--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:29:24 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/7res/ML1714/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/7res/ML1714/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1714/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/7res/ML1714/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2097.69 -2100.17 2 -2097.76 -2101.84 -------------------------------------- TOTAL -2097.73 -2101.32 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/7res/ML1714/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1714/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/7res/ML1714/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.903872 0.094112 0.362673 1.529470 0.877693 1501.00 1501.00 1.000 r(A<->C){all} 0.157930 0.018942 0.000136 0.432520 0.119771 179.68 208.04 1.000 r(A<->G){all} 0.176305 0.021010 0.000023 0.454258 0.140359 173.72 207.38 1.006 r(A<->T){all} 0.164485 0.018556 0.000099 0.430499 0.132127 217.38 234.07 1.002 r(C<->G){all} 0.170234 0.020266 0.000009 0.454585 0.130421 162.48 219.65 1.000 r(C<->T){all} 0.175834 0.021140 0.000178 0.466572 0.139171 234.33 245.81 1.000 r(G<->T){all} 0.155213 0.018015 0.000026 0.425565 0.117497 290.85 330.47 1.000 pi(A){all} 0.178158 0.000092 0.159935 0.196942 0.177966 1000.99 1232.35 1.000 pi(C){all} 0.337536 0.000138 0.314067 0.359840 0.337613 1159.15 1179.69 1.001 pi(G){all} 0.314940 0.000132 0.293407 0.338282 0.315035 1122.30 1249.43 1.001 pi(T){all} 0.169366 0.000089 0.150306 0.187238 0.169124 1018.33 1193.67 1.000 alpha{1,2} 0.433480 0.240705 0.000468 1.434224 0.263059 1043.14 1137.78 1.000 alpha{3} 0.462777 0.252837 0.000114 1.428542 0.293973 1094.11 1223.91 1.000 pinvar{all} 0.999093 0.000001 0.997078 1.000000 0.999424 1091.67 1158.31 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2035.157347 Model 2: PositiveSelection -2035.157196 Model 0: one-ratio -2035.15746 Model 7: beta -2035.157196 Model 8: beta&w>1 -2035.157335 Model 0 vs 1 2.2599999965677853E-4 Model 2 vs 1 3.019999999196443E-4 Model 8 vs 7 2.779999999802385E-4
>C1 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ LADGWNRADGLFGALDARRLPR >C2 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ LADGWNRADGLFGALDARRLPR >C3 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ LADGWNRADGLFGALDARRLPR >C4 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ LADGWNRADGLFGALDARRLPR >C5 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ LADGWNRADGLFGALDARRLPR >C6 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ LADGWNRADGLFGALDARRLPR CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=522 C1 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV C2 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV C3 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV C4 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV C5 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV C6 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV ************************************************** C1 LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS C2 LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS C3 LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS C4 LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS C5 LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS C6 LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS ************************************************** C1 VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI C2 VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI C3 VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI C4 VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI C5 VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI C6 VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI ************************************************** C1 DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP C2 DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP C3 DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP C4 DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP C5 DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP C6 DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP ************************************************** C1 ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ C2 ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ C3 ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ C4 ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ C5 ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ C6 ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ ************************************************** C1 VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP C2 VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP C3 VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP C4 VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP C5 VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP C6 VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP ************************************************** C1 DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE C2 DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE C3 DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE C4 DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE C5 DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE C6 DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE ************************************************** C1 GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV C2 GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV C3 GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV C4 GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV C5 GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV C6 GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV ************************************************** C1 WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE C2 WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE C3 WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE C4 WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE C5 WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE C6 WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE ************************************************** C1 TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ C2 TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ C3 TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ C4 TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ C5 TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ C6 TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ ************************************************** C1 LADGWNRADGLFGALDARRLPR C2 LADGWNRADGLFGALDARRLPR C3 LADGWNRADGLFGALDARRLPR C4 LADGWNRADGLFGALDARRLPR C5 LADGWNRADGLFGALDARRLPR C6 LADGWNRADGLFGALDARRLPR ********************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 522 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 522 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15660] Library Relaxation: Multi_proc [96] Relaxation Summary: [15660]--->[15660] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.556 Mb, Max= 31.115 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV C2 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV C3 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV C4 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV C5 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV C6 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV ************************************************** C1 LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS C2 LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS C3 LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS C4 LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS C5 LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS C6 LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS ************************************************** C1 VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI C2 VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI C3 VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI C4 VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI C5 VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI C6 VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI ************************************************** C1 DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP C2 DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP C3 DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP C4 DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP C5 DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP C6 DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP ************************************************** C1 ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ C2 ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ C3 ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ C4 ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ C5 ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ C6 ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ ************************************************** C1 VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP C2 VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP C3 VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP C4 VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP C5 VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP C6 VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP ************************************************** C1 DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE C2 DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE C3 DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE C4 DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE C5 DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE C6 DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE ************************************************** C1 GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV C2 GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV C3 GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV C4 GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV C5 GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV C6 GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV ************************************************** C1 WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE C2 WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE C3 WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE C4 WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE C5 WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE C6 WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE ************************************************** C1 TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ C2 TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ C3 TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ C4 TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ C5 TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ C6 TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ ************************************************** C1 LADGWNRADGLFGALDARRLPR C2 LADGWNRADGLFGALDARRLPR C3 LADGWNRADGLFGALDARRLPR C4 LADGWNRADGLFGALDARRLPR C5 LADGWNRADGLFGALDARRLPR C6 LADGWNRADGLFGALDARRLPR ********************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAACACATCCGCAAACCCAGTGCCCGGTCTGTTCACCCTGGTGCTACA C2 ATGAACACATCCGCAAACCCAGTGCCCGGTCTGTTCACCCTGGTGCTACA C3 ATGAACACATCCGCAAACCCAGTGCCCGGTCTGTTCACCCTGGTGCTACA C4 ATGAACACATCCGCAAACCCAGTGCCCGGTCTGTTCACCCTGGTGCTACA C5 ATGAACACATCCGCAAACCCAGTGCCCGGTCTGTTCACCCTGGTGCTACA C6 ATGAACACATCCGCAAACCCAGTGCCCGGTCTGTTCACCCTGGTGCTACA ************************************************** C1 CACCCACTTGCCGTGGCTAGCCCACCACGGCCGCTGGCCGGTCGGTGAGG C2 CACCCACTTGCCGTGGCTAGCCCACCACGGCCGCTGGCCGGTCGGTGAGG C3 CACCCACTTGCCGTGGCTAGCCCACCACGGCCGCTGGCCGGTCGGTGAGG C4 CACCCACTTGCCGTGGCTAGCCCACCACGGCCGCTGGCCGGTCGGTGAGG C5 CACCCACTTGCCGTGGCTAGCCCACCACGGCCGCTGGCCGGTCGGTGAGG C6 CACCCACTTGCCGTGGCTAGCCCACCACGGCCGCTGGCCGGTCGGTGAGG ************************************************** C1 AATGGCTCTACCAATCGTGGGCCGCGGCCTACCTGCCGCTGCTGCAGGTG C2 AATGGCTCTACCAATCGTGGGCCGCGGCCTACCTGCCGCTGCTGCAGGTG C3 AATGGCTCTACCAATCGTGGGCCGCGGCCTACCTGCCGCTGCTGCAGGTG C4 AATGGCTCTACCAATCGTGGGCCGCGGCCTACCTGCCGCTGCTGCAGGTG C5 AATGGCTCTACCAATCGTGGGCCGCGGCCTACCTGCCGCTGCTGCAGGTG C6 AATGGCTCTACCAATCGTGGGCCGCGGCCTACCTGCCGCTGCTGCAGGTG ************************************************** C1 CTTCACACCCTAGCCGATGAAAATCGGCACCGGCTGATTACACTCGGGGT C2 CTTCACACCCTAGCCGATGAAAATCGGCACCGGCTGATTACACTCGGGGT C3 CTTCACACCCTAGCCGATGAAAATCGGCACCGGCTGATTACACTCGGGGT C4 CTTCACACCCTAGCCGATGAAAATCGGCACCGGCTGATTACACTCGGGGT C5 CTTCACACCCTAGCCGATGAAAATCGGCACCGGCTGATTACACTCGGGGT C6 CTTCACACCCTAGCCGATGAAAATCGGCACCGGCTGATTACACTCGGGGT ************************************************** C1 TACGCCGGTGGTGAACGCTCAACTCGACGACCCCTATTGTCTCGACGGTA C2 TACGCCGGTGGTGAACGCTCAACTCGACGACCCCTATTGTCTCGACGGTA C3 TACGCCGGTGGTGAACGCTCAACTCGACGACCCCTATTGTCTCGACGGTA C4 TACGCCGGTGGTGAACGCTCAACTCGACGACCCCTATTGTCTCGACGGTA C5 TACGCCGGTGGTGAACGCTCAACTCGACGACCCCTATTGTCTCGACGGTA C6 TACGCCGGTGGTGAACGCTCAACTCGACGACCCCTATTGTCTCGACGGTA ************************************************** C1 TGCATCACTGGCTGGCGAACTGGCGACTGCGCGCGACTGAAGCGGCCAGC C2 TGCATCACTGGCTGGCGAACTGGCGACTGCGCGCGACTGAAGCGGCCAGC C3 TGCATCACTGGCTGGCGAACTGGCGACTGCGCGCGACTGAAGCGGCCAGC C4 TGCATCACTGGCTGGCGAACTGGCGACTGCGCGCGACTGAAGCGGCCAGC C5 TGCATCACTGGCTGGCGAACTGGCGACTGCGCGCGACTGAAGCGGCCAGC C6 TGCATCACTGGCTGGCGAACTGGCGACTGCGCGCGACTGAAGCGGCCAGC ************************************************** C1 GTGCGGTCCGGTTCGGAGTCGAAGCCGGCGTGCGCACCGCAAGCATTGCG C2 GTGCGGTCCGGTTCGGAGTCGAAGCCGGCGTGCGCACCGCAAGCATTGCG C3 GTGCGGTCCGGTTCGGAGTCGAAGCCGGCGTGCGCACCGCAAGCATTGCG C4 GTGCGGTCCGGTTCGGAGTCGAAGCCGGCGTGCGCACCGCAAGCATTGCG C5 GTGCGGTCCGGTTCGGAGTCGAAGCCGGCGTGCGCACCGCAAGCATTGCG C6 