061263 0.090075 0.029344 0.050846 0.099644 0.128259 0.893720 0.183142 0.114183 1.306708
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 13.028783
np = 11
lnL0 = -356.378730
Iterating by ming2
Initial: fx= 356.378730
x= 0.02273 0.06126 0.09008 0.02934 0.05085 0.09964 0.12826 0.89372 0.18314 0.11418 1.30671
1 h-m-p 0.0000 0.0003 162.0441 +++ 347.091118 m 0.0003 17 | 1/11
2 h-m-p 0.0001 0.0004 88.0261 ++ 344.567548 m 0.0004 31 | 2/11
3 h-m-p 0.0001 0.0003 192.9067 ++ 338.586838 m 0.0003 45 | 3/11
4 h-m-p 0.0000 0.0002 157.1475 ++ 337.185268 m 0.0002 59 | 4/11
5 h-m-p 0.0009 0.0095 14.7758 ++ 336.894085 m 0.0095 73 | 5/11
6 h-m-p 0.0001 0.0004 39.7754 ++ 335.731223 m 0.0004 87 | 6/11
7 h-m-p 0.0001 0.0025 30.9296 +++ 335.115336 m 0.0025 102 | 7/11
8 h-m-p 0.0005 0.0032 138.8123 ++ 330.506551 m 0.0032 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0001 ++ 330.506551 m 8.0000 130 | 8/11
10 h-m-p 0.0160 8.0000 0.5103 ----------Y 330.506551 0 0.0000 157 | 8/11
11 h-m-p 0.0160 8.0000 0.0039 +++++ 330.506549 m 8.0000 177 | 8/11
12 h-m-p 0.0210 8.0000 1.5002 -----------C 330.506549 0 0.0000 205 | 8/11
13 h-m-p 0.0160 8.0000 0.0005 +++++ 330.506549 m 8.0000 222 | 8/11
14 h-m-p 0.0160 8.0000 1.5679 -----------Y 330.506549 0 0.0000 250 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 330.506549 m 8.0000 267 | 8/11
16 h-m-p 0.0010 0.4800 2.8174 ---------C 330.506549 0 0.0000 293 | 8/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 330.506549 m 8.0000 310 | 8/11
18 h-m-p 0.0160 8.0000 0.0215 +++++ 330.506540 m 8.0000 330 | 8/11
19 h-m-p 0.1013 8.0000 1.6967 --------------.. | 8/11
20 h-m-p 0.0160 8.0000 0.0001 +++++ 330.506540 m 8.0000 376 | 8/11
21 h-m-p 0.0160 8.0000 6.9491 -------------.. | 8/11
22 h-m-p 0.0160 8.0000 0.0001 +++++ 330.506540 m 8.0000 421 | 8/11
23 h-m-p 0.0029 1.4510 0.7255 +++++ 330.506463 m 1.4510 441 | 9/11
24 h-m-p 0.2897 8.0000 3.1738 --------------N 330.506463 0 0.0000 472 | 9/11
25 h-m-p 0.0160 8.0000 0.0038 +++++ 330.506461 m 8.0000 489 | 9/11
26 h-m-p 0.0016 0.7819 125.3014 ++++Y 330.506331 0 0.4004 509 | 9/11
27 h-m-p 1.6000 8.0000 0.0000 N 330.506331 0 1.6000 523 | 9/11
28 h-m-p 0.0160 8.0000 0.0000 Y 330.506331 0 0.0160 539
Out..