GTGCGGTCCGGTTCGGAGTCGAAGCCGGCGTGCGCACCGCAAGCATTGCG ************************************************** C1 GGCCTTCGGAGCTCGCGAATGCATCGAGGCCCAGCGGGCACTCGAGTATT C2 GGCCTTCGGAGCTCGCGAATGCATCGAGGCCCAGCGGGCACTCGAGTATT C3 GGCCTTCGGAGCTCGCGAATGCATCGAGGCCCAGCGGGCACTCGAGTATT C4 GGCCTTCGGAGCTCGCGAATGCATCGAGGCCCAGCGGGCACTCGAGTATT C5 GGCCTTCGGAGCTCGCGAATGCATCGAGGCCCAGCGGGCACTCGAGTATT C6 GGCCTTCGGAGCTCGCGAATGCATCGAGGCCCAGCGGGCACTCGAGTATT ************************************************** C1 TCGCTACTCTGTGGCGTCACGGCGGCAGCCCGCTACTGCGCAGCCTAATC C2 TCGCTACTCTGTGGCGTCACGGCGGCAGCCCGCTACTGCGCAGCCTAATC C3 TCGCTACTCTGTGGCGTCACGGCGGCAGCCCGCTACTGCGCAGCCTAATC C4 TCGCTACTCTGTGGCGTCACGGCGGCAGCCCGCTACTGCGCAGCCTAATC C5 TCGCTACTCTGTGGCGTCACGGCGGCAGCCCGCTACTGCGCAGCCTAATC C6 TCGCTACTCTGTGGCGTCACGGCGGCAGCCCGCTACTGCGCAGCCTAATC ************************************************** C1 GACGCCGGGACGGTCGAACTGCTTGGCGGCCCGTTGGCCCACCCATTCCA C2 GACGCCGGGACGGTCGAACTGCTTGGCGGCCCGTTGGCCCACCCATTCCA C3 GACGCCGGGACGGTCGAACTGCTTGGCGGCCCGTTGGCCCACCCATTCCA C4 GACGCCGGGACGGTCGAACTGCTTGGCGGCCCGTTGGCCCACCCATTCCA C5 GACGCCGGGACGGTCGAACTGCTTGGCGGCCCGTTGGCCCACCCATTCCA C6 GACGCCGGGACGGTCGAACTGCTTGGCGGCCCGTTGGCCCACCCATTCCA ************************************************** C1 ACCGCTTATCGCGCCGCGGCTGCGCGAGTTCGCGCTACACGAAGGCCTGG C2 ACCGCTTATCGCGCCGCGGCTGCGCGAGTTCGCGCTACACGAAGGCCTGG C3 ACCGCTTATCGCGCCGCGGCTGCGCGAGTTCGCGCTACACGAAGGCCTGG C4 ACCGCTTATCGCGCCGCGGCTGCGCGAGTTCGCGCTACACGAAGGCCTGG C5 ACCGCTTATCGCGCCGCGGCTGCGCGAGTTCGCGCTACACGAAGGCCTGG C6 ACCGCTTATCGCGCCGCGGCTGCGCGAGTTCGCGCTACACGAAGGCCTGG ************************************************** C1 ATGACGCGTGGCTGCGGCTGGCGCACCGGCCAACCGGCATATGGGCGCCG C2 ATGACGCGTGGCTGCGGCTGGCGCACCGGCCAACCGGCATATGGGCGCCG C3 ATGACGCGTGGCTGCGGCTGGCGCACCGGCCAACCGGCATATGGGCGCCG C4 ATGACGCGTGGCTGCGGCTGGCGCACCGGCCAACCGGCATATGGGCGCCG C5 ATGACGCGTGGCTGCGGCTGGCGCACCGGCCAACCGGCATATGGGCGCCG C6 ATGACGCGTGGCTGCGGCTGGCGCACCGGCCAACCGGCATATGGGCGCCG ************************************************** C1 GAATGCGCCTACGCCCCAGGGATGGAACACGACTACTCGGCCGCGGGCAT C2 GAATGCGCCTACGCCCCAGGGATGGAACACGACTACTCGGCCGCGGGCAT C3 GAATGCGCCTACGCCCCAGGGATGGAACACGACTACTCGGCCGCGGGCAT C4 GAATGCGCCTACGCCCCAGGGATGGAACACGACTACTCGGCCGCGGGCAT C5 GAATGCGCCTACGCCCCAGGGATGGAACACGACTACTCGGCCGCGGGCAT C6 GAATGCGCCTACGCCCCAGGGATGGAACACGACTACTCGGCCGCGGGCAT ************************************************** C1 CACTCACTTCATGGTCGACGGTCCGTCACTGCACGGCGACACCGCACTGG C2 CACTCACTTCATGGTCGACGGTCCGTCACTGCACGGCGACACCGCACTGG C3 CACTCACTTCATGGTCGACGGTCCGTCACTGCACGGCGACACCGCACTGG C4 CACTCACTTCATGGTCGACGGTCCGTCACTGCACGGCGACACCGCACTGG C5 CACTCACTTCATGGTCGACGGTCCGTCACTGCACGGCGACACCGCACTGG C6 CACTCACTTCATGGTCGACGGTCCGTCACTGCACGGCGACACCGCACTGG ************************************************** C1 GCCGACCAGTTGGCGACACCGCCGTGGTCGCGTTCGGGCGTGACTTGCAG C2 GCCGACCAGTTGGCGACACCGCCGTGGTCGCGTTCGGGCGTGACTTGCAG C3 GCCGACCAGTTGGCGACACCGCCGTGGTCGCGTTCGGGCGTGACTTGCAG C4 GCCGACCAGTTGGCGACACCGCCGTGGTCGCGTTCGGGCGTGACTTGCAG C5 GCCGACCAGTTGGCGACACCGCCGTGGTCGCGTTCGGGCGTGACTTGCAG C6 GCCGACCAGTTGGCGACACCGCCGTGGTCGCGTTCGGGCGTGACTTGCAG ************************************************** C1 GTCAGCTACCGGGTGTGGTCGCCGAAATCTGGCTATCCGGGACATGCCGC C2 GTCAGCTACCGGGTGTGGTCGCCGAAATCTGGCTATCCGGGACATGCCGC C3 GTCAGCTACCGGGTGTGGTCGCCGAAATCTGGCTATCCGGGACATGCCGC C4 GTCAGCTACCGGGTGTGGTCGCCGAAATCTGGCTATCCGGGACATGCCGC C5 GTCAGCTACCGGGTGTGGTCGCCGAAATCTGGCTATCCGGGACATGCCGC C6 GTCAGCTACCGGGTGTGGTCGCCGAAATCTGGCTATCCGGGACATGCCGC ************************************************** C1 CTACCGCGATTTCCACACCTACGACCACCTCACCGGTCTCAAACCGGCCA C2 CTACCGCGATTTCCACACCTACGACCACCTCACCGGTCTCAAACCGGCCA C3 CTACCGCGATTTCCACACCTACGACCACCTCACCGGTCTCAAACCGGCCA C4 CTACCGCGATTTCCACACCTACGACCACCTCACCGGTCTCAAACCGGCCA C5 CTACCGCGATTTCCACACCTACGACCACCTCACCGGTCTCAAACCGGCCA C6 CTACCGCGATTTCCACACCTACGACCACCTCACCGGTCTCAAACCGGCCA ************************************************** C1 GAGTCACCGGGTGCAACGTGCCGTCTGAGGCCAAGGCGCCCTACGATCCC C2 GAGTCACCGGGTGCAACGTGCCGTCTGAGGCCAAGGCGCCCTACGATCCC C3 GAGTCACCGGGTGCAACGTGCCGTCTGAGGCCAAGGCGCCCTACGATCCC C4 GAGTCACCGGGTGCAACGTGCCGTCTGAGGCCAAGGCGCCCTACGATCCC C5 GAGTCACCGGGTGCAACGTGCCGTCTGAGGCCAAGGCGCCCTACGATCCC C6 GAGTCACCGGGTGCAACGTGCCGTCTGAGGCCAAGGCGCCCTACGATCCC ************************************************** C1 GACCACGCCGACAAAGTCGTCGACGCCCATGTAGACGACTTTGTCGGCGT C2 GACCACGCCGACAAAGTCGTCGACGCCCATGTAGACGACTTTGTCGGCGT C3 GACCACGCCGACAAAGTCGTCGACGCCCATGTAGACGACTTTGTCGGCGT C4 GACCACGCCGACAAAGTCGTCGACGCCCATGTAGACGACTTTGTCGGCGT C5 GACCACGCCGACAAAGTCGTCGACGCCCATGTAGACGACTTTGTCGGCGT C6 GACCACGCCGACAAAGTCGTCGACGCCCATGTAGACGACTTTGTCGGCGT ************************************************** C1 GGTCCGCAACCGGCTCTTCACCGAGTCCGAGCGCATCGGGCGGCCCGCTC C2 GGTCCGCAACCGGCTCTTCACCGAGTCCGAGCGCATCGGGCGGCCCGCTC C3 GGTCCGCAACCGGCTCTTCACCGAGTCCGAGCGCATCGGGCGGCCCGCTC C4 GGTCCGCAACCGGCTCTTCACCGAGTCCGAGCGCATCGGGCGGCCCGCTC C5 GGTCCGCAACCGGCTCTTCACCGAGTCCGAGCGCATCGGGCGGCCCGCTC C6 GGTCCGCAACCGGCTCTTCACCGAGTCCGAGCGCATCGGGCGGCCCGCTC ************************************************** C1 ACGTGGTCGCCGCCTTCGATACTGAGTTGTTCGGCCATTGGTGGTACGAG C2 ACGTGGTCGCCGCCTTCGATACTGAGTTGTTCGGCCATTGGTGGTACGAG C3 ACGTGGTCGCCGCCTTCGATACTGAGTTGTTCGGCCATTGGTGGTACGAG C4 ACGTGGTCGCCGCCTTCGATACTGAGTTGTTCGGCCATTGGTGGTACGAG C5 ACGTGGTCGCCGCCTTCGATACTGAGTTGTTCGGCCATTGGTGGTACGAG C6 ACGTGGTCGCCGCCTTCGATACTGAGTTGTTCGGCCATTGGTGGTACGAG ************************************************** C1 GGGCCGATCTGGCTGCAGCGGGTGCTGCGCGCCTTGCCCACCGCCGGGGT C2 GGGCCGATCTGGCTGCAGCGGGTGCTGCGCGCCTTGCCCACCGCCGGGGT C3 GGGCCGATCTGGCTGCAGCGGGTGCTGCGCGCCTTGCCCACCGCCGGGGT C4 GGGCCGATCTGGCTGCAGCGGGTGCTGCGCGCCTTGCCCACCGCCGGGGT C5 GGGCCGATCTGGCTGCAGCGGGTGCTGCGCGCCTTGCCCACCGCCGGGGT C6 GGGCCGATCTGGCTGCAGCGGGTGCTGCGCGCCTTGCCCACCGCCGGGGT ************************************************** C1 GCGAGTGGGCACACTTAGCGACGCCCTAGCGGGCGGGTTCGTCGGCAATA C2 GCGAGTGGGCACACTTAGCGACGCCCTAGCGGGCGGGTTCGTCGGCAATA C3 GCGAGTGGGCACACTTAGCGACGCCCTAGCGGGCGGGTTCGTCGGCAATA C4 GCGAGTGGGCACACTTAGCGACGCCCTAGCGGGCGGGTTCGTCGGCAATA C5 GCGAGTGGGCACACTTAGCGACGCCCTAGCGGGCGGGTTCGTCGGCAATA C6 GCGAGTGGGCACACTTAGCGACGCCCTAGCGGGCGGGTTCGTCGGCAATA ************************************************** C1 CAGTTACGTTGCCACCCAGCTCGTGGGGGTCCGGTAAGGACTGGCAAGTG C2 CAGTTACGTTGCCACCCAGCTCGTGGGGGTCCGGTAAGGACTGGCAAGTG C3 CAGTTACGTTGCCACCCAGCTCGTGGGGGTCCGGTAAGGACTGGCAAGTG C4 CAGTTACGTTGCCACCCAGCTCGTGGGGGTCCGGTAAGGACTGGCAAGTG C5 CAGTTACGTTGCCACCCAGCTCGTGGGGGTCCGGTAAGGACTGGCAAGTG C6 CAGTTACGTTGCCACCCAGCTCGTGGGGGTCCGGTAAGGACTGGCAAGTG ************************************************** C1 TGGGCCGGCGACAAAGTCGCTGATCTGGTTCAGCTCAACAATGAGGTAGT C2 TGGGCCGGCGACAAAGTCGCTGATCTGGTTCAGCTCAACAATGAGGTAGT C3 TGGGCCGGCGACAAAGTCGCTGATCTGGTTCAGCTCAACAATGAGGTAGT C4 TGGGCCGGCGACAAAGTCGCTGATCTGGTTCAGCTCAACAATGAGGTAGT C5 TGGGCCGGCGACAAAGTCGCTGATCTGGTTCAGCTCAACAATGAGGTAGT C6 TGGGCCGGCGACAAAGTCGCTGATCTGGTTCAGCTCAACAATGAGGTAGT ************************************************** C1 CGACACAGCGCTGACCACAGTCGATAAAGTGCTAGCACAGACGACATCAC C2 CGACACAGCGCTGACCACAGTCGATAAAGTGCTAGCACAGACGACATCAC C3 CGACACAGCGCTGACCACAGTCGATAAAGTGCTAGCACAGACGACATCAC C4 CGACACAGCGCTGACCACAGTCGATAAAGTGCTAGCACAGACGACATCAC C5 CGACACAGCGCTGACCACAGTCGATAAAGTGCTAGCACAGACGACATCAC C6 CGACACAGCGCTGACCACAGTCGATAAAGTGCTAGCACAGACGACATCAC ************************************************** C1 TGGATGGACTTCTCCCTCGCAATCACGTCGCCGACCAACTCCTGCGCGAA C2 TGGATGGACTTCTCCCTCGCAATCACGTCGCCGACCAACTCCTGCGCGAA C3 TGGATGGACTTCTCCCTCGCAATCACGTCGCCGACCAACTCCTGCGCGAA C4 TGGATGGACTTCTCCCTCGCAATCACGTCGCCGACCAACTCCTGCGCGAA C5 TGGATGGACTTCTCCCTCGCAATCACGTCGCCGACCAACTCCTGCGCGAA C6 TGGATGGACTTCTCCCTCGCAATCACGTCGCCGACCAACTCCTGCGCGAA ************************************************** C1 ACGCTGCTCACCGTATCAAGTGACTGGCCATTCATGGTGAGCAAGGATTC C2 ACGCTGCTCACCGTATCAAGTGACTGGCCATTCATGGTGAGCAAGGATTC C3 ACGCTGCTCACCGTATCAAGTGACTGGCCATTCATGGTGAGCAAGGATTC C4 ACGCTGCTCACCGTATCAAGTGACTGGCCATTCATGGTGAGCAAGGATTC C5 ACGCTGCTCACCGTATCAAGTGACTGGCCATTCATGGTGAGCAAGGATTC C6 ACGCTGCTCACCGTATCAAGTGACTGGCCATTCATGGTGAGCAAGGATTC ************************************************** C1 AGCCGCCGACTACGCCAGGTACCGTGCCCACCTGCATGCCCACGCCACAC C2 AGCCGCCGACTACGCCAGGTACCGTGCCCACCTGCATGCCCACGCCACAC C3 AGCCGCCGACTACGCCAGGTACCGTGCCCACCTGCATGCCCACGCCACAC C4 AGCCGCCGACTACGCCAGGTACCGTGCCCACCTGCATGCCCACGCCACAC C5 AGCCGCCGACTACGCCAGGTACCGTGCCCACCTGCATGCCCACGCCACAC C6 AGCCGCCGACTACGCCAGGTACCGTGCCCACCTGCATGCCCACGCCACAC ************************************************** C1 GGGAGATCGCGGGAGCGCTGGCATCGGGCCGACGTGACACCGCGGCGCAA C2 GGGAGATCGCGGGAGCGCTGGCATCGGGCCGACGTGACACCGCGGCGCAA C3 GGGAGATCGCGGGAGCGCTGGCATCGGGCCGACGTGACACCGCGGCGCAA C4 GGGAGATCGCGGGAGCGCTGGCATCGGGCCGACGTGACACCGCGGCGCAA C5 GGGAGATCGCGGGAGCGCTGGCATCGGGCCGACGTGACACCGCGGCGCAA C6 GGGAGATCGCGGGAGCGCTGGCATCGGGCCGACGTGACACCGCGGCGCAA ************************************************** C1 CTGGCGGACGGATGGAACCGCGCCGACGGTCTGTTCGGCGCACTGGACGC C2 CTGGCGGACGGATGGAACCGCGCCGACGGTCTGTTCGGCGCACTGGACGC C3 CTGGCGGACGGATGGAACCGCGCCGACGGTCTGTTCGGCGCACTGGACGC C4 CTGGCGGACGGATGGAACCGCGCCGACGGTCTGTTCGGCGCACTGGACGC C5 CTGGCGGACGGATGGAACCGCGCCGACGGTCTGTTCGGCGCACTGGACGC C6 CTGGCGGACGGATGGAACCGCGCCGACGGTCTGTTCGGCGCACTGGACGC ************************************************** C1 CCGAAGGCTGCCCCGG C2 CCGAAGGCTGCCCCGG C3 CCGAAGGCTGCCCCGG C4 CCGAAGGCTGCCCCGG C5 CCGAAGGCTGCCCCGG C6 CCGAAGGCTGCCCCGG **************** >C1 ATGAACACATCCGCAAACCCAGTGCCCGGTCTGTTCACCCTGGTGCTACA CACCCACTTGCCGTGGCTAGCCCACCACGGCCGCTGGCCGGTCGGTGAGG AATGGCTCTACCAATCGTGGGCCGCGGCCTACCTGCCGCTGCTGCAGGTG CTTCACACCCTAGCCGATGAAAATCGGCACCGGCTGATTACACTCGGGGT TACGCCGGTGGTGAACGCTCAACTCGACGACCCCTATTGTCTCGACGGTA TGCATCACTGGCTGGCGAACTGGCGACTGCGCGCGACTGAAGCGGCCAGC GTGCGGTCCGGTTCGGAGTCGAAGCCGGCGTGCGCACCGCAAGCATTGCG GGCCTTCGGAGCTCGCGAATGCATCGAGGCCCAGCGGGCACTCGAGTATT TCGCTACTCTGTGGCGTCACGGCGGCAGCCCGCTACTGCGCAGCCTAATC GACGCCGGGACGGTCGAACTGCTTGGCGGCCCGTTGGCCCACCCATTCCA ACCGCTTATCGCGCCGCGGCTGCGCGAGTTCGCGCTACACGAAGGCCTGG ATGACGCGTGGCTGCGGCTGGCGCACCGGCCAACCGGCATATGGGCGCCG GAATGCGCCTACGCCCCAGGGATGGAACACGACTACTCGGCCGCGGGCAT CACTCACTTCATGGTCGACGGTCCGTCACTGCACGGCGACACCGCACTGG GCCGACCAGTTGGCGACACCGCCGTGGTCGCGTTCGGGCGTGACTTGCAG GTCAGCTACCGGGTGTGGTCGCCGAAATCTGGCTATCCGGGACATGCCGC CTACCGCGATTTCCACACCTACGACCACCTCACCGGTCTCAAACCGGCCA GAGTCACCGGGTGCAACGTGCCGTCTGAGGCCAAGGCGCCCTACGATCCC GACCACGCCGACAAAGTCGTCGACGCCCATGTAGACGACTTTGTCGGCGT GGTCCGCAACCGGCTCTTCACCGAGTCCGAGCGCATCGGGCGGCCCGCTC ACGTGGTCGCCGCCTTCGATACTGAGTTGTTCGGCCATTGGTGGTACGAG GGGCCGATCTGGCTGCAGCGGGTGCTGCGCGCCTTGCCCACCGCCGGGGT GCGAGTGGGCACACTTAGCGACGCCCTAGCGGGCGGGTTCGTCGGCAATA CAGTTACGTTGCCACCCAGCTCGTGGGGGTCCGGTAAGGACTGGCAAGTG TGGGCCGGCGACAAAGTCGCTGATCTGGTTCAGCTCAACAATGAGGTAGT CGACACAGCGCTGACCACAGTCGATAAAGTGCTAGCACAGACGACATCAC TGGATGGACTTCTCCCTCGCAATCACGTCGCCGACCAACTCCTGCGCGAA ACGCTGCTCACCGTATCAAGTGACTGGCCATTCATGGTGAGCAAGGATTC AGCCGCCGACTACGCCAGGTACCGTGCCCACCTGCATGCCCACGCCACAC GGGAGATCGCGGGAGCGCTGGCATCGGGCCGACGTGACACCGCGGCGCAA CTGGCGGACGGATGGAACCGCGCCGACGGTCTGTTCGGCGCACTGGACGC CCGAAGGCTGCCCCGG >C2 ATGAACACATCCGCAAACCCAGTGCCCGGTCTGTTCACCCTGGTGCTACA CACCCACTTGCCGTGGCTAGCCCACCACGGCCGCTGGCCGGTCGGTGAGG AATGGCTCTACCAATCGTGGGCCGCGGCCTACCTGCCGCTGCTGCAGGTG CTTCACACCCTAGCCGATGAAAATCGGCACCGGCTGATTACACTCGGGGT TACGCCGGTGGTGAACGCTCAACTCGACGACCCCTATTGTCTCGACGGTA TGCATCACTGGCTGGCGAACTGGCGACTGCGCGCGACTGAAGCGGCCAGC GTGCGGTCCGGTTCGGAGTCGAAGCCGGCGTGCGCACCGCAAGCATTGCG GGCCTTCGGAGCTCGCGAATGCATCGAGGCCCAGCGGGCACTCGAGTATT TCGCTACTCTGTGGCGTCACGGCGGCAGCCCGCTACTGCGCAGCCTAATC GACGCCGGGACGGTCGAACTGCTTGGCGGCCCGTTGGCCCACCCATTCCA ACCGCTTATCGCGCCGCGGCTGCGCGAGTTCGCGCTACACGAAGGCCTGG ATGACGCGTGGCTGCGGCTGGCGCACCGGCCAACCGGCATATGGGCGCCG GAATGCGCCTACGCCCCAGGGATGGAACACGACTACTCGGCCGCGGGCAT CACTCACTTCATGGTCGACGGTCCGTCACTGCACGGCGACACCGCACTGG GCCGACCAGTTGGCGACACCGCCGTGGTCGCGTTCGGGCGTGACTTGCAG GTCAGCTACCGGGTGTGGTCGCCGAAATCTGGCTATCCGGGACATGCCGC CTACCGCGATTTCCACACCTACGACCACCTCACCGGTCTCAAACCGGCCA GAGTCACCGGGTGCAACGTGCCGTCTGAGGCCAAGGCGCCCTACGATCCC GACCACGCCGACAAAGTCGTCGACGCCCATGTAGACGACTTTGTCGGCGT GGTCCGCAACCGGCTCTTCACCGAGTCCGAGCGCATCGGGCGGCCCGCTC ACGTGGTCGCCGCCTTCGATACTGAGTTGTTCGGCCATTGGTGGTACGAG GGGCCGATCTGGCTGCAGCGGGTGCTGCGCGCCTTGCCCACCGCCGGGGT GCGAGTGGGCACACTTAGCGACGCCCTAGCGGGCGGGTTCGTCGGCAATA CAGTTACGTTGCCACCCAGCTCGTGGGGGTCCGGTAAGGACTGGCAAGTG TGGGCCGGCGACAAAGTCGCTGATCTGGTTCAGCTCAACAATGAGGTAGT CGACACAGCGCTGACCACAGTCGATAAAGTGCTAGCACAGACGACATCAC TGGATGGACTTCTCCCTCGCAATCACGTCGCCGACCAACTCCTGCGCGAA ACGCTGCTCACCGTATCAAGTGACTGGCCATTCATGGTGAGCAAGGATTC AGCCGCCGACTACGCCAGGTACCGTGCCCACCTGCATGCCCACGCCACAC GGGAGATCGCGGGAGCGCTGGCATCGGGCCGACGTGACACCGCGGCGCAA CTGGCGGACGGATGGAACCGCGCCGACGGTCTGTTCGGCGCACTGGACGC CCGAAGGCTGCCCCGG >C3 ATGAACACATCCGCAAACCCAGTGCCCGGTCTGTTCACCCTGGTGCTACA CACCCACTTGCCGTGGCTAGCCCACCACGGCCGCTGGCCGGTCGGTGAGG AATGGCTCTACCAATCGTGGGCCGCGGCCTACCTGCCGCTGCTGCAGGTG CTTCACACCCTAGCCGATGAAAATCGGCACCGGCTGATTACACTCGGGGT TACGCCGGTGGTGAACGCTCAACTCGACGACCCCTATTGTCTCGACGGTA TGCATCACTGGCTGGCGAACTGGCGACTGCGCGCGACTGAAGCGGCCAGC GTGCGGTCCGGTTCGGAGTCGAAGCCGGCGTGCGCACCGCAAGCATTGCG GGCCTTCGGAGCTCGCGAATGCATCGAGGCCCAGCGGGCACTCGAGTATT TCGCTACTCTGTGGCGTCACGGCGGCAGCCCGCTACTGCGCAGCCTAATC GACGCCGGGACGGTCGAACTGCTTGGCGGCCCGTTGGCCCACCCATTCCA ACCGCTTATCGCGCCGCGGCTGCGCGAGTTCGCGCTACACGAAGGCCTGG ATGACGCGTGGCTGCGGCTGGCGCACCGGCCAACCGGCATATGGGCGCCG GAATGCGCCTACGCCCCAGGGATGGAACACGACTACTCGGCCGCGGGCAT CACTCACTTCATGGTCGACGGTCCGTCACTGCACGGCGACACCGCACTGG GCCGACCAGTTGGCGACACCGCCGTGGTCGCGTTCGGGCGTGACTTGCAG GTCAGCTACCGGGTGTGGTCGCCGAAATCTGGCTATCCGGGACATGCCGC CTACCGCGATTTCCACACCTACGACCACCTCACCGGTCTCAAACCGGCCA GAGTCACCGGGTGCAACGTGCCGTCTGAGGCCAAGGCGCCCTACGATCCC GACCACGCCGACAAAGTCGTCGACGCCCATGTAGACGACTTTGTCGGCGT GGTCCGCAACCGGCTCTTCACCGAGTCCGAGCGCATCGGGCGGCCCGCTC ACGTGGTCGCCGCCTTCGATACTGAGTTGTTCGGCCATTGGTGGTACGAG GGGCCGATCTGGCTGCAGCGGGTGCTGCGCGCCTTGCCCACCGCCGGGGT GCGAGTGGGCACACTTAGCGACGCCCTAGCGGGCGGGTTCGTCGGCAATA CAGTTACGTTGCCACCCAGCTCGTGGGGGTCCGGTAAGGACTGGCAAGTG TGGGCCGGCGACAAAGTCGCTGATCTGGTTCAGCTCAACAATGAGGTAGT CGACACAGCGCTGACCACAGTCGATAAAGTGCTAGCACAGACGACATCAC TGGATGGACTTCTCCCTCGCAATCACGTCGCCGACCAACTCCTGCGCGAA ACGCTGCTCACCGTATCAAGTGACTGGCCATTCATGGTGAGCAAGGATTC AGCCGCCGACTACGCCAGGTACCGTGCCCACCTGCATGCCCACGCCACAC