lnL = -330.506331
540 lfun, 2160 eigenQcodon, 9720 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -330.537415 S = -330.506958 -0.011712
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 45 patterns 0:04
did 20 / 45 patterns 0:04
did 30 / 45 patterns 0:04
did 40 / 45 patterns 0:04
did 45 / 45 patterns 0:04
Time used: 0:04
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.077444 0.025905 0.035184 0.055133 0.025993 0.106592 0.000100 0.912482 0.226652 0.649960 1.504747 2.200622
ntime & nrate & np: 6 4 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 7.785215
np = 12
lnL0 = -356.018567
Iterating by ming2
Initial: fx= 356.018567
x= 0.07744 0.02590 0.03518 0.05513 0.02599 0.10659 0.00011 0.91248 0.22665 0.64996 1.50475 2.20062
1 h-m-p 0.0000 0.0000 183.6861 ++ 355.665676 m 0.0000 17 | 1/12
2 h-m-p 0.0000 0.0040 61.1763 ++++ 343.018797 m 0.0040 34 | 2/12
3 h-m-p 0.0000 0.0000 146.0402 ++ 342.988562 m 0.0000 49 | 3/12
4 h-m-p 0.0000 0.0015 68.3483 ++++ 339.939596 m 0.0015 66 | 4/12
5 h-m-p 0.0001 0.0004 170.8948 ++ 335.791248 m 0.0004 81 | 5/12
6 h-m-p 0.0003 0.0014 129.3018 ++ 332.581352 m 0.0014 96 | 6/12
7 h-m-p 0.0000 0.0000 4299.5970 ++ 331.314290 m 0.0000 111 | 7/12
8 h-m-p 0.0285 3.4896 1.3358 --------------.. | 7/12
9 h-m-p 0.0000 0.0001 80.0349 ++ 330.506585 m 0.0001 153 | 8/12
10 h-m-p 0.3572 8.0000 0.0000 +++ 330.506585 m 8.0000 169 | 8/12
11 h-m-p 0.0160 8.0000 0.0587 --------Y 330.506585 0 0.0000 196 | 8/12
12 h-m-p 0.0160 8.0000 0.0001 +++++ 330.506585 m 8.0000 218 | 8/12
13 h-m-p 0.0160 8.0000 1.7312 ----------N 330.506585 0 0.0000 247 | 8/12
14 h-m-p 0.0160 8.0000 0.0000 +++++ 330.506585 m 8.0000 265 | 8/12
15 h-m-p 0.0160 8.0000 0.1695 ++++C 330.506583 0 4.3057 288 | 8/12
16 h-m-p 1.6000 8.0000 0.0006 ----------------.. | 8/12
17 h-m-p 0.0160 8.0000 0.0000 +++++ 330.506583 m 8.0000 343 | 8/12
18 h-m-p 0.0160 8.0000 1.2905 -------------.. | 8/12
19 h-m-p 0.0160 8.0000 0.0000 +++++ 330.506583 m 8.0000 391 | 8/12
20 h-m-p 0.0138 6.9014 0.4760 +++++ 330.506371 m 6.9014 413 | 9/12
21 h-m-p 0.2986 8.0000 9.5493 --------------C 330.506371 0 0.0000 446 | 9/12
22 h-m-p 0.0160 8.0000 0.0004 +++++ 330.506371 m 8.0000 464 | 9/12
23 h-m-p 0.0044 2.2040 1.2506 +++++ 330.506331 m 2.2040 485 | 10/12
24 h-m-p 1.6000 8.0000 0.0000 N 330.506331 0 1.6000 500 | 10/12
25 h-m-p 0.0160 8.0000 0.0000 Y 330.506331 0 0.0160 517
Out..
lnL = -330.506331
518 lfun, 2072 eigenQcodon, 9324 P(t)
Time used: 0:07
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.075900 0.075955 0.077640 0.045323 0.026359 0.105238 0.000100 0.951353 1.184473
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.539296
np = 9
lnL0 = -361.166002
Iterating by ming2
Initial: fx= 361.166002
x= 0.07590 0.07596 0.07764 0.04532 0.02636 0.10524 0.00011 0.95135 1.18447
1 h-m-p 0.0000 0.0000 174.3913 ++ 361.084069 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0149 35.4725 +++++ 346.637280 m 0.0149 29 | 2/9
3 h-m-p 0.0003 0.0014 25.8763 ++ 343.620505 m 0.0014 41 | 3/9
4 h-m-p 0.0002 0.0026 147.0414 ++ 335.090586 m 0.0026 53 | 4/9
5 h-m-p 0.0000 0.0000 825.4720 ++ 335.087167 m 0.0000 65 | 5/9
6 h-m-p 0.0000 0.0001 50.5416 ++ 334.816476 m 0.0001 77 | 6/9
7 h-m-p 0.0005 0.2488 1.9840 -----------.. | 6/9
8 h-m-p 0.0000 0.0009 69.2888 ++++ 330.506424 m 0.0009 112 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 330.506424 m 8.0000 124 | 7/9
10 h-m-p 0.0160 8.0000 0.0738 ----------Y 330.506424 0 0.0000 148 | 7/9
11 h-m-p 0.0160 8.0000 0.0000 +++++ 330.506424 m 8.0000 165 | 7/9
12 h-m-p 0.0115 5.7400 1.0312 ++++
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
+ 330.506331 m 5.7400 182
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.239744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130459e-161 2000 rounds
| 8/9
13 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
N 330.506331 0 1.6000 194
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.239744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07469) = 3.130353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07424) = 3.130568e-161 2000 rounds
| 8/9
14 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
N 330.506331 0 0.0160 207
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
Out..