GGGAGATCGCGGGAGCGCTGGCATCGGGCCGACGTGACACCGCGGCGCAA CTGGCGGACGGATGGAACCGCGCCGACGGTCTGTTCGGCGCACTGGACGC CCGAAGGCTGCCCCGG >C4 ATGAACACATCCGCAAACCCAGTGCCCGGTCTGTTCACCCTGGTGCTACA CACCCACTTGCCGTGGCTAGCCCACCACGGCCGCTGGCCGGTCGGTGAGG AATGGCTCTACCAATCGTGGGCCGCGGCCTACCTGCCGCTGCTGCAGGTG CTTCACACCCTAGCCGATGAAAATCGGCACCGGCTGATTACACTCGGGGT TACGCCGGTGGTGAACGCTCAACTCGACGACCCCTATTGTCTCGACGGTA TGCATCACTGGCTGGCGAACTGGCGACTGCGCGCGACTGAAGCGGCCAGC GTGCGGTCCGGTTCGGAGTCGAAGCCGGCGTGCGCACCGCAAGCATTGCG GGCCTTCGGAGCTCGCGAATGCATCGAGGCCCAGCGGGCACTCGAGTATT TCGCTACTCTGTGGCGTCACGGCGGCAGCCCGCTACTGCGCAGCCTAATC GACGCCGGGACGGTCGAACTGCTTGGCGGCCCGTTGGCCCACCCATTCCA ACCGCTTATCGCGCCGCGGCTGCGCGAGTTCGCGCTACACGAAGGCCTGG ATGACGCGTGGCTGCGGCTGGCGCACCGGCCAACCGGCATATGGGCGCCG GAATGCGCCTACGCCCCAGGGATGGAACACGACTACTCGGCCGCGGGCAT CACTCACTTCATGGTCGACGGTCCGTCACTGCACGGCGACACCGCACTGG GCCGACCAGTTGGCGACACCGCCGTGGTCGCGTTCGGGCGTGACTTGCAG GTCAGCTACCGGGTGTGGTCGCCGAAATCTGGCTATCCGGGACATGCCGC CTACCGCGATTTCCACACCTACGACCACCTCACCGGTCTCAAACCGGCCA GAGTCACCGGGTGCAACGTGCCGTCTGAGGCCAAGGCGCCCTACGATCCC GACCACGCCGACAAAGTCGTCGACGCCCATGTAGACGACTTTGTCGGCGT GGTCCGCAACCGGCTCTTCACCGAGTCCGAGCGCATCGGGCGGCCCGCTC ACGTGGTCGCCGCCTTCGATACTGAGTTGTTCGGCCATTGGTGGTACGAG GGGCCGATCTGGCTGCAGCGGGTGCTGCGCGCCTTGCCCACCGCCGGGGT GCGAGTGGGCACACTTAGCGACGCCCTAGCGGGCGGGTTCGTCGGCAATA CAGTTACGTTGCCACCCAGCTCGTGGGGGTCCGGTAAGGACTGGCAAGTG TGGGCCGGCGACAAAGTCGCTGATCTGGTTCAGCTCAACAATGAGGTAGT CGACACAGCGCTGACCACAGTCGATAAAGTGCTAGCACAGACGACATCAC TGGATGGACTTCTCCCTCGCAATCACGTCGCCGACCAACTCCTGCGCGAA ACGCTGCTCACCGTATCAAGTGACTGGCCATTCATGGTGAGCAAGGATTC AGCCGCCGACTACGCCAGGTACCGTGCCCACCTGCATGCCCACGCCACAC GGGAGATCGCGGGAGCGCTGGCATCGGGCCGACGTGACACCGCGGCGCAA CTGGCGGACGGATGGAACCGCGCCGACGGTCTGTTCGGCGCACTGGACGC CCGAAGGCTGCCCCGG >C5 ATGAACACATCCGCAAACCCAGTGCCCGGTCTGTTCACCCTGGTGCTACA CACCCACTTGCCGTGGCTAGCCCACCACGGCCGCTGGCCGGTCGGTGAGG AATGGCTCTACCAATCGTGGGCCGCGGCCTACCTGCCGCTGCTGCAGGTG CTTCACACCCTAGCCGATGAAAATCGGCACCGGCTGATTACACTCGGGGT TACGCCGGTGGTGAACGCTCAACTCGACGACCCCTATTGTCTCGACGGTA TGCATCACTGGCTGGCGAACTGGCGACTGCGCGCGACTGAAGCGGCCAGC GTGCGGTCCGGTTCGGAGTCGAAGCCGGCGTGCGCACCGCAAGCATTGCG GGCCTTCGGAGCTCGCGAATGCATCGAGGCCCAGCGGGCACTCGAGTATT TCGCTACTCTGTGGCGTCACGGCGGCAGCCCGCTACTGCGCAGCCTAATC GACGCCGGGACGGTCGAACTGCTTGGCGGCCCGTTGGCCCACCCATTCCA ACCGCTTATCGCGCCGCGGCTGCGCGAGTTCGCGCTACACGAAGGCCTGG ATGACGCGTGGCTGCGGCTGGCGCACCGGCCAACCGGCATATGGGCGCCG GAATGCGCCTACGCCCCAGGGATGGAACACGACTACTCGGCCGCGGGCAT CACTCACTTCATGGTCGACGGTCCGTCACTGCACGGCGACACCGCACTGG GCCGACCAGTTGGCGACACCGCCGTGGTCGCGTTCGGGCGTGACTTGCAG GTCAGCTACCGGGTGTGGTCGCCGAAATCTGGCTATCCGGGACATGCCGC CTACCGCGATTTCCACACCTACGACCACCTCACCGGTCTCAAACCGGCCA GAGTCACCGGGTGCAACGTGCCGTCTGAGGCCAAGGCGCCCTACGATCCC GACCACGCCGACAAAGTCGTCGACGCCCATGTAGACGACTTTGTCGGCGT GGTCCGCAACCGGCTCTTCACCGAGTCCGAGCGCATCGGGCGGCCCGCTC ACGTGGTCGCCGCCTTCGATACTGAGTTGTTCGGCCATTGGTGGTACGAG GGGCCGATCTGGCTGCAGCGGGTGCTGCGCGCCTTGCCCACCGCCGGGGT GCGAGTGGGCACACTTAGCGACGCCCTAGCGGGCGGGTTCGTCGGCAATA CAGTTACGTTGCCACCCAGCTCGTGGGGGTCCGGTAAGGACTGGCAAGTG TGGGCCGGCGACAAAGTCGCTGATCTGGTTCAGCTCAACAATGAGGTAGT CGACACAGCGCTGACCACAGTCGATAAAGTGCTAGCACAGACGACATCAC TGGATGGACTTCTCCCTCGCAATCACGTCGCCGACCAACTCCTGCGCGAA ACGCTGCTCACCGTATCAAGTGACTGGCCATTCATGGTGAGCAAGGATTC AGCCGCCGACTACGCCAGGTACCGTGCCCACCTGCATGCCCACGCCACAC GGGAGATCGCGGGAGCGCTGGCATCGGGCCGACGTGACACCGCGGCGCAA CTGGCGGACGGATGGAACCGCGCCGACGGTCTGTTCGGCGCACTGGACGC CCGAAGGCTGCCCCGG >C6 ATGAACACATCCGCAAACCCAGTGCCCGGTCTGTTCACCCTGGTGCTACA CACCCACTTGCCGTGGCTAGCCCACCACGGCCGCTGGCCGGTCGGTGAGG AATGGCTCTACCAATCGTGGGCCGCGGCCTACCTGCCGCTGCTGCAGGTG CTTCACACCCTAGCCGATGAAAATCGGCACCGGCTGATTACACTCGGGGT TACGCCGGTGGTGAACGCTCAACTCGACGACCCCTATTGTCTCGACGGTA TGCATCACTGGCTGGCGAACTGGCGACTGCGCGCGACTGAAGCGGCCAGC GTGCGGTCCGGTTCGGAGTCGAAGCCGGCGTGCGCACCGCAAGCATTGCG GGCCTTCGGAGCTCGCGAATGCATCGAGGCCCAGCGGGCACTCGAGTATT TCGCTACTCTGTGGCGTCACGGCGGCAGCCCGCTACTGCGCAGCCTAATC GACGCCGGGACGGTCGAACTGCTTGGCGGCCCGTTGGCCCACCCATTCCA ACCGCTTATCGCGCCGCGGCTGCGCGAGTTCGCGCTACACGAAGGCCTGG ATGACGCGTGGCTGCGGCTGGCGCACCGGCCAACCGGCATATGGGCGCCG GAATGCGCCTACGCCCCAGGGATGGAACACGACTACTCGGCCGCGGGCAT CACTCACTTCATGGTCGACGGTCCGTCACTGCACGGCGACACCGCACTGG GCCGACCAGTTGGCGACACCGCCGTGGTCGCGTTCGGGCGTGACTTGCAG GTCAGCTACCGGGTGTGGTCGCCGAAATCTGGCTATCCGGGACATGCCGC CTACCGCGATTTCCACACCTACGACCACCTCACCGGTCTCAAACCGGCCA GAGTCACCGGGTGCAACGTGCCGTCTGAGGCCAAGGCGCCCTACGATCCC GACCACGCCGACAAAGTCGTCGACGCCCATGTAGACGACTTTGTCGGCGT GGTCCGCAACCGGCTCTTCACCGAGTCCGAGCGCATCGGGCGGCCCGCTC ACGTGGTCGCCGCCTTCGATACTGAGTTGTTCGGCCATTGGTGGTACGAG GGGCCGATCTGGCTGCAGCGGGTGCTGCGCGCCTTGCCCACCGCCGGGGT GCGAGTGGGCACACTTAGCGACGCCCTAGCGGGCGGGTTCGTCGGCAATA CAGTTACGTTGCCACCCAGCTCGTGGGGGTCCGGTAAGGACTGGCAAGTG TGGGCCGGCGACAAAGTCGCTGATCTGGTTCAGCTCAACAATGAGGTAGT CGACACAGCGCTGACCACAGTCGATAAAGTGCTAGCACAGACGACATCAC TGGATGGACTTCTCCCTCGCAATCACGTCGCCGACCAACTCCTGCGCGAA ACGCTGCTCACCGTATCAAGTGACTGGCCATTCATGGTGAGCAAGGATTC AGCCGCCGACTACGCCAGGTACCGTGCCCACCTGCATGCCCACGCCACAC GGGAGATCGCGGGAGCGCTGGCATCGGGCCGACGTGACACCGCGGCGCAA CTGGCGGACGGATGGAACCGCGCCGACGGTCTGTTCGGCGCACTGGACGC CCGAAGGCTGCCCCGG >C1 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ LADGWNRADGLFGALDARRLPR >C2 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ LADGWNRADGLFGALDARRLPR >C3 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ LADGWNRADGLFGALDARRLPR >C4 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ LADGWNRADGLFGALDARRLPR >C5 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ LADGWNRADGLFGALDARRLPR >C6 MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQV LHTLADENRHRLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAAS VRSGSESKPACAPQALRAFGARECIEAQRALEYFATLWRHGGSPLLRSLI DAGTVELLGGPLAHPFQPLIAPRLREFALHEGLDDAWLRLAHRPTGIWAP ECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDTAVVAFGRDLQ VSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYE GPIWLQRVLRALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQV WAGDKVADLVQLNNEVVDTALTTVDKVLAQTTSLDGLLPRNHVADQLLRE TLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRDTAAQ LADGWNRADGLFGALDARRLPR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/7res/ML1714/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1566 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579858066 Setting output file names to "/data/7res/ML1714/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 207267515 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5593363698 Seed = 917436579 Swapseed = 1579858066 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3504.783080 -- -24.965149 Chain 2 -- -3504.783080 -- -24.965149 Chain 3 -- -3504.783080 -- -24.965149 Chain 4 -- -3504.783080 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3504.783080 -- -24.965149 Chain 2 -- -3504.783080 -- -24.965149 Chain 3 -- -3504.783080 -- -24.965149 Chain 4 -- -3504.782546 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3504.783] (-3504.783) (-3504.783) (-3504.783) * [-3504.783] (-3504.783) (-3504.783) (-3504.783) 500 -- (-2151.896) [-2113.774] (-2165.849) (-2137.765) * (-2126.325) (-2141.950) (-2118.056) [-2114.475] -- 0:00:00 1000 -- (-2116.436) [-2112.777] (-2116.709) (-2107.262) * (-2117.490) (-2134.217) [-2104.196] (-2103.055) -- 0:00:00 1500 -- [-2100.744] (-2110.940) (-2112.375) (-2117.485) * (-2117.442) (-2110.841) [-2109.402] (-2106.643) -- 0:00:00 2000 -- (-2102.897) [-2109.441] (-2107.557) (-2106.655) * [-2106.510] (-2110.916) (-2103.905) (-2105.911) -- 0:00:00 2500 -- (-2108.014) [-2102.491] (-2110.501) (-2100.734) * (-2104.731) [-2104.240] (-2108.819) (-2103.593) -- 0:00:00 3000 -- (-2103.719) (-2104.263) (-2107.243) [-2108.656] * (-2110.421) (-2106.367) (-2106.545) [-2103.580] -- 0:00:00 3500 -- (-2110.062) (-2103.238) (-2107.412) [-2106.579] * (-2110.453) (-2109.872) (-2104.778) [-2111.564] -- 0:00:00 4000 -- (-2121.393) (-2112.363) [-2105.245] (-2108.724) * [-2105.813] (-2106.768) (-2103.724) (-2108.635) -- 0:00:00 4500 -- (-2107.292) (-2107.491) [-2109.890] (-2113.176) * [-2105.090] (-2108.278) (-2105.370) (-2103.632) -- 0:00:00 5000 -- [-2104.771] (-2106.158) (-2108.995) (-2108.448) * (-2111.607) [-2104.103] (-2109.770) (-2106.570) -- 0:00:00 Average standard deviation of split frequencies: 0.088815 5500 -- [-2106.311] (-2109.269) (-2101.884) (-2111.661) * (-2111.837) (-2108.698) (-2107.317) [-2109.069] -- 0:00:00 6000 -- (-2109.852) (-2108.533) [-2112.149] (-2111.953) * (-2113.279) (-2107.447) [-2109.189] (-2103.262) -- 0:00:00 6500 -- [-2111.150] (-2107.644) (-2103.658) (-2112.283) * (-2112.955) (-2099.985) (-2107.179) [-2101.248] -- 0:00:00 7000 -- (-2111.600) [-2109.044] (-2110.508) (-2106.034) * (-2109.371) [-2107.678] (-2112.236) (-2113.066) -- 0:00:00 7500 -- (-2106.091) [-2105.870] (-2110.794) (-2109.062) * [-2110.005] (-2105.026) (-2101.823) (-2114.003) -- 0:00:00 8000 -- (-2107.613) (-2105.656) [-2108.749] (-2107.983) * (-2103.573) (-2113.659) [-2101.278] (-2106.498) -- 0:00:00 8500 -- (-2113.116) [-2105.746] (-2106.968) (-2109.232) * (-2117.004) (-2102.438) (-2107.898) [-2105.118] -- 0:00:00 9000 -- (-2103.935) [-2105.293] (-2113.605) (-2106.128) * (-2109.212) (-2108.470) (-2109.506) [-2103.120] -- 0:00:00 9500 -- (-2105.973) (-2104.842) (-2107.647) [-2104.878] * (-2109.093) (-2113.489) [-2107.580] (-2104.735) -- 0:00:00 10000 -- (-2107.194) [-2108.426] (-2114.651) (-2107.021) * (-2103.825) [-2109.421] (-2108.124) (-2107.786) -- 0:00:00 Average standard deviation of split frequencies: 0.068501 10500 -- (-2102.896) [-2103.843] (-2111.477) (-2112.577) * (-2110.371) [-2111.818] (-2122.071) (-2109.940) -- 0:01:34 11000 -- (-2104.840) [-2104.629] (-2103.631) (-2109.027) * (-2109.161) [-2104.010] (-2113.603) (-2107.259) -- 0:01:29 11500 -- (-2107.479) [-2107.266] (-2100.488) (-2119.148) * (-2107.813) (-2107.782) [-2106.937] (-2115.117) -- 0:01:25 12000 -- (-2105.100) (-2105.441) (-2110.610) [-2100.583] * [-2105.949] (-2111.537) (-2108.788) (-2109.647) -- 0:01:22 12500 -- (-2098.655) (-2103.398) (-2106.715) [-2108.924] * (-2107.824) (-2106.546) (-2112.384) [-2113.144] -- 0:01:19 13000 -- [-2107.209] (-2115.876) (-2103.196) (-2104.885) * [-2107.480] (-2106.357) (-2105.558) (-2107.902) -- 0:01:15 13500 -- (-2101.859) (-2114.404) (-2109.527) [-2101.908] * (-2106.331) [-2102.124] (-2109.077) (-2107.600) -- 0:01:13 14000 -- (-2112.282) (-2110.416) [-2102.968] (-2112.347) * (-2102.031) (-2104.131) [-2105.160] (-2105.476) -- 0:01:10 14500 -- (-2116.911) (-2103.601) (-2105.266) [-2105.309] * (-2099.414) (-2107.388) (-2113.558) [-2104.910] -- 0:01:07 15000 -- (-2104.689) (-2108.837) (-2107.990) [-2101.116] * (-2099.236) (-2105.889) (-2109.143) [-2107.864] -- 0:01:05 Average standard deviation of split frequencies: 0.043419 15500 -- [-2105.095] (-2109.153) (-2106.207) (-2105.968) * [-2097.850] (-2107.750) (-2113.702) (-2107.872) -- 0:01:03 16000 -- (-2105.042) (-2109.032) (-2103.088) [-2105.434] * [-2099.310] (-2112.067) (-2105.133) (-2110.854) -- 0:01:01 16500 -- [-2102.024] (-2108.505) (-2108.428) (-2117.923) * (-2100.102) [-2106.177] (-2108.990) (-2106.322) -- 0:00:59 17000 -- (-2109.350) [-2102.912] (-2106.368) (-2110.227) * [-2097.973] (-2113.364) (-2115.921) (-2106.338) -- 0:00:57 17500 -- (-2110.133) (-2110.146) (-2111.192) [-2106.693] * [-2100.944] (-2103.731) (-2109.806) (-2111.830) -- 0:00:56 18000 -- (-2104.763) (-2104.438) (-2106.500) [-2104.531] * (-2100.618) (-2104.108) [-2108.023] (-2107.584) -- 0:00:54 18500 -- (-2114.856) (-2116.621) [-2105.623] (-2108.674) * [-2100.800] (-2105.103) (-2114.966) (-2107.387) -- 0:00:53 19000 -- (-2103.676) (-2111.571) (-2114.634) [-2104.352] * [-2099.189] (-2117.544) (-2113.065) (-2110.474) -- 0:00:51 19500 -- [-2104.413] (-2110.006) (-2104.020) (-2110.165) * [-2100.887] (-2114.712) (-2105.755) (-2106.738) -- 0:00:50 20000 -- (-2114.027) (-2108.758) (-2103.177) [-2105.486] * [-2100.036] (-2109.448) (-2102.301) (-2106.302) -- 0:00:49 Average standard deviation of split frequencies: 0.049221 20500 -- (-2112.908) (-2107.088) [-2103.931] (-2115.255) * (-2097.957) (-2107.898) [-2102.097] (-2111.337) -- 0:00:47 21000 -- (-2106.589) (-2113.372) [-2104.089] (-2115.236) * (-2098.169) (-2109.433) [-2108.503] (-2102.055) -- 0:00:46 21500 -- (-2110.730) (-2113.532) [-2106.090] (-2106.770) * (-2097.643) (-2109.529) [-2103.892] (-2112.220) -- 0:00:45 22000 -- (-2103.262) (-2104.504) (-2104.936) [-2102.115] * [-2098.925] (-2114.535) (-2105.927) (-2105.817) -- 0:00:44 22500 -- [-2103.958] (-2111.583) (-2102.868) (-2099.600) * (-2097.709) [-2109.134] (-2113.439) (-2112.888) -- 0:00:43 23000 -- (-2105.578) (-2111.555) (-2106.979) [-2096.961] * (-2101.723) (-2106.495) [-2105.848] (-2105.265) -- 0:00:42 23500 -- [-2108.592] (-2103.869) (-2111.054) (-2098.976) * (-2098.303) [-2105.523] (-2115.667) (-2109.665) -- 0:00:41 24000 -- [-2110.368] (-2107.057) (-2104.966) (-2099.219) * (-2097.592) (-2111.834) [-2108.827] (-2107.481) -- 0:00:40 24500 -- (-2113.060) [-2100.523] (-2105.327) (-2098.724) * [-2097.522] (-2100.333) (-2102.621) (-2107.440) -- 0:01:19 25000 -- (-2113.850) (-2106.274) [-2107.151] (-2099.971) * (-2098.594) (-2104.937) [-2101.423] (-2106.250) -- 0:01:18 Average standard deviation of split frequencies: 0.037989 25500 -- (-2118.521) (-2106.215) [-2103.563] (-2099.978) * (-2098.518) [-2110.857] (-2109.384) (-2110.764) -- 0:01:16 26000 -- [-2101.370] (-2114.273) (-2107.965) (-2100.146) * (-2098.554) (-2107.125) (-2110.089) [-2103.621] -- 0:01:14 26500 -- (-2107.164) (-2110.835) [-2108.606] (-2099.267) * (-2098.231) (-2104.978) (-2101.572) [-2101.891] -- 0:01:13 27000 -- (-2112.634) (-2112.430) (-2104.550) [-2097.810] * (-2098.164) [-2100.679] (-2108.288) (-2115.016) -- 0:01:12 27500 -- (-2112.808) (-2104.820) (-2104.211) [-2097.693] * [-2099.206] (-2115.847) (-2109.437) (-2105.773) -- 0:01:10 28000 -- [-2106.541] (-2104.509) (-2107.068) (-2097.298) * (-2102.155) (-2101.100) [-2107.758] (-2104.206) -- 0:01:09 28500 -- (-2108.973) (-2112.424) [-2108.819] (-2100.335) * (-2101.110) [-2102.048] (-2103.751) (-2107.757) -- 0:01:08 29000 -- [-2109.731] (-2104.370) (-2100.138) (-2100.247) * (-2097.763) (-2109.881) (-2110.286) [-2105.446] -- 0:01:06 29500 -- [-2105.971] (-2105.135) (-2115.922) (-2096.924) * (-2098.593) [-2105.493] (-2108.602) (-2103.405) -- 0:01:05 30000 -- [-2106.971] (-2111.096) (-2112.970) (-2098.050) * [-2098.670] (-2104.865) (-2116.759) (-2105.881) -- 0:01:04 Average standard deviation of split frequencies: 0.045417 30500 -- (-2103.489) (-2106.643) [-2107.297] (-2096.427) * [-2099.533] (-2116.927) (-2119.602) (-2105.400) -- 0:01:03 31000 -- (-2110.752) (-2121.678) [-2107.204] (-2096.930) * [-2098.259] (-2103.653) (-2107.796) (-2108.910) -- 0:01:02 31500 -- (-2101.821) (-2110.824) (-2108.337) [-2097.857] * (-2098.260) (-2108.011) (-2117.700) [-2111.912] -- 0:01:01 32000 -- (-2106.097) (-2106.158) (-2106.969) [-2098.162] * (-2098.260) (-2105.078) [-2107.494] (-2109.311) -- 0:01:00 32500 -- [-2106.816] (-2113.047) (-2100.759) (-2101.274) * [-2098.666] (-2118.989) (-2104.653) (-2111.486) -- 0:00:59 33000 -- (-2111.613) (-2109.730) (-2103.205) [-2100.753] * (-2098.928) [-2108.789] (-2104.150) (-2106.949) -- 0:00:58 33500 -- (-2102.997) (-2107.351) [-2106.503] (-2098.655) * (-2098.778) (-2113.484) (-2101.826) [-2100.754] -- 0:00:57 34000 -- (-2109.611) [-2104.290] (-2109.601) (-2099.529) * (-2100.196) (-2110.054) [-2105.933] (-2112.089) -- 0:00:56 34500 -- (-2103.943) [-2110.645] (-2116.996) (-2099.139) * (-2098.783) [-2104.547] (-2102.071) (-2114.183) -- 0:00:55 35000 -- (-2106.245) (-2117.914) [-2103.791] (-2098.241) * [-2100.325] (-2108.026) (-2107.489) (-2103.287) -- 0:00:55 Average standard deviation of split frequencies: 0.038556 35500 -- (-2105.690) (-2119.541) (-2108.963) [-2098.570] * (-2101.498) [-2102.704] (-2115.828) (-2110.650) -- 0:00:54 36000 -- (-2107.406) [-2105.294] (-2105.490) (-2097.332) * (-2098.537) (-2103.771) (-2111.239) [-2104.530] -- 0:00:53 36500 -- (-2102.890) (-2106.569) (-2114.876) [-2097.383] * (-2098.141) [-2102.980] (-2104.932) (-2115.048) -- 0:00:52 37000 -- (-2100.093) (-2099.599) (-2112.135) [-2096.627] * (-2097.646) (-2112.552) [-2106.779] (-2109.900) -- 0:00:52 37500 -- [-2097.976] (-2100.162) (-2105.794) (-2102.183) * (-2098.204) (-2105.791) [-2101.711] (-2107.952) -- 0:00:51 38000 -- (-2097.495) (-2100.659) (-2108.995) [-2098.018] * (-2097.883) (-2111.259) (-2111.870) [-2104.997] -- 0:00:50 38500 -- (-2098.149) [-2098.494] (-2106.408) (-2104.320) * (-2100.477) (-2107.521) [-2105.587] (-2106.829) -- 0:01:14 39000 -- (-2098.158) [-2098.117] (-2118.006) (-2104.456) * (-2104.047) (-2113.393) (-2111.545) [-2106.018] -- 0:01:13 39500 -- (-2097.044) (-2098.945) [-2106.309] (-2106.332) * (-2098.180) (-2103.369) [-2107.088] (-2110.625) -- 0:01:12 40000 -- [-2097.682] (-2101.044) (-2114.596) (-2099.067) * (-2101.224) (-2111.721) [-2107.548] (-2107.852) -- 0:01:12 Average standard deviation of split frequencies: 0.038253 40500 -- [-2096.954] (-2098.101) (-2108.216) (-2097.413) * [-2098.193] (-2108.408) (-2113.057) (-2117.278) -- 0:01:11 41000 -- (-2097.096) (-2098.102) (-2105.401) [-2096.500] * (-2099.476) [-2104.077] (-2105.255) (-2106.935) -- 0:01:10 41500 -- [-2097.545] (-2097.519) (-2115.901) (-2096.418) * (-2100.813) (-2103.682) [-2111.673] (-2108.747) -- 0:01:09 42000 -- (-2097.643) (-2097.111) (-2108.747) [-2099.544] * (-2100.145) (-2106.507) (-2109.472) [-2106.770] -- 0:01:08 42500 -- (-2097.086) (-2096.260) [-2110.799] (-2104.773) * [-2098.495] (-2108.097) (-2111.218) (-2116.770) -- 0:01:07 43000 -- (-2097.566) (-2096.309) (-2104.181) [-2099.601] * (-2097.749) (-2111.484) (-2115.506) [-2109.722] -- 0:01:06 43500 -- (-2098.115) (-2096.366) [-2109.340] (-2097.753) * [-2097.894] (-2104.628) (-2112.946) (-2105.012) -- 0:01:05 44000 -- (-2098.761) (-2096.491) (-2111.243) [-2097.646] * [-2096.931] (-2110.676) (-2106.665) (-2117.025) -- 0:01:05 44500 -- (-2098.043) [-2097.575] (-2108.544) (-2101.605) * (-2097.470) (-2105.850) [-2109.716] (-2121.115) -- 0:01:04 45000 -- (-2099.255) (-2096.606) (-2101.250) [-2099.484] * (-2098.636) [-2100.930] (-2110.379) (-2098.290) -- 0:01:03 Average standard deviation of split frequencies: 0.038430 45500 -- (-2098.391) [-2096.823] (-2110.697) (-2098.222) * (-2097.390) (-2105.767) [-2109.627] (-2101.804) -- 0:01:02 46000 -- (-2097.914) (-2100.477) (-2105.202) [-2097.818] * (-2098.550) (-2105.388) (-2113.967) [-2097.677] -- 0:01:02 46500 -- (-2097.891) (-2100.160) [-2104.095] (-2098.783) * (-2097.364) (-2103.368) [-2105.680] (-2098.543) -- 0:01:01 47000 -- (-2097.894) (-2097.761) [-2107.059] (-2098.147) * (-2096.485) [-2101.539] (-2104.971) (-2100.137) -- 0:01:00 47500 -- (-2097.752) (-2097.092) (-2106.485) [-2099.104] * (-2096.485) [-2112.745] (-2111.205) (-2096.473) -- 0:01:00 48000 -- [-2098.903] (-2099.374) (-2107.360) (-2098.605) * (-2096.362) [-2100.408] (-2110.762) (-2099.078) -- 0:00:59 48500 -- (-2096.984) [-2101.061] (-2110.835) (-2099.059) * (-2096.433) (-2104.223) [-2108.825] (-2099.592) -- 0:00:58 49000 -- [-2099.330] (-2100.231) (-2104.404) (-2097.554) * [-2097.385] (-2101.375) (-2104.425) (-2098.539) -- 0:00:58 49500 -- (-2098.048) (-2098.150) (-2107.890) [-2098.791] * (-2097.170) [-2110.900] (-2107.818) (-2097.898) -- 0:00:57 50000 -- [-2097.480] (-2098.934) (-2106.662) (-2096.703) * (-2097.355) (-2107.501) (-2105.673) [-2099.820] -- 0:00:57 Average standard deviation of split frequencies: 0.031634 50500 -- [-2097.425] (-2100.179) (-2119.873) (-2097.678) * (-2097.851) (-2107.632) [-2114.457] (-2098.139) -- 0:00:56 51000 -- (-2097.134) [-2098.330] (-2112.492) (-2097.716) * (-2098.798) (-2110.785) (-2119.030) [-2099.110] -- 0:00:55 51500 -- [-2097.147] (-2099.728) (-2107.698) (-2097.258) * (-2098.045) (-2113.176) (-2106.085) [-2098.338] -- 0:00:55 52000 -- (-2097.147) [-2097.647] (-2109.698) (-2101.277) * (-2102.616) (-2117.725) [-2102.532] (-2097.988) -- 0:00:54 52500 -- (-2097.766) (-2097.416) [-2104.542] (-2100.635) * (-2099.598) (-2108.175) [-2105.294] (-2098.231) -- 0:00:54 53000 -- (-2099.464) (-2097.315) (-2109.466) [-2100.901] * (-2097.589) (-2106.970) [-2103.607] (-2097.608) -- 0:00:53 53500 -- (-2100.744) [-2097.858] (-2106.521) (-2101.148) * (-2099.047) [-2106.977] (-2105.733) (-2097.576) -- 0:01:10 54000 -- (-2097.557) (-2097.070) (-2108.419) [-2099.300] * (-2098.549) (-2105.906) [-2109.504] (-2097.513) -- 0:01:10 54500 -- (-2097.553) (-2098.690) [-2109.063] (-2098.523) * (-2098.841) (-2107.588) [-2108.357] (-2098.005) -- 0:01:09 55000 -- (-2104.356) [-2099.247] (-2108.396) (-2100.613) * (-2097.829) [-2105.808] (-2115.337) (-2101.281) -- 0:01:08 Average standard deviation of split frequencies: 0.035001 55500 -- (-2102.593) (-2098.345) [-2107.400] (-2100.657) * (-2098.529) [-2106.566] (-2111.013) (-2100.262) -- 0:01:08 56000 -- (-2104.095) (-2104.504) [-2106.865] (-2100.344) * (-2097.977) [-2109.471] (-2116.702) (-2101.938) -- 0:01:07 56500 -- [-2097.713] (-2100.148) (-2104.239) (-2099.509) * (-2099.737) (-2103.185) (-2105.541) [-2098.822] -- 0:01:06 57000 -- (-2097.339) (-2099.346) [-2107.829] (-2096.720) * (-2099.422) [-2103.735] (-2108.772) (-2098.626) -- 0:01:06 57500 -- [-2097.339] (-2098.662) (-2107.009) (-2096.902) * (-2098.712) (-2115.067) (-2113.494) [-2099.576] -- 0:01:05 58000 -- (-2100.752) [-2099.949] (-2107.404) (-2096.579) * (-2099.366) (-2110.269) (-2108.950) [-2099.735] -- 0:01:04 58500 -- (-2101.378) (-2099.903) [-2112.672] (-2097.020) * [-2106.265] (-2106.416) (-2105.827) (-2098.508) -- 0:01:04 59000 -- (-2101.090) (-2099.596) (-2109.748) [-2096.705] * (-2098.683) [-2106.777] (-2105.924) (-2098.518) -- 0:01:03 59500 -- (-2100.562) (-2097.561) [-2109.118] (-2096.035) * (-2098.748) [-2108.997] (-2115.750) (-2099.549) -- 0:01:03 60000 -- (-2098.546) (-2097.491) [-2107.600] (-2097.214) * (-2098.669) (-2104.581) (-2112.481) [-2098.869] -- 0:01:02 Average standard deviation of split frequencies: 0.035989 60500 -- (-2097.433) (-2097.876) (-2110.888) [-2097.010] * (-2098.544) (-2121.920) [-2105.951] (-2100.827) -- 0:01:02 61000 -- (-2104.335) (-2097.409) [-2103.939] (-2099.966) * (-2100.804) [-2102.572] (-2111.547) (-2100.942) -- 0:01:01 61500 -- [-2102.698] (-2100.866) (-2110.330) (-2100.746) * [-2101.840] (-2106.356) (-2107.234) (-2100.469) -- 0:01:01 62000 -- (-2099.798) (-2100.080) (-2103.649) [-2097.763] * [-2101.671] (-2106.042) (-2104.339) (-2099.338) -- 0:01:00 62500 -- (-2101.465) (-2101.755) [-2103.151] (-2098.040) * (-2102.419) [-2111.547] (-2099.580) (-2100.718) -- 0:01:00 63000 -- (-2099.618) (-2100.503) (-2108.122) [-2096.575] * (-2099.662) (-2104.447) (-2100.272) [-2097.155] -- 0:00:59 63500 -- (-2099.027) (-2101.370) [-2109.894] (-2096.581) * [-2097.490] (-2111.020) (-2101.870) (-2101.114) -- 0:00:58 64000 -- (-2099.078) [-2098.846] (-2102.177) (-2096.628) * [-2097.367] (-2105.704) (-2099.720) (-2099.622) -- 0:00:58 64500 -- (-2098.650) (-2101.067) [-2109.059] (-2097.969) * (-2097.463) (-2106.540) [-2098.013] (-2098.898) -- 0:00:58 65000 -- [-2097.778] (-2099.925) (-2109.441) (-2098.016) * (-2097.165) (-2101.400) [-2098.478] (-2098.943) -- 0:00:57 Average standard deviation of split frequencies: 0.035712 65500 -- (-2100.136) (-2099.864) [-2103.099] (-2096.446) * (-2098.648) (-2111.261) [-2097.283] (-2097.698) -- 0:00:57 66000 -- (-2097.643) (-2097.946) [-2105.851] (-2100.007) * [-2099.114] (-2107.941) (-2098.561) (-2098.401) -- 0:00:56 66500 -- (-2099.383) (-2097.649) (-2114.488) [-2096.399] * (-2101.065) (-2118.583) [-2098.817] (-2098.347) -- 0:00:56 67000 -- (-2098.919) (-2099.207) (-2111.421) [-2104.128] * [-2099.434] (-2119.187) (-2100.958) (-2096.798) -- 0:00:55 67500 -- [-2098.451] (-2099.846) (-2106.590) (-2106.992) * (-2099.541) (-2107.377) [-2098.072] (-2096.657) -- 0:00:55 68000 -- (-2099.027) (-2099.250) [-2101.750] (-2102.401) * (-2098.575) (-2105.262) [-2099.084] (-2098.202) -- 0:01:08 68500 -- (-2098.673) (-2101.628) (-2112.329) [-2099.239] * [-2098.082] (-2102.436) (-2099.075) (-2098.299) -- 0:01:07 69000 -- [-2097.482] (-2097.524) (-2106.880) (-2097.222) * (-2099.317) (-2099.879) [-2098.000] (-2100.605) -- 0:01:07 69500 -- [-2098.431] (-2098.610) (-2112.245) (-2097.586) * (-2099.279) (-2099.234) (-2101.442) [-2098.390] -- 0:01:06 70000 -- (-2098.884) (-2097.584) (-2103.716) [-2097.701] * [-2103.532] (-2099.678) (-2099.011) (-2099.420) -- 0:01:06 Average standard deviation of split frequencies: 0.030194 70500 -- (-2097.585) (-2098.314) (-2105.140) [-2096.373] * [-2101.457] (-2099.934) (-2099.051) (-2101.092) -- 0:01:05 71000 -- (-2101.624) (-2099.663) (-2108.558) [-2097.058] * (-2101.457) (-2101.877) [-2097.867] (-2098.778) -- 0:01:05 71500 -- [-2099.402] (-2099.136) (-2105.219) (-2098.849) * (-2099.430) (-2104.061) (-2097.855) [-2099.337] -- 0:01:04 72000 -- (-2097.682) [-2100.638] (-2106.576) (-2098.031) * (-2099.240) (-2100.843) (-2100.075) [-2100.385] -- 0:01:04 72500 -- (-2097.706) (-2102.546) [-2107.042] (-2098.353) * [-2099.190] (-2097.048) (-2098.268) (-2100.472) -- 0:01:03 73000 -- (-2098.147) [-2097.133] (-2103.038) (-2099.872) * (-2099.809) (-2101.560) (-2097.781) [-2098.276] -- 0:01:03 73500 -- [-2099.080] (-2097.267) (-2108.096) (-2099.393) * (-2104.263) (-2099.800) [-2097.175] (-2100.339) -- 0:01:03 74000 -- (-2099.704) [-2098.726] (-2106.009) (-2098.424) * [-2098.598] (-2097.799) (-2100.726) (-2100.339) -- 0:01:02 74500 -- (-2103.080) [-2099.314] (-2113.829) (-2097.641) * [-2096.147] (-2097.588) (-2101.087) (-2100.605) -- 0:01:02 75000 -- (-2101.973) (-2097.125) [-2104.977] (-2100.309) * (-2096.148) [-2098.122] (-2100.000) (-2098.792) -- 0:01:01 Average standard deviation of split frequencies: 0.026770 75500 -- [-2096.695] (-2100.154) (-2106.384) (-2103.125) * (-2096.327) [-2098.648] (-2099.591) (-2101.276) -- 0:01:01 76000 -- (-2097.931) [-2098.337] (-2108.701) (-2098.376) * (-2096.480) [-2100.767] (-2099.942) (-2097.598) -- 0:01:00 76500 -- (-2098.272) [-2097.490] (-2103.671) (-2099.661) * (-2099.874) (-2100.666) (-2099.916) [-2098.216] -- 0:01:00 77000 -- [-2099.016] (-2097.088) (-2110.800) (-2098.185) * (-2098.445) (-2098.092) (-2099.916) [-2101.056] -- 0:00:59 77500 -- (-2098.396) (-2097.137) [-2106.781] (-2098.589) * (-2098.936) [-2096.743] (-2101.138) (-2099.608) -- 0:00:59 78000 -- [-2097.837] (-2098.440) (-2106.004) (-2098.206) * (-2099.379) (-2097.506) (-2101.138) [-2099.961] -- 0:00:59 78500 -- (-2098.085) (-2096.578) [-2106.618] (-2099.257) * (-2098.009) (-2098.051) (-2102.780) [-2100.615] -- 0:00:58 79000 -- [-2098.486] (-2096.578) (-2106.386) (-2098.710) * [-2100.292] (-2097.122) (-2100.517) (-2099.022) -- 0:00:58 79500 -- [-2099.211] (-2096.736) (-2118.417) (-2099.820) * (-2102.857) [-2098.373] (-2099.619) (-2098.735) -- 0:00:57 80000 -- (-2099.976) (-2096.281) (-2107.089) [-2098.070] * (-2099.246) (-2097.876) [-2099.269] (-2100.191) -- 0:00:57 Average standard deviation of split frequencies: 0.024025 80500 -- (-2101.083) [-2096.263] (-2107.614) (-2098.931) * (-2100.444) (-2101.463) [-2098.591] (-2098.865) -- 0:00:57 81000 -- (-2098.265) (-2098.712) (-2107.744) [-2099.357] * (-2099.951) (-2102.960) [-2097.897] (-2099.142) -- 0:00:56 81500 -- (-2098.395) [-2096.850] (-2112.740) (-2100.241) * (-2103.061) (-2102.561) (-2098.104) [-2098.442] -- 0:00:56 82000 -- [-2099.936] (-2097.728) (-2109.779) (-2098.922) * (-2104.150) [-2099.324] (-2098.041) (-2097.225) -- 0:00:55 82500 -- (-2102.434) (-2099.529) [-2101.461] (-2098.886) * [-2100.697] (-2098.409) (-2097.462) (-2099.241) -- 0:00:55 83000 -- (-2096.827) [-2098.428] (-2103.056) (-2097.674) * (-2098.644) (-2097.264) [-2096.934] (-2098.929) -- 0:01:06 83500 -- (-2096.910) (-2099.683) [-2111.195] (-2100.526) * (-2096.391) (-2097.265) [-2098.425] (-2098.951) -- 0:01:05 84000 -- (-2097.725) (-2097.035) [-2106.530] (-2097.416) * (-2098.222) [-2097.303] (-2096.616) (-2098.860) -- 0:01:05 84500 -- (-2097.201) (-2097.078) (-2105.978) [-2100.305] * [-2097.598] (-2098.229) (-2096.711) (-2101.090) -- 0:01:05 85000 -- (-2097.422) (-2097.196) [-2111.059] (-2100.953) * (-2097.614) (-2098.273) [-2096.693] (-2100.576) -- 0:01:04 Average standard deviation of split frequencies: 0.022214 85500 -- (-2097.335) [-2097.960] (-2103.829) (-2100.529) * (-2097.684) [-2098.469] (-2096.855) (-2100.577) -- 0:01:04 86000 -- [-2097.273] (-2099.279) (-2104.971) (-2100.082) * (-2100.477) (-2096.916) [-2096.565] (-2098.560) -- 0:01:03 86500 -- [-2096.251] (-2100.359) (-2103.771) (-2100.128) * (-2098.819) [-2099.228] (-2098.956) (-2097.993) -- 0:01:03 87000 -- (-2098.086) (-2104.021) [-2105.369] (-2099.127) * (-2099.689) (-2098.271) (-2098.731) [-2097.965] -- 0:01:02 87500 -- [-2098.817] (-2102.364) (-2105.663) (-2099.138) * (-2099.160) (-2098.280) (-2097.258) [-2097.902] -- 0:01:02 88000 -- (-2099.329) [-2099.922] (-2105.573) (-2100.335) * (-2100.009) (-2098.851) [-2097.014] (-2097.920) -- 0:01:02 88500 -- (-2097.297) (-2097.374) (-2118.630) [-2100.596] * (-2099.442) (-2101.469) (-2097.334) [-2097.272] -- 0:01:01 89000 -- (-2097.869) (-2097.894) [-2106.176] (-2098.769) * (-2100.649) [-2097.634] (-2097.295) (-2096.751) -- 0:01:01 89500 -- (-2097.866) (-2097.735) (-2105.340) [-2097.984] * (-2099.741) [-2098.204] (-2098.459) (-2097.791) -- 0:01:01 90000 -- (-2100.086) [-2097.303] (-2108.271) (-2097.902) * (-2102.429) (-2101.209) [-2101.076] (-2097.566) -- 0:01:00 Average standard deviation of split frequencies: 0.022439 90500 -- (-2098.554) [-2097.078] (-2107.989) (-2098.351) * (-2103.947) (-2096.813) (-2103.379) [-2097.514] -- 0:01:00 91000 -- [-2099.720] (-2099.489) (-2102.153) (-2099.820) * [-2098.194] (-2098.236) (-2099.165) (-2100.384) -- 0:00:59 91500 -- (-2098.131) [-2099.561] (-2113.416) (-2099.240) * (-2099.317) (-2101.800) [-2099.803] (-2099.894) -- 0:00:59 92000 -- (-2099.897) [-2098.881] (-2115.088) (-2099.450) * (-2101.471) (-2101.729) (-2100.666) [-2099.016] -- 0:00:59 92500 -- (-2100.833) [-2099.016] (-2112.628) (-2097.693) * (-2104.122) (-2097.484) (-2098.344) [-2098.934] -- 0:00:58 93000 -- (-2099.382) (-2100.764) [-2106.995] (-2097.695) * (-2105.154) [-2097.283] (-2096.888) (-2098.630) -- 0:00:58 93500 -- (-2101.726) (-2098.185) [-2109.413] (-2097.814) * (-2098.407) (-2098.007) [-2100.906] (-2099.024) -- 0:00:58 94000 -- (-2103.804) [-2098.548] (-2111.240) (-2096.578) * [-2098.060] (-2097.550) (-2097.685) (-2099.428) -- 0:00:57 94500 -- (-2104.966) (-2097.645) (-2112.362) [-2096.861] * [-2097.960] (-2097.733) (-2097.352) (-2098.697) -- 0:00:57 95000 -- (-2103.321) (-2097.621) (-2105.947) [-2096.867] * [-2102.213] (-2097.034) (-2097.376) (-2097.823) -- 0:00:57 Average standard deviation of split frequencies: 0.020577 95500 -- (-2099.114) (-2099.425) [-2112.643] (-2096.710) * (-2100.862) [-2098.457] (-2101.201) (-2099.000) -- 0:00:56 96000 -- (-2099.379) [-2099.762] (-2105.229) (-2097.568) * (-2100.521) [-2097.087] (-2098.020) (-2098.638) -- 0:00:56 96500 -- [-2099.072] (-2098.667) (-2112.388) (-2098.270) * (-2100.019) (-2097.513) (-2100.334) [-2102.064] -- 0:00:56 97000 -- (-2098.494) [-2099.094] (-2111.608) (-2101.260) * (-2098.600) (-2098.023) [-2098.209] (-2100.144) -- 0:00:55 97500 -- (-2098.370) [-2098.093] (-2111.988) (-2099.062) * (-2098.685) (-2099.604) [-2097.030] (-2101.395) -- 0:00:55 98000 -- [-2096.971] (-2098.873) (-2105.786) (-2101.467) * (-2098.861) [-2097.568] (-2099.959) (-2100.983) -- 0:01:04 98500 -- (-2096.419) [-2097.629] (-2106.559) (-2098.052) * (-2099.042) (-2099.319) [-2097.917] (-2101.885) -- 0:01:04 99000 -- (-2098.348) (-2097.387) (-2107.501) [-2097.462] * (-2100.146) (-2099.292) [-2098.773] (-2099.956) -- 0:01:03 99500 -- (-2098.513) (-2097.078) [-2107.796] (-2100.811) * (-2099.129) [-2098.078] (-2099.684) (-2102.116) -- 0:01:03 100000 -- (-2097.073) (-2097.069) [-2105.828] (-2107.466) * [-2099.558] (-2097.795) (-2097.729) (-2103.048) -- 0:01:02 Average standard deviation of split frequencies: 0.018238 100500 -- (-2096.826) [-2098.117] (-2104.782) (-2109.117) * [-2097.957] (-2098.958) (-2099.845) (-2101.247) -- 0:01:02 101000 -- (-2096.803) (-2098.600) (-2112.176) [-2109.514] * (-2100.182) (-2097.290) (-2098.288) [-2096.527] -- 0:01:02 101500 -- [-2096.523] (-2098.731) (-2109.379) (-2106.277) * (-2100.598) [-2096.790] (-2098.041) (-2096.910) -- 0:01:01 102000 -- [-2097.137] (-2097.747) (-2110.370) (-2099.263) * (-2097.769) [-2096.513] (-2096.413) (-2097.249) -- 0:01:01 102500 -- (-2097.137) [-2098.514] (-2108.525) (-2096.817) * (-2098.010) (-2097.016) (-2099.203) [-2097.070] -- 0:01:01 103000 -- [-2098.418] (-2098.204) (-2102.238) (-2098.087) * (-2099.427) [-2098.192] (-2106.663) (-2098.313) -- 0:01:00 103500 -- (-2098.402) (-2098.219) [-2110.417] (-2098.490) * (-2098.023) (-2097.114) [-2100.936] (-2097.553) -- 0:01:00 104000 -- (-2102.108) [-2098.222] (-2102.947) (-2099.082) * [-2098.128] (-2096.259) (-2101.421) (-2100.074) -- 0:01:00 104500 -- (-2101.567) (-2098.021) [-2103.422] (-2101.423) * (-2097.710) (-2097.505) (-2099.293) [-2100.769] -- 0:00:59 105000 -- (-2103.646) [-2096.805] (-2103.682) (-2098.698) * (-2100.379) (-2099.551) (-2098.224) [-2102.423] -- 0:00:59 Average standard deviation of split frequencies: 0.018023 105500 -- (-2100.598) (-2097.642) [-2105.466] (-2097.657) * [-2103.017] (-2101.717) (-2100.983) (-2099.582) -- 0:00:59 106000 -- (-2099.737) [-2097.645] (-2112.641) (-2097.123) * [-2099.714] (-2099.136) (-2098.565) (-2100.652) -- 0:00:59 106500 -- (-2100.857) (-2099.166) (-2112.084) [-2097.475] * (-2100.705) (-2099.684) [-2097.268] (-2099.692) -- 0:00:58 107000 -- (-2099.925) (-2103.235) (-2108.968) [-2097.721] * [-2098.672] (-2099.539) (-2096.217) (-2099.439) -- 0:00:58 107500 -- [-2097.963] (-2098.670) (-2104.362) (-2098.181) * (-2097.148) [-2098.386] (-2096.345) (-2097.709) -- 0:00:58 108000 -- [-2097.943] (-2100.265) (-2106.611) (-2098.568) * (-2096.949) (-2097.808) [-2096.345] (-2097.673) -- 0:00:57 108500 -- [-2096.667] (-2100.381) (-2108.660) (-2098.580) * (-2098.805) (-2101.903) (-2096.735) [-2097.472] -- 0:00:57 109000 -- (-2097.859) (-2101.198) [-2103.552] (-2099.156) * (-2101.386) (-2103.462) [-2098.178] (-2098.075) -- 0:00:57 109500 -- (-2097.583) [-2100.940] (-2106.373) (-2099.462) * [-2102.717] (-2102.215) (-2097.680) (-2097.813) -- 0:00:56 110000 -- [-2098.591] (-2099.461) (-2110.508) (-2099.925) * [-2098.440] (-2104.175) (-2102.682) (-2098.054) -- 0:00:56 Average standard deviation of split frequencies: 0.016590 110500 -- (-2097.797) [-2097.565] (-2111.356) (-2099.152) * (-2105.256) (-2101.251) [-2101.373] (-2097.576) -- 0:00:56 111000 -- (-2097.193) (-2098.317) (-2108.561) [-2098.880] * (-2099.077) (-2108.347) (-2099.087) [-2099.677] -- 0:00:56 111500 -- [-2097.720] (-2096.898) (-2103.647) (-2098.634) * (-2097.729) (-2110.586) (-2099.806) [-2101.657] -- 0:00:55 112000 -- (-2097.339) [-2096.997] (-2101.067) (-2097.329) * [-2097.232] (-2102.524) (-2098.767) (-2099.683) -- 0:00:55 112500 -- (-2097.185) (-2097.577) (-2101.656) [-2099.402] * (-2097.526) (-2099.541) (-2099.908) [-2102.586] -- 0:00:55 113000 -- (-2096.909) (-2101.928) (-2102.061) [-2097.318] * [-2097.906] (-2099.675) (-2098.635) (-2099.773) -- 0:01:02 113500 -- [-2098.170] (-2105.869) (-2099.508) (-2098.446) * (-2098.365) (-2099.937) [-2098.601] (-2100.362) -- 0:01:02 114000 -- (-2097.420) [-2098.693] (-2098.055) (-2097.750) * [-2096.686] (-2098.976) (-2097.324) (-2097.755) -- 0:01:02 114500 -- [-2097.898] (-2102.540) (-2098.405) (-2098.366) * (-2098.604) (-2099.346) (-2099.437) [-2097.963] -- 0:01:01 115000 -- (-2097.434) (-2098.093) (-2102.947) [-2097.613] * (-2098.573) (-2096.345) [-2099.092] (-2098.596) -- 0:01:01 Average standard deviation of split frequencies: 0.017158 115500 -- [-2096.852] (-2101.015) (-2100.778) (-2097.696) * [-2098.043] (-2097.717) (-2106.401) (-2099.467) -- 0:01:01 116000 -- (-2101.705) (-2101.822) [-2099.298] (-2100.703) * [-2098.471] (-2098.427) (-2101.982) (-2098.102) -- 0:01:00 116500 -- (-2100.076) (-2099.815) [-2096.947] (-2100.892) * (-2098.464) (-2100.433) (-2097.854) [-2098.425] -- 0:01:00 117000 -- (-2101.692) (-2099.071) [-2096.752] (-2097.138) * (-2099.961) (-2097.940) [-2098.171] (-2099.254) -- 0:01:00 117500 -- (-2101.561) (-2099.686) [-2096.495] (-2098.479) * (-2097.150) [-2097.955] (-2098.776) (-2097.952) -- 0:01:00 118000 -- (-2098.102) (-2098.409) (-2097.531) [-2097.408] * (-2097.824) [-2097.781] (-2099.372) (-2097.871) -- 0:00:59 118500 -- [-2098.191] (-2098.934) (-2096.276) (-2097.365) * [-2100.796] (-2099.530) (-2097.698) (-2100.533) -- 0:00:59 119000 -- [-2098.386] (-2101.598) (-2097.656) (-2096.932) * (-2098.007) (-2097.426) [-2096.289] (-2099.082) -- 0:00:59 119500 -- [-2100.252] (-2099.331) (-2096.990) (-2097.326) * (-2104.661) [-2099.325] (-2096.163) (-2099.003) -- 0:00:58 120000 -- [-2098.989] (-2100.946) (-2097.042) (-2097.795) * (-2099.745) [-2098.513] (-2098.349) (-2100.694) -- 0:00:58 Average standard deviation of split frequencies: 0.018231 120500 -- [-2099.511] (-2101.077) (-2099.605) (-2097.539) * (-2097.410) (-2099.567) (-2098.128) [-2098.275] -- 0:00:58 121000 -- [-2098.888] (-2097.286) (-2101.591) (-2099.561) * (-2097.192) (-2098.817) [-2101.156] (-2096.999) -- 0:00:58 121500 -- (-2099.370) (-2098.812) (-2102.872) [-2099.141] * (-2100.172) [-2100.941] (-2098.104) (-2098.418) -- 0:00:57 122000 -- (-2098.982) (-2099.663) [-2098.341] (-2097.319) * (-2098.311) (-2100.422) (-2098.831) [-2098.890] -- 0:00:57 122500 -- (-2100.624) (-2097.857) (-2098.219) [-2096.927] * [-2101.616] (-2098.207) (-2100.715) (-2099.075) -- 0:00:57 123000 -- (-2100.487) (-2099.908) [-2098.235] (-2097.243) * (-2104.795) (-2097.988) (-2097.616) [-2099.287] -- 0:00:57 123500 -- (-2102.792) (-2099.334) [-2098.416] (-2097.296) * (-2105.074) (-2100.507) (-2098.779) [-2099.297] -- 0:00:56 124000 -- (-2099.132) [-2099.027] (-2098.004) (-2099.358) * [-2099.061] (-2102.981) (-2097.634) (-2099.416) -- 0:00:56 124500 -- (-2102.257) (-2100.870) [-2097.962] (-2097.881) * (-2099.437) (-2099.651) [-2096.331] (-2099.075) -- 0:00:56 125000 -- [-2100.524] (-2097.835) (-2098.395) (-2096.735) * (-2098.690) [-2102.209] (-2096.468) (-2099.102) -- 0:00:56 Average standard deviation of split frequencies: 0.018519 125500 -- (-2100.514) [-2097.859] (-2096.474) (-2098.207) * [-2097.191] (-2103.714) (-2096.350) (-2098.665) -- 0:00:55 126000 -- (-2097.420) [-2098.026] (-2097.012) (-2097.260) * [-2097.465] (-2098.415) (-2096.726) (-2098.695) -- 0:00:55 126500 -- [-2098.326] (-2097.703) (-2099.585) (-2097.647) * (-2099.269) [-2098.696] (-2100.204) (-2099.335) -- 0:00:55 127000 -- [-2099.403] (-2097.604) (-2100.215) (-2097.067) * [-2097.961] (-2099.327) (-2097.867) (-2098.507) -- 0:00:54 127500 -- (-2098.502) (-2097.354) (-2099.694) [-2097.384] * (-2101.493) (-2097.996) [-2097.168] (-2098.237) -- 0:00:54 128000 -- (-2097.860) [-2097.456] (-2099.189) (-2097.715) * [-2100.293] (-2097.503) (-2097.716) (-2099.062) -- 0:01:01 128500 -- (-2099.121) [-2098.474] (-2098.669) (-2097.292) * (-2097.607) [-2096.981] (-2096.537) (-2100.456) -- 0:01:01 129000 -- [-2097.830] (-2098.456) (-2099.458) (-2098.280) * (-2097.595) (-2097.034) (-2096.814) [-2100.088] -- 0:01:00 129500 -- (-2099.405) (-2097.008) [-2099.314] (-2098.576) * (-2099.363) (-2097.297) (-2097.767) [-2098.406] -- 0:01:00 130000 -- (-2101.733) (-2098.273) (-2099.907) [-2096.701] * (-2098.322) (-2098.356) (-2101.090) [-2099.631] -- 0:01:00 Average standard deviation of split frequencies: 0.018038 130500 -- [-2100.673] (-2099.565) (-2098.527) (-2097.321) * (-2096.567) [-2100.637] (-2097.085) (-2097.802) -- 0:00:59 131000 -- (-2104.335) (-2103.247) [-2098.455] (-2097.129) * (-2096.613) (-2098.802) (-2099.962) [-2100.208] -- 0:00:59 131500 -- (-2105.055) (-2103.013) (-2097.633) [-2097.020] * (-2102.492) (-2098.351) [-2096.235] (-2100.766) -- 0:00:59 132000 -- [-2098.096] (-2098.983) (-2101.909) (-2100.103) * (-2096.569) (-2102.909) [-2102.482] (-2102.103) -- 0:00:59 132500 -- (-2098.850) [-2098.447] (-2099.428) (-2101.526) * (-2097.960) (-2100.761) [-2099.552] (-2097.583) -- 0:00:58 133000 -- (-2100.512) (-2097.321) (-2098.206) [-2096.679] * [-2099.015] (-2099.251) (-2097.759) (-2098.197) -- 0:00:58 133500 -- (-2104.854) (-2100.816) (-2098.206) [-2099.139] * (-2099.276) (-2100.067) [-2099.099] (-2096.849) -- 0:00:58 134000 -- (-2105.529) [-2099.871] (-2104.591) (-2098.933) * [-2098.386] (-2101.056) (-2099.897) (-2099.115) -- 0:00:58 134500 -- (-2098.501) [-2099.013] (-2099.367) (-2099.916) * (-2096.641) [-2099.124] (-2096.719) (-2099.181) -- 0:00:57 135000 -- (-2098.361) (-2098.521) (-2099.690) [-2096.284] * (-2100.494) (-2099.328) [-2096.925] (-2102.884) -- 0:00:57 Average standard deviation of split frequencies: 0.017804 135500 -- [-2098.761] (-2096.911) (-2101.892) (-2096.284) * [-2097.900] (-2098.835) (-2097.886) (-2101.878) -- 0:00:57 136000 -- (-2100.935) (-2099.628) (-2099.069) [-2098.278] * (-2097.443) [-2099.027] (-2097.368) (-2099.268) -- 0:00:57 136500 -- [-2098.719] (-2098.517) (-2099.535) (-2100.421) * (-2097.713) (-2098.156) (-2100.027) [-2099.938] -- 0:00:56 137000 -- (-2100.268) (-2099.887) [-2097.987] (-2096.632) * (-2096.810) [-2097.641] (-2098.493) (-2099.233) -- 0:00:56 137500 -- (-2100.217) [-2098.960] (-2101.699) (-2096.510) * (-2096.881) [-2098.662] (-2097.219) (-2098.027) -- 0:00:56 138000 -- (-2100.199) (-2097.860) (-2099.245) [-2096.592] * (-2098.920) (-2098.936) [-2096.557] (-2097.557) -- 0:00:56 138500 -- (-2099.438) (-2097.798) [-2098.785] (-2097.047) * [-2098.570] (-2100.264) (-2098.465) (-2099.946) -- 0:00:55 139000 -- [-2097.907] (-2097.736) (-2098.993) (-2109.747) * (-2100.887) (-2099.997) (-2100.138) [-2097.593] -- 0:00:55 139500 -- (-2097.184) (-2097.767) (-2098.213) [-2100.889] * (-2098.088) (-2098.124) [-2097.311] (-2100.006) -- 0:00:55 140000 -- [-2097.273] (-2097.797) (-2097.724) (-2099.094) * (-2099.045) [-2097.908] (-2097.832) (-2100.466) -- 0:00:55 Average standard deviation of split frequencies: 0.017285 140500 -- (-2099.413) [-2097.517] (-2098.857) (-2100.192) * (-2100.155) [-2096.979] (-2097.002) (-2098.985) -- 0:00:55 141000 -- (-2099.426) [-2096.619] (-2100.280) (-2103.415) * [-2098.512] (-2098.977) (-2097.120) (-2101.476) -- 0:00:54 141500 -- (-2099.618) (-2100.424) [-2098.418] (-2097.283) * (-2099.068) (-2097.649) (-2097.699) [-2100.608] -- 0:00:54 142000 -- (-2098.228) (-2100.243) (-2098.238) [-2097.874] * (-2098.494) (-2097.216) [-2099.352] (-2098.661) -- 0:00:54 142500 -- (-2105.447) (-2103.930) (-2099.660) [-2096.475] * (-2098.069) (-2096.799) [-2098.384] (-2099.410) -- 0:00:54 143000 -- (-2108.403) [-2104.143] (-2099.699) (-2098.261) * (-2098.264) [-2099.714] (-2098.469) (-2099.009) -- 0:00:59 143500 -- (-2105.331) (-2099.524) [-2098.266] (-2100.635) * (-2097.209) (-2103.129) [-2098.470] (-2097.498) -- 0:00:59 144000 -- [-2099.252] (-2097.618) (-2099.154) (-2102.198) * (-2097.997) [-2103.562] (-2097.189) (-2100.839) -- 0:00:59 144500 -- (-2099.408) [-2098.227] (-2100.547) (-2099.610) * (-2098.246) [-2098.848] (-2097.835) (-2101.683) -- 0:00:59 145000 -- (-2098.535) (-2097.917) [-2099.912] (-2098.440) * (-2099.926) (-2100.125) [-2098.338] (-2106.464) -- 0:00:58 Average standard deviation of split frequencies: 0.019065 145500 -- [-2098.869] (-2098.444) (-2103.159) (-2097.203) * (-2098.546) (-2098.985) (-2097.559) [-2103.449] -- 0:00:58 146000 -- [-2098.414] (-2097.405) (-2103.445) (-2099.388) * (-2098.813) (-2098.597) [-2096.689] (-2098.934) -- 0:00:58 146500 -- (-2097.078) [-2097.963] (-2103.851) (-2099.296) * (-2100.416) (-2096.767) [-2097.332] (-2100.631) -- 0:00:58 147000 -- (-2096.953) [-2097.991] (-2096.635) (-2101.056) * (-2099.838) (-2098.778) (-2096.847) [-2100.396] -- 0:00:58 147500 -- (-2098.532) (-2097.307) (-2097.433) [-2099.116] * (-2098.332) [-2098.638] (-2098.729) (-2099.791) -- 0:00:57 148000 -- (-2096.902) [-2098.371] (-2099.690) (-2100.926) * [-2097.912] (-2098.552) (-2099.060) (-2099.126) -- 0:00:57 148500 -- (-2099.659) (-2098.488) [-2098.097] (-2098.139) * [-2097.036] (-2096.848) (-2098.357) (-2098.788) -- 0:00:57 149000 -- [-2098.941] (-2100.187) (-2096.866) (-2097.276) * (-2098.110) [-2097.483] (-2099.011) (-2097.595) -- 0:00:57 149500 -- [-2098.023] (-2102.357) (-2096.866) (-2098.488) * (-2097.119) [-2097.565] (-2097.914) (-2097.379) -- 0:00:56 150000 -- [-2097.933] (-2097.393) (-2097.186) (-2098.240) * (-2097.047) [-2098.875] (-2101.789) (-2097.742) -- 0:00:56 Average standard deviation of split frequencies: 0.017949 150500 -- (-2097.264) [-2100.214] (-2097.257) (-2099.131) * (-2096.907) [-2098.387] (-2101.052) (-2098.239) -- 0:00:56 151000 -- (-2098.964) (-2104.537) [-2097.203] (-2102.248) * (-2097.507) (-2098.789) (-2098.383) [-2097.880] -- 0:00:56 151500 -- (-2097.774) (-2103.482) (-2097.692) [-2103.657] * (-2097.956) (-2097.798) (-2098.530) [-2097.038] -- 0:00:56 152000 -- (-2100.709) (-2102.825) (-2099.451) [-2101.652] * (-2098.762) [-2097.898] (-2099.014) (-2099.199) -- 0:00:55 152500 -- (-2106.024) (-2098.747) (-2099.974) [-2104.340] * (-2098.762) [-2098.858] (-2098.113) (-2098.318) -- 0:00:55 153000 -- [-2101.517] (-2100.268) (-2097.844) (-2097.194) * (-2098.649) (-2097.773) (-2100.310) [-2098.293] -- 0:00:55 153500 -- (-2100.301) (-2100.713) (-2097.844) [-2096.592] * (-2096.978) (-2098.942) (-2099.875) [-2097.864] -- 0:00:55 154000 -- (-2103.550) (-2099.304) (-2098.366) [-2096.957] * (-2099.109) [-2098.048] (-2104.692) (-2096.881) -- 0:00:54 154500 -- (-2101.647) [-2099.074] (-2098.013) (-2098.678) * (-2101.184) (-2099.071) [-2099.614] (-2097.092) -- 0:00:54 155000 -- (-2100.262) (-2102.046) (-2096.809) [-2096.382] * (-2098.656) (-2104.728) (-2098.849) [-2097.093] -- 0:00:54 Average standard deviation of split frequencies: 0.018584 155500 -- (-2099.628) (-2099.814) (-2099.852) [-2096.377] * [-2096.968] (-2096.138) (-2097.920) (-2096.651) -- 0:00:54 156000 -- [-2099.556] (-2100.552) (-2099.863) (-2098.528) * [-2096.901] (-2096.618) (-2097.955) (-2100.328) -- 0:00:54 156500 -- (-2099.114) [-2100.967] (-2100.211) (-2099.959) * [-2096.475] (-2097.101) (-2098.811) (-2096.815) -- 0:00:53 157000 -- (-2096.777) (-2099.682) (-2102.551) [-2097.611] * [-2096.992] (-2097.101) (-2099.118) (-2100.763) -- 0:00:53 157500 -- [-2096.833] (-2099.622) (-2108.747) (-2098.715) * (-2099.606) (-2099.575) (-2099.085) [-2098.679] -- 0:00:58 158000 -- [-2098.573] (-2099.217) (-2105.980) (-2098.399) * [-2099.126] (-2096.698) (-2103.733) (-2096.796) -- 0:00:58 158500 -- (-2098.782) (-2099.585) [-2098.982] (-2098.660) * (-2098.963) (-2096.730) [-2101.785] (-2097.205) -- 0:00:58 159000 -- [-2098.706] (-2101.802) (-2099.101) (-2102.463) * (-2096.859) (-2096.866) (-2100.027) [-2097.014] -- 0:00:58 159500 -- (-2097.729) (-2099.015) (-2098.787) [-2097.785] * [-2097.402] (-2096.361) (-2097.839) (-2097.048) -- 0:00:57 160000 -- (-2097.698) [-2097.385] (-2100.780) (-2098.983) * (-2096.338) (-2096.393) [-2099.278] (-2097.777) -- 0:00:57 Average standard deviation of split frequencies: 0.017295 160500 -- [-2097.768] (-2097.044) (-2098.582) (-2098.875) * (-2097.720) (-2097.267) (-2098.837) [-2097.832] -- 0:00:57 161000 -- (-2097.714) (-2098.566) [-2099.642] (-2098.361) * (-2099.726) (-2097.273) (-2098.972) [-2097.588] -- 0:00:57 161500 -- (-2097.827) (-2096.957) (-2098.148) [-2097.888] * (-2097.311) (-2100.374) [-2097.868] (-2097.752) -- 0:00:57 162000 -- (-2101.515) (-2097.105) (-2098.502) [-2099.115] * (-2097.311) [-2098.212] (-2097.618) (-2099.167) -- 0:00:56 162500 -- (-2104.189) (-2097.703) [-2098.418] (-2096.798) * [-2097.381] (-2097.226) (-2096.900) (-2096.998) -- 0:00:56 163000 -- (-2104.460) (-2097.595) [-2098.232] (-2096.725) * (-2098.086) (-2097.697) [-2098.231] (-2097.623) -- 0:00:56 163500 -- (-2102.147) (-2097.509) [-2098.641] (-2098.183) * (-2097.141) [-2100.546] (-2097.687) (-2101.347) -- 0:00:56 164000 -- (-2097.342) (-2097.004) [-2099.444] (-2099.887) * [-2097.184] (-2100.255) (-2097.911) (-2101.131) -- 0:00:56 164500 -- (-2098.634) (-2097.705) [-2099.766] (-2098.745) * (-2098.063) (-2097.389) [-2097.394] (-2100.081) -- 0:00:55 165000 -- (-2097.159) (-2099.236) (-2099.204) [-2097.453] * (-2099.974) (-2098.346) [-2098.197] (-2100.323) -- 0:00:55 Average standard deviation of split frequencies: 0.017188 165500 -- (-2096.695) (-2100.834) [-2098.466] (-2100.744) * (-2098.821) (-2099.854) (-2098.051) [-2099.947] -- 0:00:55 166000 -- [-2099.146] (-2101.628) (-2098.699) (-2100.641) * (-2098.472) (-2099.688) [-2097.101] (-2098.654) -- 0:00:55 166500 -- (-2099.978) [-2098.378] (-2100.683) (-2099.564) * (-2102.918) (-2101.158) (-2097.992) [-2098.471] -- 0:00:55 167000 -- (-2098.300) (-2097.633) (-2098.949) [-2099.400] * (-2097.501) (-2099.184) [-2096.549] (-2096.965) -- 0:00:54 167500 -- (-2100.934) (-2098.078) (-2097.576) [-2097.060] * (-2096.915) (-2098.008) [-2096.447] (-2097.912) -- 0:00:54 168000 -- (-2096.593) (-2097.376) [-2098.208] (-2097.060) * (-2098.675) (-2097.949) [-2098.419] (-2097.427) -- 0:00:54 168500 -- (-2097.311) (-2097.752) [-2097.488] (-2096.710) * (-2103.198) [-2098.407] (-2096.905) (-2097.517) -- 0:00:54 169000 -- (-2097.150) [-2097.661] (-2098.708) (-2098.955) * [-2102.881] (-2097.998) (-2096.876) (-2096.375) -- 0:00:54 169500 -- (-2097.899) (-2098.714) [-2097.228] (-2097.950) * (-2097.463) [-2097.960] (-2097.936) (-2097.734) -- 0:00:53 170000 -- [-2097.771] (-2097.309) (-2097.314) (-2097.125) * [-2098.830] (-2097.489) (-2096.467) (-2097.810) -- 0:00:53 Average standard deviation of split frequencies: 0.016573 170500 -- (-2097.633) (-2099.070) [-2097.161] (-2102.185) * (-2101.351) [-2098.741] (-2096.445) (-2097.730) -- 0:00:53 171000 -- (-2099.512) [-2097.168] (-2096.696) (-2097.419) * (-2104.999) (-2098.864) [-2099.512] (-2098.305) -- 0:00:53 171500 -- (-2099.874) [-2097.070] (-2099.437) (-2097.691) * (-2102.321) (-2096.525) [-2099.587] (-2098.348) -- 0:00:57 172000 -- [-2099.501] (-2099.347) (-2098.047) (-2097.639) * (-2102.304) [-2096.759] (-2098.759) (-2100.497) -- 0:00:57 172500 -- [-2096.601] (-2099.423) (-2101.979) (-2098.720) * (-2101.506) (-2096.781) (-2096.605) [-2099.460] -- 0:00:57 173000 -- (-2096.788) (-2100.005) (-2098.896) [-2097.519] * (-2101.483) (-2096.596) (-2098.429) [-2101.660] -- 0:00:57 173500 -- [-2096.778] (-2099.820) (-2096.366) (-2097.879) * (-2102.752) [-2096.914] (-2098.474) (-2099.665) -- 0:00:57 174000 -- (-2097.020) (-2100.073) [-2096.409] (-2097.822) * [-2097.405] (-2096.937) (-2101.606) (-2096.518) -- 0:00:56 174500 -- (-2099.043) (-2101.708) [-2097.563] (-2097.600) * (-2097.860) [-2097.943] (-2098.451) (-2096.728) -- 0:00:56 175000 -- [-2098.325] (-2102.006) (-2099.400) (-2098.863) * (-2099.500) (-2096.983) [-2097.439] (-2099.382) -- 0:00:56 Average standard deviation of split frequencies: 0.017480 175500 -- (-2098.320) (-2101.909) [-2099.153] (-2097.996) * (-2098.598) (-2099.170) [-2097.703] (-2100.210) -- 0:00:56 176000 -- [-2098.295] (-2099.868) (-2099.464) (-2097.908) * [-2096.719] (-2097.931) (-2100.518) (-2100.467) -- 0:00:56 176500 -- [-2097.416] (-2098.835) (-2102.594) (-2098.135) * [-2097.311] (-2097.879) (-2098.269) (-2100.997) -- 0:00:55 177000 -- [-2098.928] (-2100.233) (-2098.509) (-2097.319) * (-2096.995) (-2098.304) (-2099.940) [-2098.738] -- 0:00:55 177500 -- [-2098.763] (-2099.388) (-2100.332) (-2096.909) * (-2097.506) (-2096.967) (-2100.620) [-2098.940] -- 0:00:55 178000 -- (-2100.828) (-2097.184) [-2098.035] (-2102.985) * [-2098.199] (-2097.389) (-2100.339) (-2100.354) -- 0:00:55 178500 -- (-2098.510) [-2100.116] (-2097.753) (-2097.528) * [-2097.990] (-2102.788) (-2101.562) (-2098.886) -- 0:00:55 179000 -- (-2096.273) [-2098.471] (-2097.535) (-2097.649) * [-2098.945] (-2101.133) (-2102.565) (-2098.831) -- 0:00:55 179500 -- [-2097.169] (-2097.261) (-2098.248) (-2098.832) * (-2099.193) [-2100.269] (-2099.702) (-2099.422) -- 0:00:54 180000 -- (-2099.368) [-2097.531] (-2098.313) (-2098.392) * (-2099.263) [-2100.550] (-2103.080) (-2099.485) -- 0:00:54 Average standard deviation of split frequencies: 0.018127 180500 -- (-2100.829) [-2096.717] (-2097.618) (-2102.824) * (-2096.247) [-2097.563] (-2097.774) (-2101.666) -- 0:00:54 181000 -- (-2099.840) (-2100.900) [-2097.420] (-2100.718) * [-2097.049] (-2100.107) (-2097.687) (-2098.183) -- 0:00:54 181500 -- (-2100.494) (-2099.304) (-2097.223) [-2098.666] * (-2100.178) (-2100.228) [-2099.148] (-2098.945) -- 0:00:54 182000 -- (-2104.789) [-2098.628] (-2100.374) (-2097.350) * [-2097.527] (-2099.139) (-2102.518) (-2100.361) -- 0:00:53 182500 -- (-2104.943) (-2101.066) [-2096.871] (-2097.291) * [-2098.865] (-2099.280) (-2104.169) (-2101.537) -- 0:00:53 183000 -- (-2101.786) [-2097.398] (-2097.122) (-2099.642) * [-2097.347] (-2098.804) (-2098.286) (-2106.703) -- 0:00:53 183500 -- (-2099.053) [-2098.195] (-2098.029) (-2101.338) * (-2097.082) (-2097.275) [-2097.308] (-2097.850) -- 0:00:53 184000 -- (-2097.847) [-2098.510] (-2097.500) (-2100.602) * [-2100.420] (-2098.777) (-2097.302) (-2100.117) -- 0:00:53 184500 -- (-2100.587) [-2098.617] (-2099.442) (-2099.379) * [-2099.444] (-2098.666) (-2097.339) (-2098.801) -- 0:00:53 185000 -- (-2099.561) (-2097.443) [-2098.377] (-2101.453) * (-2098.413) [-2100.012] (-2098.492) (-2098.801) -- 0:00:52 Average standard deviation of split frequencies: 0.017608 185500 -- (-2100.413) [-2097.865] (-2100.288) (-2101.129) * (-2099.499) (-2097.675) [-2098.180] (-2102.426) -- 0:00:57 186000 -- (-2097.179) (-2099.313) (-2098.561) [-2101.098] * [-2097.802] (-2098.786) (-2098.203) (-2105.913) -- 0:00:56 186500 -- (-2098.564) (-2096.851) [-2096.985] (-2099.230) * (-2099.437) (-2102.055) [-2099.464] (-2101.068) -- 0:00:56 187000 -- (-2099.442) (-2098.282) [-2096.869] (-2096.699) * (-2101.007) (-2097.829) (-2098.649) [-2102.036] -- 0:00:56 187500 -- (-2099.833) (-2099.535) (-2099.127) [-2096.699] * (-2098.075) (-2097.638) [-2097.989] (-2101.319) -- 0:00:56 188000 -- (-2098.650) (-2098.795) [-2098.195] (-2103.028) * (-2098.615) [-2098.421] (-2098.152) (-2103.489) -- 0:00:56 188500 -- [-2099.009] (-2098.658) (-2097.847) (-2097.488) * (-2100.306) [-2099.088] (-2101.173) (-2104.410) -- 0:00:55 189000 -- (-2100.846) (-2099.087) (-2097.691) [-2097.471] * [-2098.624] (-2099.125) (-2099.395) (-2100.468) -- 0:00:55 189500 -- (-2100.097) (-2101.716) [-2099.088] (-2097.475) * (-2100.583) (-2096.453) [-2098.577] (-2098.236) -- 0:00:55 190000 -- (-2102.174) (-2100.674) (-2098.851) [-2098.672] * (-2098.684) (-2100.709) [-2098.960] (-2099.513) -- 0:00:55 Average standard deviation of split frequencies: 0.017678 190500 -- (-2099.637) (-2104.429) (-2098.548) [-2096.971] * [-2098.790] (-2098.384) (-2097.403) (-2101.360) -- 0:00:55 191000 -- (-2097.055) (-2098.385) [-2098.787] (-2096.754) * (-2097.922) [-2098.384] (-2098.038) (-2102.054) -- 0:00:55 191500 -- (-2097.341) [-2099.156] (-2098.927) (-2100.068) * (-2097.829) [-2097.936] (-2098.038) (-2102.264) -- 0:00:54 192000 -- (-2098.210) (-2098.095) (-2099.556) [-2097.234] * (-2097.718) (-2098.064) (-2097.008) [-2099.625] -- 0:00:54 192500 -- (-2097.683) (-2097.906) [-2098.724] (-2098.064) * [-2098.352] (-2098.425) (-2096.909) (-2098.405) -- 0:00:54 193000 -- (-2097.568) [-2098.507] (-2097.040) (-2096.831) * (-2097.142) (-2104.476) (-2098.962) [-2098.190] -- 0:00:54 193500 -- (-2098.714) (-2099.749) [-2097.036] (-2098.191) * (-2098.070) [-2097.584] (-2101.732) (-2098.190) -- 0:00:54 194000 -- (-2098.768) [-2099.641] (-2098.158) (-2097.131) * (-2098.777) [-2098.579] (-2099.322) (-2098.158) -- 0:00:54 194500 -- (-2098.761) (-2099.907) (-2097.106) [-2096.932] * (-2099.658) (-2099.636) [-2098.682] (-2097.940) -- 0:00:53 195000 -- [-2101.739] (-2098.950) (-2101.133) (-2099.074) * (-2098.795) (-2099.793) (-2097.368) [-2097.972] -- 0:00:53 Average standard deviation of split frequencies: 0.016956 195500 -- (-2097.769) (-2097.211) (-2098.626) [-2100.357] * (-2102.153) (-2099.884) (-2099.111) [-2097.328] -- 0:00:53 196000 -- (-2099.591) (-2097.647) (-2098.134) [-2099.766] * (-2099.559) [-2097.883] (-2098.187) (-2099.006) -- 0:00:53 196500 -- (-2099.293) (-2098.220) [-2097.329] (-2099.729) * (-2099.533) (-2099.550) [-2098.014] (-2103.447) -- 0:00:53 197000 -- (-2098.544) (-2098.244) (-2101.657) [-2099.087] * (-2098.393) (-2098.331) (-2098.973) [-2100.282] -- 0:00:52 197500 -- (-2098.801) (-2099.065) [-2098.266] (-2097.563) * (-2101.202) (-2096.200) [-2096.947] (-2099.723) -- 0:00:52 198000 -- (-2101.294) (-2100.851) (-2099.114) [-2097.280] * (-2101.282) [-2096.431] (-2097.978) (-2097.799) -- 0:00:52 198500 -- [-2099.083] (-2099.951) (-2098.078) (-2097.864) * (-2104.596) (-2098.835) [-2097.973] (-2098.196) -- 0:00:52 199000 -- (-2098.366) [-2097.840] (-2097.783) (-2097.686) * (-2099.822) [-2097.889] (-2097.935) (-2098.592) -- 0:00:56 199500 -- (-2101.944) (-2097.575) (-2097.490) [-2096.662] * (-2099.152) (-2097.397) [-2097.189] (-2097.429) -- 0:00:56 200000 -- (-2097.717) [-2097.923] (-2098.088) (-2096.510) * (-2097.250) [-2097.867] (-2098.250) (-2097.811) -- 0:00:55 Average standard deviation of split frequencies: 0.016797 200500 -- (-2098.402) (-2097.121) (-2099.949) [-2096.919] * (-2097.794) (-2097.148) [-2098.501] (-2096.782) -- 0:00:55 201000 -- [-2097.512] (-2100.266) (-2099.490) (-2097.843) * (-2098.982) (-2096.362) [-2097.453] (-2096.860) -- 0:00:55 201500 -- (-2102.884) [-2097.272] (-2100.536) (-2098.370) * (-2097.600) (-2098.520) (-2099.286) [-2098.049] -- 0:00:55 202000 -- (-2102.469) (-2098.391) [-2099.860] (-2099.394) * (-2100.599) [-2100.334] (-2099.485) (-2097.970) -- 0:00:55 202500 -- (-2101.176) (-2097.941) [-2098.350] (-2099.104) * (-2097.974) [-2099.504] (-2099.572) (-2099.024) -- 0:00:55 203000 -- [-2100.211] (-2097.099) (-2097.097) (-2099.104) * (-2101.188) (-2099.754) (-2097.413) [-2099.533] -- 0:00:54 203500 -- (-2098.630) (-2100.532) (-2097.457) [-2098.117] * (-2102.623) (-2099.176) [-2097.983] (-2100.428) -- 0:00:54 204000 -- [-2097.851] (-2100.274) (-2103.356) (-2098.376) * (-2101.131) (-2102.749) [-2097.720] (-2099.374) -- 0:00:54 204500 -- (-2096.893) (-2097.494) [-2102.322] (-2099.047) * (-2098.170) (-2097.763) (-2096.816) [-2099.346] -- 0:00:54 205000 -- (-2097.181) [-2099.291] (-2099.361) (-2101.301) * (-2101.860) (-2097.620) (-2096.644) [-2100.331] -- 0:00:54 Average standard deviation of split frequencies: 0.014935 205500 -- [-2097.720] (-2101.050) (-2100.943) (-2103.084) * (-2100.649) [-2098.514] (-2096.678) (-2099.265) -- 0:00:54 206000 -- (-2097.710) [-2097.583] (-2103.116) (-2101.998) * (-2104.784) (-2098.202) [-2096.737] (-2097.130) -- 0:00:53 206500 -- (-2097.022) (-2097.815) [-2101.728] (-2098.076) * (-2102.943) [-2096.517] (-2096.635) (-2098.625) -- 0:00:53 207000 -- [-2097.146] (-2098.422) (-2102.628) (-2098.741) * (-2103.440) [-2097.658] (-2096.627) (-2097.091) -- 0:00:53 207500 -- (-2098.440) [-2100.357] (-2099.526) (-2101.306) * (-2101.655) (-2096.346) [-2098.293] (-2097.517) -- 0:00:53 208000 -- [-2097.100] (-2101.487) (-2105.701) (-2098.714) * (-2099.224) (-2097.611) [-2097.579] (-2096.962) -- 0:00:53 208500 -- (-2100.500) [-2100.179] (-2101.139) (-2097.505) * (-2098.893) (-2100.454) (-2097.101) [-2099.125] -- 0:00:53 209000 -- (-2098.376) (-2100.176) (-2097.303) [-2096.536] * (-2099.573) (-2100.187) [-2097.105] (-2099.808) -- 0:00:52 209500 -- (-2100.424) (-2101.511) [-2096.899] (-2097.360) * (-2099.583) (-2100.150) (-2096.644) [-2102.709] -- 0:00:52 210000 -- (-2100.457) [-2100.860] (-2097.550) (-2101.675) * (-2099.257) (-2098.266) (-2097.694) [-2100.087] -- 0:00:52 Average standard deviation of split frequencies: 0.016253 210500 -- [-2099.135] (-2100.215) (-2097.510) (-2100.771) * [-2100.734] (-2099.239) (-2101.610) (-2097.263) -- 0:00:52 211000 -- (-2098.466) (-2099.548) [-2097.450] (-2099.850) * (-2101.928) [-2097.035] (-2100.580) (-2098.007) -- 0:00:52 211500 -- (-2100.216) [-2101.230] (-2096.774) (-2098.890) * (-2100.817) (-2099.127) [-2100.396] (-2099.496) -- 0:00:52 212000 -- (-2100.114) (-2097.431) [-2097.244] (-2098.103) * (-2100.644) (-2101.875) (-2101.037) [-2097.617] -- 0:00:52 212500 -- [-2100.542] (-2097.577) (-2098.758) (-2098.225) * (-2103.481) (-2098.075) [-2097.911] (-2105.181) -- 0:00:51 213000 -- (-2097.637) (-2098.638) (-2099.844) [-2097.779] * (-2103.027) (-2100.029) (-2097.030) [-2102.601] -- 0:00:55 213500 -- [-2097.492] (-2098.815) (-2098.983) (-2103.043) * (-2099.151) (-2098.623) (-2096.885) [-2105.706] -- 0:00:55 214000 -- (-2098.051) [-2098.763] (-2100.111) (-2101.624) * (-2098.611) (-2097.163) (-2099.321) [-2100.935] -- 0:00:55 214500 -- (-2096.902) (-2097.291) [-2099.206] (-2099.227) * (-2098.859) [-2097.249] (-2098.574) (-2101.981) -- 0:00:54 215000 -- (-2097.844) (-2097.373) [-2101.341] (-2098.926) * (-2100.107) [-2096.692] (-2098.287) (-2099.850) -- 0:00:54 Average standard deviation of split frequencies: 0.015762 215500 -- (-2099.031) (-2098.165) (-2100.480) [-2098.344] * (-2098.600) [-2096.904] (-2099.152) (-2099.835) -- 0:00:54 216000 -- (-2097.624) (-2098.495) (-2097.364) [-2098.957] * (-2096.422) (-2096.659) [-2099.576] (-2099.974) -- 0:00:54 216500 -- (-2097.781) [-2097.672] (-2097.811) (-2096.472) * [-2097.481] (-2096.516) (-2098.284) (-2097.885) -- 0:00:54 217000 -- [-2096.542] (-2099.510) (-2097.796) (-2096.502) * (-2099.154) [-2096.568] (-2097.647) (-2096.886) -- 0:00:54 217500 -- (-2096.744) (-2100.955) (-2096.943) [-2097.465] * (-2098.115) (-2096.810) [-2097.403] (-2098.361) -- 0:00:53 218000 -- [-2097.911] (-2100.392) (-2097.030) (-2099.576) * (-2100.927) (-2096.809) [-2097.202] (-2098.269) -- 0:00:53 218500 -- (-2102.998) (-2098.471) [-2098.459] (-2098.228) * (-2099.571) (-2097.516) (-2098.964) [-2098.165] -- 0:00:53 219000 -- (-2102.204) [-2098.526] (-2098.341) (-2099.810) * (-2101.216) [-2099.661] (-2099.107) (-2100.700) -- 0:00:53 219500 -- (-2102.378) (-2097.965) [-2098.011] (-2098.925) * (-2096.831) (-2098.028) [-2097.228] (-2099.187) -- 0:00:53 220000 -- (-2102.043) (-2097.867) (-2099.408) [-2098.634] * (-2096.547) [-2098.596] (-2099.372) (-2097.022) -- 0:00:53 Average standard deviation of split frequencies: 0.015191 220500 -- (-2100.972) (-2098.448) (-2098.890) [-2099.136] * [-2096.657] (-2097.228) (-2099.588) (-2097.522) -- 0:00:53 221000 -- (-2100.251) [-2098.866] (-2100.665) (-2099.154) * (-2096.530) (-2101.279) (-2101.011) [-2098.333] -- 0:00:52 221500 -- (-2097.933) [-2100.753] (-2098.379) (-2099.213) * (-2096.771) (-2106.339) [-2101.647] (-2097.965) -- 0:00:52 222000 -- (-2099.310) [-2097.780] (-2097.854) (-2102.217) * [-2096.932] (-2100.962) (-2102.508) (-2097.613) -- 0:00:52 222500 -- (-2099.984) (-2100.181) (-2098.902) [-2098.470] * (-2098.763) [-2101.713] (-2101.759) (-2099.095) -- 0:00:52 223000 -- (-2099.837) [-2098.964] (-2102.778) (-2099.277) * (-2105.442) (-2101.903) (-2102.625) [-2099.327] -- 0:00:52 223500 -- (-2102.581) (-2102.873) (-2098.172) [-2099.039] * (-2099.190) (-2103.698) (-2096.728) [-2100.828] -- 0:00:52 224000 -- (-2103.191) [-2099.764] (-2098.339) (-2099.633) * (-2100.997) (-2099.102) (-2098.989) [-2100.104] -- 0:00:51 224500 -- (-2099.579) (-2100.354) (-2102.638) [-2098.571] * [-2099.992] (-2099.778) (-2096.192) (-2098.437) -- 0:00:51 225000 -- [-2097.992] (-2101.625) (-2100.178) (-2098.005) * (-2098.353) (-2101.531) (-2096.904) [-2098.282] -- 0:00:51 Average standard deviation of split frequencies: 0.014711 225500 -- (-2098.562) (-2101.295) (-2099.104) [-2098.057] * (-2098.702) (-2098.872) [-2097.190] (-2097.714) -- 0:00:51 226000 -- (-2098.253) [-2101.717] (-2097.151) (-2099.119) * (-2097.713) (-2097.493) (-2101.025) [-2097.339] -- 0:00:51 226500 -- [-2100.374] (-2099.648) (-2097.596) (-2101.503) * (-2098.119) (-2097.409) [-2103.263] (-2100.821) -- 0:00:51 227000 -- (-2099.463) (-2100.048) [-2098.398] (-2099.398) * (-2096.947) (-2099.720) [-2097.209] (-2106.509) -- 0:00:54 227500 -- (-2098.253) (-2097.985) [-2099.637] (-2099.178) * (-2097.526) [-2098.741] (-2097.752) (-2101.880) -- 0:00:54 228000 -- (-2103.592) (-2100.275) [-2099.975] (-2099.034) * (-2099.196) (-2098.535) [-2097.206] (-2102.204) -- 0:00:54 228500 -- (-2097.230) (-2098.334) [-2096.500] (-2097.393) * (-2098.635) [-2098.570] (-2099.742) (-2099.226) -- 0:00:54 229000 -- (-2097.480) (-2098.889) (-2096.856) [-2096.689] * (-2098.880) (-2099.601) [-2098.664] (-2099.669) -- 0:00:53 229500 -- (-2096.423) (-2100.930) (-2096.660) [-2097.090] * (-2103.569) (-2098.404) [-2098.410] (-2099.781) -- 0:00:53 230000 -- (-2097.216) (-2098.276) (-2096.888) [-2097.148] * [-2099.612] (-2099.667) (-2098.387) (-2098.243) -- 0:00:53 Average standard deviation of split frequencies: 0.013338 230500 -- (-2097.259) (-2098.244) (-2097.030) [-2097.224] * (-2102.091) [-2097.976] (-2100.600) (-2098.848) -- 0:00:53 231000 -- [-2096.609] (-2098.223) (-2099.280) (-2097.243) * (-2102.804) (-2099.872) [-2097.473] (-2099.153) -- 0:00:53 231500 -- [-2096.618] (-2100.406) (-2101.367) (-2100.554) * (-2102.167) (-2101.524) (-2097.348) [-2100.256] -- 0:00:53 232000 -- [-2098.788] (-2098.404) (-2098.015) (-2097.187) * [-2098.963] (-2099.825) (-2100.947) (-2097.826) -- 0:00:52 232500 -- (-2105.533) [-2097.762] (-2099.021) (-2097.225) * (-2096.760) (-2097.034) (-2100.333) [-2098.340] -- 0:00:52 233000 -- [-2099.471] (-2098.007) (-2097.097) (-2097.133) * (-2102.651) [-2097.104] (-2100.261) (-2099.529) -- 0:00:52 233500 -- [-2100.393] (-2099.593) (-2097.097) (-2097.181) * (-2100.938) (-2100.769) [-2099.306] (-2102.056) -- 0:00:52 234000 -- [-2101.821] (-2097.157) (-2101.513) (-2099.641) * (-2098.848) [-2097.329] (-2101.458) (-2097.883) -- 0:00:52 234500 -- [-2098.033] (-2097.195) (-2097.405) (-2096.782) * (-2097.183) (-2101.899) [-2102.932] (-2097.934) -- 0:00:52 235000 -- (-2098.734) [-2098.190] (-2097.439) (-2097.050) * [-2101.495] (-2101.973) (-2099.052) (-2098.574) -- 0:00:52 Average standard deviation of split frequencies: 0.013036 235500 -- (-2097.492) [-2098.431] (-2097.685) (-2097.672) * (-2102.431) [-2101.222] (-2100.186) (-2099.247) -- 0:00:51 236000 -- (-2096.938) (-2102.989) [-2097.725] (-2096.274) * (-2099.275) (-2100.269) (-2097.127) [-2100.582] -- 0:00:51 236500 -- (-2096.611) [-2098.588] (-2097.665) (-2099.815) * (-2108.702) [-2101.376] (-2098.471) (-2098.555) -- 0:00:51 237000 -- (-2096.965) [-2097.739] (-2097.880) (-2097.943) * [-2099.778] (-2100.304) (-2096.670) (-2098.504) -- 0:00:51 237500 -- [-2096.965] (-2097.709) (-2098.727) (-2098.350) * (-2101.452) (-2099.733) (-2096.406) [-2101.278] -- 0:00:51 238000 -- (-2097.549) (-2097.509) (-2096.766) [-2098.168] * (-2099.393) (-2096.774) (-2096.446) [-2101.125] -- 0:00:51 238500 -- (-2097.241) (-2097.411) (-2096.545) [-2099.002] * (-2100.500) [-2097.286] (-2096.727) (-2098.517) -- 0:00:51 239000 -- (-2097.159) (-2104.723) [-2098.649] (-2104.204) * (-2099.557) (-2096.982) (-2098.266) [-2099.510] -- 0:00:50 239500 -- (-2101.395) [-2098.382] (-2098.381) (-2101.752) * (-2100.908) (-2096.169) (-2099.545) [-2098.633] -- 0:00:50 240000 -- (-2099.944) (-2096.841) [-2097.709] (-2098.258) * (-2099.662) (-2102.414) (-2096.999) [-2099.655] -- 0:00:50 Average standard deviation of split frequencies: 0.014979 240500 -- (-2102.093) (-2097.049) (-2097.035) [-2097.173] * (-2099.247) (-2101.781) [-2098.548] (-2096.225) -- 0:00:50 241000 -- [-2098.780] (-2101.650) (-2097.035) (-2097.816) * [-2097.271] (-2097.358) (-2099.151) (-2098.616) -- 0:00:53 241500 -- (-2097.261) (-2097.168) [-2097.468] (-2099.853) * (-2097.997) [-2097.406] (-2100.812) (-2097.138) -- 0:00:53 242000 -- (-2100.341) (-2097.012) (-2097.163) [-2100.213] * (-2099.962) [-2098.299] (-2099.544) (-2097.202) -- 0:00:53 242500 -- (-2100.015) (-2097.008) (-2100.309) [-2098.246] * (-2100.961) (-2098.403) (-2100.421) [-2096.347] -- 0:00:53 243000 -- (-2099.767) (-2096.447) [-2097.612] (-2099.900) * (-2098.981) [-2098.112] (-2097.772) (-2097.433) -- 0:00:52 243500 -- (-2097.277) [-2097.385] (-2099.416) (-2099.659) * (-2098.563) (-2100.687) [-2098.194] (-2098.782) -- 0:00:52 244000 -- (-2097.504) (-2097.709) (-2096.818) [-2098.304] * [-2097.787] (-2098.703) (-2100.163) (-2101.069) -- 0:00:52 244500 -- [-2099.384] (-2097.962) (-2096.585) (-2098.230) * (-2097.334) (-2100.357) [-2101.048] (-2103.845) -- 0:00:52 245000 -- (-2097.295) [-2097.304] (-2098.041) (-2099.986) * [-2097.384] (-2097.915) (-2099.997) (-2103.440) -- 0:00:52 Average standard deviation of split frequencies: 0.015437 245500 -- (-2099.013) [-2099.265] (-2099.940) (-2100.024) * [-2099.867] (-2099.049) (-2097.819) (-2098.532) -- 0:00:52 246000 -- (-2096.640) (-2099.265) [-2098.291] (-2099.357) * [-2097.712] (-2101.360) (-2097.751) (-2099.252) -- 0:00:52 246500 -- [-2097.118] (-2103.262) (-2097.772) (-2100.151) * (-2098.796) (-2098.551) [-2097.776] (-2099.720) -- 0:00:51 247000 -- (-2096.465) (-2100.444) [-2098.229] (-2098.929) * (-2098.805) (-2099.759) [-2100.745] (-2099.398) -- 0:00:51 247500 -- [-2096.415] (-2100.353) (-2101.193) (-2097.891) * (-2101.088) (-2100.848) [-2098.748] (-2099.253) -- 0:00:51 248000 -- (-2100.134) [-2099.938] (-2098.334) (-2097.312) * [-2097.126] (-2096.732) (-2099.386) (-2097.915) -- 0:00:51 248500 -- (-2097.180) (-2100.515) (-2102.932) [-2097.312] * [-2097.951] (-2098.640) (-2101.871) (-2098.044) -- 0:00:51 249000 -- (-2096.694) (-2100.113) [-2099.620] (-2098.736) * (-2096.820) (-2099.764) [-2100.225] (-2100.594) -- 0:00:51 249500 -- (-2096.624) (-2097.711) (-2097.430) [-2097.423] * (-2098.218) (-2097.987) (-2096.937) [-2098.919] -- 0:00:51 250000 -- (-2096.157) [-2097.761] (-2098.024) (-2098.356) * [-2097.887] (-2098.349) (-2096.376) (-2099.119) -- 0:00:51 Average standard deviation of split frequencies: 0.015709 250500 -- [-2097.295] (-2098.021) (-2098.509) (-2096.995) * [-2096.427] (-2097.493) (-2096.071) (-2099.564) -- 0:00:50 251000 -- (-2098.342) (-2097.461) (-2098.928) [-2096.977] * (-2096.704) (-2100.880) [-2096.430] (-2099.842) -- 0:00:50 251500 -- [-2096.303] (-2097.873) (-2099.868) (-2098.555) * (-2097.213) [-2103.457] (-2096.521) (-2098.548) -- 0:00:50 252000 -- [-2098.214] (-2097.146) (-2101.180) (-2098.892) * [-2096.917] (-2099.468) (-2096.437) (-2098.498) -- 0:00:50 252500 -- (-2098.906) (-2101.759) (-2098.175) [-2097.866] * [-2097.500] (-2100.894) (-2096.401) (-2097.073) -- 0:00:50 253000 -- (-2100.553) (-2098.413) [-2096.827] (-2100.786) * [-2097.705] (-2096.937) (-2096.567) (-2098.945) -- 