lnL = -330.506331
208 lfun, 2288 eigenQcodon, 12480 P(t)
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.07447) = 3.130460e-161 2000 rounds
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.043756 0.096198 0.050777 0.106593 0.021082 0.020779 0.000100 0.900000 0.215585 1.448690 1.299919
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 26.313275
np = 11
lnL0 = -352.705543
Iterating by ming2
Initial: fx= 352.705543
x= 0.04376 0.09620 0.05078 0.10659 0.02108 0.02078 0.00011 0.90000 0.21559 1.44869 1.29992
1 h-m-p 0.0000 0.0000 137.7884 ++ 352.682013 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0017 77.8703 ++++ 344.683233 m 0.0017 32 | 2/11
3 h-m-p 0.0000 0.0000 152.0976 ++ 344.593853 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0003 442.9817 +++ 339.600789 m 0.0003 61 | 4/11
5 h-m-p 0.0003 0.0013 110.4677 ++ 331.862013 m 0.0013 75 | 5/11
6 h-m-p 0.0005 0.0027 13.1941 ++ 331.488369 m 0.0027 89 | 6/11
7 h-m-p 0.0000 0.0001 370.6996 ++ 330.671699 m 0.0001 103 | 7/11
8 h-m-p 0.0014 0.0196 26.7172 -----------.. | 7/11
9 h-m-p 0.0000 0.0000 77.5763 ++ 330.506507 m 0.0000 140 | 8/11
10 h-m-p 0.2858 8.0000 0.0000 +++ 330.506507 m 8.0000 155 | 8/11
11 h-m-p 0.0177 8.0000 0.0020 +++++ 330.506507 m 8.0000 175 | 8/11
12 h-m-p 0.1448 8.0000 0.1085 ---------Y 330.506507 0 0.0000 201 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 330.506507 m 8.0000 221 | 8/11
14 h-m-p 0.0160 8.0000 0.1126 ---------N 330.506507 0 0.0000 247 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 330.506507 m 8.0000 267 | 8/11
16 h-m-p 0.0160 8.0000 0.1219 ---------C 330.506507 0 0.0000 293 | 8/11
17 h-m-p 0.0160 8.0000 0.0000 -------Y 330.506507 0 0.0000 317 | 8/11
18 h-m-p 0.0160 8.0000 0.0000 +++++ 330.506507 m 8.0000 337 | 8/11
19 h-m-p 0.0160 8.0000 0.2701 ----------Y 330.506507 0 0.0000 364 | 8/11
20 h-m-p 0.0160 8.0000 0.0000 +++++ 330.506507 m 8.0000 384 | 8/11
21 h-m-p 0.0134 6.6895 0.6450 -------------.. | 8/11
22 h-m-p 0.0160 8.0000 0.0005 +++++ 330.506505 m 8.0000 432 | 8/11
23 h-m-p 0.0291 6.3549 0.1347 --------------.. | 8/11
24 h-m-p 0.0160 8.0000 0.0005 +++++ 330.506503 m 8.0000 481 | 8/11
25 h-m-p 0.0304 6.4793 0.1327 --------------.. | 8/11
26 h-m-p 0.0160 8.0000 0.0005 +++++ 330.506501 m 8.0000 530 | 8/11
27 h-m-p 0.0319 6.6114 0.1307 ------------Y 330.506501 0 0.0000 559 | 8/11
28 h-m-p 0.0160 8.0000 0.0027 +++++ 330.506489 m 8.0000 579 | 8/11
29 h-m-p 0.1389 6.4484 0.1579 --------------N 330.506489 0 0.0000 610 | 8/11
30 h-m-p 0.0000 0.0000 15457534.3288 ++ 330.506331 m 0.0000 627 | 9/11
31 h-m-p 1.6000 8.0000 0.0001 ++ 330.506331 m 8.0000 641 | 9/11
32 h-m-p 1.6000 8.0000 0.0003 ++ 330.506331 m 8.0000 657 | 9/11
33 h-m-p 0.0617 8.0000 0.0423 ++++ 330.506331 m 8.0000 675 | 9/11
34 h-m-p 0.0390 8.0000 8.6861 ---------Y 330.506331 0 0.0000 700 | 9/11
35 h-m-p 0.6961 8.0000 0.0000 ++ 330.506331 m 8.0000 714 | 9/11
36 h-m-p 1.6000 8.0000 0.0000 +N 330.506331 0 6.4000 731 | 9/11
37 h-m-p 0.0167 8.0000 0.0006 +++++ 330.506331 m 8.0000 750 | 9/11
38 h-m-p 0.0086 0.0430 0.1002 ++ 330.506331 m 0.0430 766 | 10/11
39 h-m-p 0.2857 8.0000 0.0000 +Y 330.506331 0 1.1429 783 | 10/11
40 h-m-p 0.0769 8.0000 0.0000 ---Y 330.506331 0 0.0003 801
Out..
lnL = -330.506331
802 lfun, 9624 eigenQcodon, 52932 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -330.546624 S = -330.506957 -0.017536
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 45 patterns 0:23
did 20 / 45 patterns 0:23
did 30 / 45 patterns 0:23
did 40 / 45 patterns 0:23
did 45 / 45 patterns 0:24
Time used: 0:24
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=83
NC_011896_1_WP_010908750_1_2327_MLBR_RS11025 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
NC_002677_1_NP_302430_1_1302_ML2178 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
NZ_LVXE01000030_1_WP_010908750_1_1396_A3216_RS08850 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
NZ_LYPH01000066_1_WP_010908750_1_2325_A8144_RS11145 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
NZ_CP029543_1_WP_010908750_1_2345_DIJ64_RS11925 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
NZ_AP014567_1_WP_010908750_1_2412_JK2ML_RS12260 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG
**************************************************
NC_011896_1_WP_010908750_1_2327_MLBR_RS11025 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
NC_002677_1_NP_302430_1_1302_ML2178 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
NZ_LVXE01000030_1_WP_010908750_1_1396_A3216_RS08850 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
NZ_LYPH01000066_1_WP_010908750_1_2325_A8144_RS11145 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
NZ_CP029543_1_WP_010908750_1_2345_DIJ64_RS11925 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
NZ_AP014567_1_WP_010908750_1_2412_JK2ML_RS12260 ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
*********************************
>NC_011896_1_WP_010908750_1_2327_MLBR_RS11025 ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG >NC_002677_1_NP_302430_1_1302_ML2178 ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG >NZ_LVXE01000030_1_WP_010908750_1_1396_A3216_RS08850 ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG >NZ_LYPH01000066_1_WP_010908750_1_2325_A8144_RS11145 ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG >NZ_CP029543_1_WP_010908750_1_2345_DIJ64_RS11925 ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG >NZ_AP014567_1_WP_010908750_1_2412_JK2ML_RS12260 ATGTCGTGGGAGAAATTTGCTTCGGATGGGAAAAGGCATAGTGGCGGTCC TCCGCTACACTGCACCTATTGTGCTAGGCACCTCATCGATGCACTACTTC CTAAGATTCCTAAGAGCATCGATGATTCTGACTGGATCATCGATGTCGGT GAGCGTGGTTGGGTAGTTATCACGAATTACAAGCGCATCCGGATTAGCTC TATTGAGGTGCAAATGTTGATCGAACACCATCTGAAGGTGGTTCATTTG
>NC_011896_1_WP_010908750_1_2327_MLBR_RS11025 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL >NC_002677_1_NP_302430_1_1302_ML2178 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL >NZ_LVXE01000030_1_WP_010908750_1_1396_A3216_RS08850 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL >NZ_LYPH01000066_1_WP_010908750_1_2325_A8144_RS11145 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL >NZ_CP029543_1_WP_010908750_1_2345_DIJ64_RS11925 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL >NZ_AP014567_1_WP_010908750_1_2412_JK2ML_RS12260 MSWEKFASDGKRHSGGPPLHCTYCARHLIDALLPKIPKSIDDSDWIIDVG ERGWVVITNYKRIRISSIEVQMLIEHHLKVVHL
#NEXUS
[ID: 5720264416]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908750_1_2327_MLBR_RS11025
NC_002677_1_NP_302430_1_1302_ML2178
NZ_LVXE01000030_1_WP_010908750_1_1396_A3216_RS08850
NZ_LYPH01000066_1_WP_010908750_1_2325_A8144_RS11145
NZ_CP029543_1_WP_010908750_1_2345_DIJ64_RS11925
NZ_AP014567_1_WP_010908750_1_2412_JK2ML_RS12260
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908750_1_2327_MLBR_RS11025,
2 NC_002677_1_NP_302430_1_1302_ML2178,
3 NZ_LVXE01000030_1_WP_010908750_1_1396_A3216_RS08850,
4 NZ_LYPH01000066_1_WP_010908750_1_2325_A8144_RS11145,
5 NZ_CP029543_1_WP_010908750_1_2345_DIJ64_RS11925,
6 NZ_AP014567_1_WP_010908750_1_2412_JK2ML_RS12260
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06558479,2:0.06801305,3:0.0657174,4:0.06664024,5:0.06803832,6:0.07511538);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06558479,2:0.06801305,3:0.0657174,4:0.06664024,5:0.06803832,6:0.07511538);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -345.32 -349.68
2 -345.30 -348.75
--------------------------------------
TOTAL -345.31 -349.32
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2178/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.885705 0.092484 0.338404 1.464076 0.855680 627.84 689.42 1.000
r(A<->C){all} 0.184728 0.022356 0.000016 0.479051 0.144886 61.30 72.02 0.999
r(A<->G){all} 0.145308 0.015846 0.000053 0.405833 0.109802 99.17 191.21 1.000
r(A<->T){all} 0.170039 0.018241 0.000108 0.435959 0.139657 42.34 57.12 1.013
r(C<->G){all} 0.174342 0.020047 0.000039 0.467396 0.138761 45.41 98.09 0.999
r(C<->T){all} 0.168198 0.021004 0.000554 0.468900 0.128542 87.99 95.87 1.018
r(G<->T){all} 0.157386 0.018794 0.000142 0.428352 0.120143 80.58 98.07 0.999
pi(A){all} 0.241811 0.000699 0.191487 0.295980 0.241242 634.18 654.45 1.000
pi(C){all} 0.209655 0.000649 0.160903 0.261671 0.208761 667.78 692.99 0.999
pi(G){all} 0.268161 0.000753 0.212079 0.320966 0.268145 624.88 670.87 1.001
pi(T){all} 0.280373 0.000814 0.227532 0.336602 0.280500 528.68 610.80 1.000
alpha{1,2} 0.408676 0.204578 0.000219 1.285184 0.261923 450.04 499.05 1.001
alpha{3} 0.454787 0.234482 0.000347 1.396780 0.299020 601.72 676.36 1.000
pinvar{all} 0.993636 0.000061 0.978982 0.999994 0.996183 702.50 726.75 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML2178/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 83
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 3 3 3 3 3 3 | His CAT 3 3 3 3 3 3 | Arg CGT 1 1 1 1 1 1
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 3 3 3 3 3 3 | CGC 1 1 1 1 1 1
CTA 2 2 2 2 2 2 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 1 1 1 1 1 1 | CCG 1 1 1 1 1 1 | CAG 0 0 0 0 0 0 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 7 7 7 7 7 7 | ACC 1 1 1 1 1 1 | AAC 0 0 0 0 0 0 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 1 1 1 1 1 1 | AAG 4 4 4 4 4 4 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 2 2 2 2 2 2 | Asp GAT 5 5 5 5 5 5 | Gly GGT 3 3 3 3 3 3
GTC 1 1 1 1 1 1 | GCC 0 0 0 0 0 0 | GAC 1 1 1 1 1 1 | GGC 1 1 1 1 1 1
GTA 1 1 1 1 1 1 | GCA 1 1 1 1 1 1 | Glu GAA 1 1 1 1 1 1 | GGA 0 0 0 0 0 0
GTG 2 2 2 2 2 2 | GCG 0 0 0 0 0 0 | GAG 3 3 3 3 3 3 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908750_1_2327_MLBR_RS11025
position 1: T:0.16867 C:0.22892 A:0.31325 G:0.28916
position 2: T:0.31325 C:0.15663 A:0.31325 G:0.21687
position 3: T:0.36145 C:0.24096 A:0.09639 G:0.30120
Average T:0.28112 C:0.20884 A:0.24096 G:0.26908
#2: NC_002677_1_NP_302430_1_1302_ML2178
position 1: T:0.16867 C:0.22892 A:0.31325 G:0.28916
position 2: T:0.31325 C:0.15663 A:0.31325 G:0.21687
position 3: T:0.36145 C:0.24096 A:0.09639 G:0.30120
Average T:0.28112 C:0.20884 A:0.24096 G:0.26908
#3: NZ_LVXE01000030_1_WP_010908750_1_1396_A3216_RS08850
position 1: T:0.16867 C:0.22892 A:0.31325 G:0.28916
position 2: T:0.31325 C:0.15663 A:0.31325 G:0.21687
position 3: T:0.36145 C:0.24096 A:0.09639 G:0.30120
Average T:0.28112 C:0.20884 A:0.24096 G:0.26908
#4: NZ_LYPH01000066_1_WP_010908750_1_2325_A8144_RS11145
position 1: T:0.16867 C:0.22892 A:0.31325 G:0.28916
position 2: T:0.31325 C:0.15663 A:0.31325 G:0.21687
position 3: T:0.36145 C:0.24096 A:0.09639 G:0.30120
Average T:0.28112 C:0.20884 A:0.24096 G:0.26908
#5: NZ_CP029543_1_WP_010908750_1_2345_DIJ64_RS11925
position 1: T:0.16867 C:0.22892 A:0.31325 G:0.28916
position 2: T:0.31325 C:0.15663 A:0.31325 G:0.21687
position 3: T:0.36145 C:0.24096 A:0.09639 G:0.30120
Average T:0.28112 C:0.20884 A:0.24096 G:0.26908
#6: NZ_AP014567_1_WP_010908750_1_2412_JK2ML_RS12260
position 1: T:0.16867 C:0.22892 A:0.31325 G:0.28916
position 2: T:0.31325 C:0.15663 A:0.31325 G:0.21687
position 3: T:0.36145 C:0.24096 A:0.09639 G:0.30120
Average T:0.28112 C:0.20884 A:0.24096 G:0.26908
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 12 | Tyr Y TAT 6 | Cys C TGT 6
TTC 0 | TCC 0 | TAC 6 | TGC 6
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 12 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 18 | His H CAT 18 | Arg R CGT 6
CTC 6 | CCC 0 | CAC 18 | CGC 6
CTA 12 | CCA 0 | Gln Q CAA 6 | CGA 0
CTG 6 | CCG 6 | CAG 0 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 6
ATC 42 | ACC 6 | AAC 0 | AGC 12
ATA 0 | ACA 0 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 12 | ACG 6 | AAG 24 | AGG 12
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 12 | Asp D GAT 30 | Gly G GGT 18
GTC 6 | GCC 0 | GAC 6 | GGC 6
GTA 6 | GCA 6 | Glu E GAA 6 | GGA 0
GTG 12 | GCG 0 | GAG 18 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16867 C:0.22892 A:0.31325 G:0.28916
position 2: T:0.31325 C:0.15663 A:0.31325 G:0.21687
position 3: T:0.36145 C:0.24096 A:0.09639 G:0.30120
Average T:0.28112 C:0.20884 A:0.24096 G:0.26908
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -330.506603 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299970 1.299919
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908750_1_2327_MLBR_RS11025: 0.000004, NC_002677_1_NP_302430_1_1302_ML2178: 0.000004, NZ_LVXE01000030_1_WP_010908750_1_1396_A3216_RS08850: 0.000004, NZ_LYPH01000066_1_WP_010908750_1_2325_A8144_RS11145: 0.000004, NZ_CP029543_1_WP_010908750_1_2345_DIJ64_RS11925: 0.000004, NZ_AP014567_1_WP_010908750_1_2412_JK2ML_RS12260: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29997
omega (dN/dS) = 1.29992
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 209.1 39.9 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 209.1 39.9 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 209.1 39.9 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 209.1 39.9 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 209.1 39.9 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 209.1 39.9 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -330.506378 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.128259 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908750_1_2327_MLBR_RS11025: 0.000004, NC_002677_1_NP_302430_1_1302_ML2178: 0.000004, NZ_LVXE01000030_1_WP_010908750_1_1396_A3216_RS08850: 0.000004, NZ_LYPH01000066_1_WP_010908750_1_2325_A8144_RS11145: 0.000004, NZ_CP029543_1_WP_010908750_1_2345_DIJ64_RS11925: 0.000004, NZ_AP014567_1_WP_010908750_1_2412_JK2ML_RS12260: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.12826
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 212.1 36.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 212.1 36.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 212.1 36.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 212.1 36.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 212.1 36.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 212.1 36.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -330.506331 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908750_1_2327_MLBR_RS11025: 0.000004, NC_002677_1_NP_302430_1_1302_ML2178: 0.000004, NZ_LVXE01000030_1_WP_010908750_1_1396_A3216_RS08850: 0.000004, NZ_LYPH01000066_1_WP_010908750_1_2325_A8144_RS11145: 0.000004, NZ_CP029543_1_WP_010908750_1_2345_DIJ64_RS11925: 0.000004, NZ_AP014567_1_WP_010908750_1_2412_JK2ML_RS12260: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908750_1_2327_MLBR_RS11025)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 12): -330.506331 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000633 0.997013 0.000001 0.000001 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908750_1_2327_MLBR_RS11025: 0.000004, NC_002677_1_NP_302430_1_1302_ML2178: 0.000004, NZ_LVXE01000030_1_WP_010908750_1_1396_A3216_RS08850: 0.000004, NZ_LYPH01000066_1_WP_010908750_1_2325_A8144_RS11145: 0.000004, NZ_CP029543_1_WP_010908750_1_2345_DIJ64_RS11925: 0.000004, NZ_AP014567_1_WP_010908750_1_2412_JK2ML_RS12260: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00063 0.99701 0.00235
w: 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Time used: 0:07
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -330.506331 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 7.074467
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908750_1_2327_MLBR_RS11025: 0.000004, NC_002677_1_NP_302430_1_1302_ML2178: 0.000004, NZ_LVXE01000030_1_WP_010908750_1_1396_A3216_RS08850: 0.000004, NZ_LYPH01000066_1_WP_010908750_1_2325_A8144_RS11145: 0.000004, NZ_CP029543_1_WP_010908750_1_2345_DIJ64_RS11925: 0.000004, NZ_AP014567_1_WP_010908750_1_2412_JK2ML_RS12260: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 7.07447
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -330.506331 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.516165 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908750_1_2327_MLBR_RS11025: 0.000004, NC_002677_1_NP_302430_1_1302_ML2178: 0.000004, NZ_LVXE01000030_1_WP_010908750_1_1396_A3216_RS08850: 0.000004, NZ_LYPH01000066_1_WP_010908750_1_2325_A8144_RS11145: 0.000004, NZ_CP029543_1_WP_010908750_1_2345_DIJ64_RS11925: 0.000004, NZ_AP014567_1_WP_010908750_1_2412_JK2ML_RS12260: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.51616
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 214.7 34.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908750_1_2327_MLBR_RS11025)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.102 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Time used: 0:24
Model 1: NearlyNeutral -330.506378 Model 2: PositiveSelection -330.506331 Model 0: one-ratio -330.506603 Model 3: discrete -330.506331 Model 7: beta -330.506331 Model 8: beta&w>1 -330.506331 Model 0 vs 1 4.500000000007276E-4 Model 2 vs 1 9.399999999004649E-5 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