0:00:50 253500 -- (-2096.847) (-2100.679) [-2098.447] (-2096.881) * (-2099.589) (-2098.445) [-2096.601] (-2098.144) -- 0:00:50 254000 -- [-2096.646] (-2098.413) (-2100.049) (-2096.500) * (-2102.831) (-2097.103) [-2096.521] (-2098.145) -- 0:00:49 254500 -- [-2096.633] (-2097.533) (-2099.820) (-2100.291) * (-2101.096) (-2098.298) (-2096.064) [-2098.615] -- 0:00:49 255000 -- (-2096.613) (-2097.961) [-2098.911] (-2099.796) * (-2098.888) [-2102.030] (-2096.320) (-2096.503) -- 0:00:49 Average standard deviation of split frequencies: 0.015923 255500 -- (-2096.613) (-2097.443) [-2101.880] (-2099.709) * [-2096.458] (-2098.347) (-2097.596) (-2096.794) -- 0:00:49 256000 -- [-2096.366] (-2097.042) (-2098.130) (-2098.888) * [-2096.500] (-2099.758) (-2097.496) (-2097.079) -- 0:00:52 256500 -- (-2099.418) (-2097.324) (-2097.053) [-2099.017] * (-2102.721) (-2097.858) (-2097.496) [-2099.414] -- 0:00:52 257000 -- (-2097.143) (-2097.388) (-2097.986) [-2099.993] * (-2098.622) (-2097.862) (-2097.593) [-2097.548] -- 0:00:52 257500 -- (-2097.134) (-2098.242) (-2097.242) [-2099.532] * (-2103.498) (-2097.692) [-2097.780] (-2097.549) -- 0:00:51 258000 -- (-2101.383) (-2097.634) [-2097.667] (-2101.552) * [-2099.655] (-2105.267) (-2098.117) (-2097.993) -- 0:00:51 258500 -- (-2100.490) (-2097.634) [-2096.746] (-2103.257) * (-2098.731) [-2101.996] (-2100.720) (-2099.040) -- 0:00:51 259000 -- [-2097.675] (-2096.836) (-2097.170) (-2100.545) * (-2098.448) [-2101.798] (-2102.859) (-2103.162) -- 0:00:51 259500 -- (-2103.592) (-2096.587) [-2098.619] (-2098.710) * [-2099.016] (-2102.725) (-2097.254) (-2101.222) -- 0:00:51 260000 -- [-2098.493] (-2098.844) (-2099.086) (-2096.775) * [-2099.954] (-2103.237) (-2097.254) (-2101.959) -- 0:00:51 Average standard deviation of split frequencies: 0.014893 260500 -- (-2098.721) [-2096.389] (-2098.661) (-2097.439) * (-2099.380) [-2099.410] (-2097.019) (-2096.458) -- 0:00:51 261000 -- (-2098.453) [-2097.662] (-2097.968) (-2098.726) * (-2097.249) (-2101.223) (-2097.476) [-2096.487] -- 0:00:50 261500 -- (-2096.783) (-2097.396) [-2099.828] (-2099.226) * (-2097.099) [-2098.518] (-2101.825) (-2096.414) -- 0:00:50 262000 -- [-2096.253] (-2097.743) (-2100.042) (-2100.227) * [-2098.410] (-2100.296) (-2101.574) (-2096.438) -- 0:00:50 262500 -- (-2096.211) [-2097.369] (-2101.868) (-2100.215) * (-2098.408) (-2100.101) [-2099.167] (-2097.754) -- 0:00:50 263000 -- (-2096.208) (-2101.347) (-2103.148) [-2099.601] * [-2099.197] (-2097.430) (-2097.573) (-2098.645) -- 0:00:50 263500 -- (-2096.487) [-2097.233] (-2097.978) (-2098.773) * [-2096.494] (-2097.582) (-2096.526) (-2096.524) -- 0:00:50 264000 -- (-2097.060) (-2097.258) (-2098.920) [-2098.409] * [-2096.480] (-2097.077) (-2099.312) (-2098.777) -- 0:00:50 264500 -- (-2097.455) (-2097.203) (-2098.231) [-2097.171] * (-2096.481) (-2096.348) (-2099.099) [-2098.226] -- 0:00:50 265000 -- (-2097.983) [-2099.560] (-2101.869) (-2100.208) * (-2096.089) (-2096.218) [-2099.428] (-2098.217) -- 0:00:49 Average standard deviation of split frequencies: 0.014276 265500 -- (-2105.312) (-2097.738) (-2098.174) [-2099.030] * (-2098.115) (-2097.242) (-2099.693) [-2099.150] -- 0:00:49 266000 -- [-2101.332] (-2097.284) (-2099.309) (-2097.872) * (-2096.217) (-2101.863) (-2096.354) [-2098.042] -- 0:00:49 266500 -- (-2104.025) (-2097.265) [-2096.797] (-2097.838) * (-2096.489) [-2097.045] (-2098.049) (-2096.564) -- 0:00:49 267000 -- (-2098.354) (-2096.481) (-2097.348) [-2097.736] * (-2099.074) (-2098.323) [-2098.049] (-2098.274) -- 0:00:49 267500 -- (-2100.215) (-2097.161) (-2097.300) [-2099.286] * (-2098.681) [-2096.837] (-2099.430) (-2099.999) -- 0:00:49 268000 -- (-2104.445) (-2096.981) (-2097.288) [-2098.673] * (-2098.599) (-2107.385) (-2097.658) [-2098.464] -- 0:00:49 268500 -- (-2097.794) [-2097.075] (-2098.682) (-2098.548) * (-2098.965) (-2104.747) (-2097.838) [-2097.514] -- 0:00:49 269000 -- (-2098.291) [-2097.085] (-2104.493) (-2098.875) * (-2097.291) (-2103.016) (-2100.183) [-2098.942] -- 0:00:48 269500 -- [-2097.735] (-2096.343) (-2101.857) (-2101.793) * [-2097.224] (-2108.917) (-2098.197) (-2098.625) -- 0:00:48 270000 -- [-2098.509] (-2098.284) (-2096.931) (-2104.069) * (-2097.257) (-2101.615) [-2099.710] (-2097.912) -- 0:00:48 Average standard deviation of split frequencies: 0.013824 270500 -- (-2100.029) (-2096.540) [-2101.742] (-2099.728) * [-2096.845] (-2102.079) (-2100.878) (-2097.912) -- 0:00:48 271000 -- [-2098.440] (-2104.051) (-2102.505) (-2100.189) * (-2097.141) (-2098.595) [-2099.803] (-2096.182) -- 0:00:51 271500 -- (-2098.267) (-2100.018) (-2098.902) [-2098.923] * (-2098.589) [-2097.933] (-2098.977) (-2096.201) -- 0:00:50 272000 -- (-2101.066) (-2099.405) (-2098.762) [-2099.295] * (-2098.527) (-2098.683) [-2099.122] (-2097.070) -- 0:00:50 272500 -- (-2097.352) [-2097.537] (-2097.714) (-2098.120) * (-2097.987) (-2102.776) (-2101.187) [-2096.987] -- 0:00:50 273000 -- (-2102.030) [-2098.447] (-2105.065) (-2097.938) * (-2097.440) (-2099.722) [-2099.505] (-2097.670) -- 0:00:50 273500 -- (-2099.158) [-2096.992] (-2096.659) (-2098.662) * (-2098.616) (-2098.032) [-2096.917] (-2097.093) -- 0:00:50 274000 -- (-2099.097) (-2097.266) [-2096.633] (-2102.906) * (-2098.600) (-2100.764) [-2098.335] (-2099.174) -- 0:00:50 274500 -- (-2099.536) [-2098.370] (-2098.802) (-2102.599) * (-2099.667) (-2098.756) [-2099.270] (-2100.158) -- 0:00:50 275000 -- (-2099.661) [-2098.367] (-2099.972) (-2107.739) * [-2099.019] (-2100.434) (-2100.407) (-2100.622) -- 0:00:50 Average standard deviation of split frequencies: 0.012867 275500 -- (-2097.790) [-2098.537] (-2102.132) (-2099.310) * (-2098.423) (-2100.296) [-2097.962] (-2099.414) -- 0:00:49 276000 -- (-2097.149) [-2098.271] (-2102.107) (-2098.647) * [-2097.460] (-2098.393) (-2097.195) (-2105.172) -- 0:00:49 276500 -- (-2097.474) (-2099.075) (-2096.592) [-2096.746] * (-2097.611) (-2098.528) [-2099.097] (-2098.995) -- 0:00:49 277000 -- (-2096.646) (-2097.717) [-2096.502] (-2097.920) * (-2098.159) (-2098.578) [-2098.356] (-2099.055) -- 0:00:49 277500 -- [-2097.769] (-2097.629) (-2096.697) (-2097.641) * (-2098.486) (-2097.621) [-2098.614] (-2098.601) -- 0:00:49 278000 -- (-2097.295) (-2096.778) (-2097.185) [-2097.433] * [-2098.658] (-2100.403) (-2098.463) (-2097.856) -- 0:00:49 278500 -- (-2098.392) (-2097.535) [-2097.639] (-2100.158) * (-2101.316) [-2100.806] (-2097.742) (-2100.217) -- 0:00:49 279000 -- (-2097.966) [-2097.286] (-2098.401) (-2100.329) * (-2100.499) (-2100.988) (-2099.299) [-2098.654] -- 0:00:49 279500 -- [-2099.459] (-2098.386) (-2097.477) (-2100.651) * (-2096.350) [-2098.412] (-2097.162) (-2097.624) -- 0:00:48 280000 -- (-2099.194) (-2097.744) [-2096.571] (-2101.285) * (-2098.458) (-2098.547) [-2097.353] (-2097.624) -- 0:00:48 Average standard deviation of split frequencies: 0.012877 280500 -- [-2099.836] (-2097.483) (-2097.016) (-2098.204) * (-2096.594) (-2100.963) [-2097.681] (-2097.048) -- 0:00:48 281000 -- (-2100.857) (-2097.481) (-2097.149) [-2099.664] * (-2098.333) (-2099.361) [-2097.179] (-2096.142) -- 0:00:48 281500 -- (-2099.403) [-2097.482] (-2097.067) (-2100.038) * (-2097.768) (-2097.629) [-2099.676] (-2096.957) -- 0:00:48 282000 -- (-2098.636) (-2098.586) [-2097.325] (-2100.346) * (-2100.746) (-2097.628) [-2100.311] (-2099.061) -- 0:00:48 282500 -- [-2098.604] (-2097.768) (-2099.138) (-2098.862) * (-2101.248) (-2097.479) (-2098.398) [-2099.395] -- 0:00:48 283000 -- [-2100.501] (-2097.990) (-2100.522) (-2100.372) * (-2100.624) [-2096.737] (-2098.100) (-2097.162) -- 0:00:48 283500 -- (-2099.802) (-2097.777) (-2097.468) [-2098.467] * [-2100.742] (-2099.760) (-2100.527) (-2097.454) -- 0:00:48 284000 -- (-2098.972) (-2098.663) (-2097.619) [-2096.884] * (-2103.062) (-2096.157) [-2098.871] (-2102.585) -- 0:00:47 284500 -- (-2099.353) (-2098.826) (-2099.147) [-2097.142] * (-2099.944) (-2096.202) (-2097.089) [-2097.923] -- 0:00:47 285000 -- (-2101.580) (-2100.501) (-2099.174) [-2097.192] * (-2098.917) [-2097.932] (-2097.754) (-2098.119) -- 0:00:47 Average standard deviation of split frequencies: 0.012747 285500 -- (-2103.921) (-2099.882) [-2098.226] (-2096.587) * [-2097.694] (-2100.018) (-2099.246) (-2098.131) -- 0:00:50 286000 -- (-2098.030) [-2101.460] (-2098.949) (-2098.547) * (-2097.929) (-2098.673) [-2097.588] (-2098.999) -- 0:00:49 286500 -- (-2097.990) (-2100.133) [-2097.628] (-2098.904) * (-2098.084) [-2099.109] (-2098.418) (-2098.268) -- 0:00:49 287000 -- (-2100.981) (-2097.431) [-2098.246] (-2097.181) * (-2098.074) (-2101.234) [-2096.824] (-2097.716) -- 0:00:49 287500 -- (-2097.576) (-2101.227) (-2101.234) [-2098.119] * [-2098.200] (-2099.639) (-2098.635) (-2098.801) -- 0:00:49 288000 -- (-2099.770) (-2107.502) (-2099.746) [-2097.277] * (-2098.302) (-2101.736) (-2097.789) [-2100.941] -- 0:00:49 288500 -- (-2099.149) (-2098.213) (-2097.770) [-2097.303] * [-2098.251] (-2106.462) (-2097.267) (-2098.815) -- 0:00:49 289000 -- (-2100.583) [-2097.541] (-2099.460) (-2097.060) * [-2098.087] (-2105.755) (-2098.806) (-2097.314) -- 0:00:49 289500 -- (-2103.067) (-2102.301) [-2099.048] (-2098.578) * [-2098.727] (-2097.674) (-2100.035) (-2103.613) -- 0:00:49 290000 -- [-2103.019] (-2106.079) (-2096.773) (-2099.933) * (-2099.671) (-2096.810) (-2100.153) [-2101.255] -- 0:00:48 Average standard deviation of split frequencies: 0.011555 290500 -- [-2102.370] (-2098.741) (-2097.660) (-2100.057) * (-2099.536) [-2097.340] (-2100.158) (-2097.980) -- 0:00:48 291000 -- (-2098.592) (-2100.945) [-2098.906] (-2102.786) * (-2099.287) [-2097.910] (-2101.369) (-2098.634) -- 0:00:48 291500 -- (-2100.196) (-2100.733) (-2097.332) [-2100.173] * (-2097.623) [-2100.848] (-2097.733) (-2096.678) -- 0:00:48 292000 -- (-2097.688) (-2100.375) [-2097.091] (-2100.224) * (-2099.084) (-2097.957) [-2097.374] (-2096.661) -- 0:00:48 292500 -- (-2096.555) (-2100.996) (-2097.135) [-2100.168] * (-2102.288) (-2096.586) (-2097.498) [-2096.779] -- 0:00:48 293000 -- (-2096.829) (-2098.211) (-2097.870) [-2096.559] * [-2101.173] (-2097.458) (-2097.869) (-2101.417) -- 0:00:48 293500 -- (-2098.915) (-2100.075) (-2098.809) [-2096.515] * (-2102.749) (-2101.051) (-2097.528) [-2102.235] -- 0:00:48 294000 -- (-2097.368) (-2097.636) (-2100.110) [-2097.135] * (-2106.258) (-2101.243) [-2098.151] (-2100.333) -- 0:00:48 294500 -- (-2096.781) (-2097.152) [-2101.805] (-2096.569) * (-2099.654) (-2102.188) [-2097.896] (-2101.029) -- 0:00:47 295000 -- (-2097.145) [-2097.202] (-2097.995) (-2097.376) * (-2099.001) (-2100.627) [-2096.656] (-2098.501) -- 0:00:47 Average standard deviation of split frequencies: 0.011347 295500 -- (-2097.314) (-2097.519) (-2097.501) [-2100.350] * (-2098.509) (-2100.756) (-2096.545) [-2100.675] -- 0:00:47 296000 -- (-2096.883) [-2096.847] (-2097.665) (-2098.437) * [-2096.520] (-2097.588) (-2098.052) (-2101.307) -- 0:00:47 296500 -- (-2097.764) (-2097.124) (-2098.222) [-2099.345] * (-2102.943) (-2103.664) (-2098.525) [-2097.751] -- 0:00:47 297000 -- (-2098.249) (-2096.837) [-2098.778] (-2098.222) * [-2102.312] (-2098.380) (-2098.828) (-2096.307) -- 0:00:47 297500 -- (-2104.824) (-2098.908) [-2098.834] (-2097.548) * (-2097.934) (-2098.745) (-2098.151) [-2097.464] -- 0:00:47 298000 -- (-2099.265) (-2096.406) [-2097.058] (-2097.544) * (-2098.403) [-2099.531] (-2097.870) (-2098.641) -- 0:00:47 298500 -- [-2100.776] (-2096.668) (-2096.680) (-2099.269) * [-2099.021] (-2100.306) (-2096.976) (-2098.651) -- 0:00:47 299000 -- (-2098.616) (-2097.679) [-2097.787] (-2097.947) * (-2100.779) [-2098.380] (-2097.143) (-2098.079) -- 0:00:46 299500 -- (-2099.893) (-2096.262) [-2098.004] (-2097.946) * [-2097.736] (-2098.545) (-2100.562) (-2096.781) -- 0:00:46 300000 -- (-2098.284) (-2097.281) (-2100.521) [-2096.884] * (-2098.256) (-2097.618) (-2096.750) [-2098.277] -- 0:00:48 Average standard deviation of split frequencies: 0.012347 300500 -- (-2097.797) [-2097.833] (-2099.223) (-2096.862) * (-2099.745) (-2097.580) [-2097.753] (-2104.005) -- 0:00:48 301000 -- (-2097.741) (-2096.716) [-2097.657] (-2096.832) * (-2098.144) (-2099.028) (-2103.333) [-2099.847] -- 0:00:48 301500 -- [-2096.426] (-2096.597) (-2098.062) (-2098.622) * (-2097.415) (-2099.920) [-2100.537] (-2099.858) -- 0:00:48 302000 -- (-2097.472) (-2096.616) [-2100.028] (-2097.529) * (-2096.441) [-2099.966] (-2096.481) (-2099.119) -- 0:00:48 302500 -- (-2099.125) (-2096.618) (-2096.999) [-2097.281] * (-2096.268) (-2101.484) [-2096.481] (-2102.066) -- 0:00:48 303000 -- (-2098.335) (-2096.468) (-2098.557) [-2097.479] * (-2097.734) (-2101.804) [-2098.422] (-2099.909) -- 0:00:48 303500 -- (-2097.511) [-2098.497] (-2097.049) (-2098.972) * (-2096.381) [-2100.276] (-2096.539) (-2099.802) -- 0:00:48 304000 -- (-2097.553) (-2098.859) [-2097.055] (-2099.220) * (-2097.352) (-2099.938) (-2097.548) [-2099.715] -- 0:00:48 304500 -- (-2097.424) [-2102.398] (-2097.897) (-2097.246) * (-2096.769) [-2098.105] (-2096.829) (-2098.849) -- 0:00:47 305000 -- (-2098.695) (-2098.319) [-2098.741] (-2096.580) * (-2097.933) (-2097.622) [-2097.329] (-2098.639) -- 0:00:47 Average standard deviation of split frequencies: 0.011843 305500 -- [-2098.874] (-2098.459) (-2097.813) (-2098.510) * (-2097.929) (-2100.879) (-2099.293) [-2096.128] -- 0:00:47 306000 -- (-2101.700) [-2097.313] (-2099.577) (-2099.445) * [-2096.004] (-2099.528) (-2099.855) (-2097.804) -- 0:00:47 306500 -- (-2098.129) (-2097.209) [-2097.591] (-2099.060) * (-2096.395) [-2108.074] (-2101.654) (-2098.146) -- 0:00:47 307000 -- (-2098.185) [-2096.692] (-2096.540) (-2103.416) * [-2096.989] (-2098.950) (-2102.549) (-2098.979) -- 0:00:47 307500 -- (-2097.552) (-2097.103) [-2096.558] (-2099.318) * [-2096.958] (-2098.152) (-2098.283) (-2099.872) -- 0:00:47 308000 -- (-2097.477) (-2103.079) (-2099.905) [-2097.426] * (-2096.769) (-2099.265) (-2097.852) [-2097.201] -- 0:00:47 308500 -- (-2097.309) (-2097.123) [-2103.001] (-2097.813) * [-2098.647] (-2099.803) (-2102.574) (-2098.595) -- 0:00:47 309000 -- (-2097.605) (-2097.482) [-2099.576] (-2097.769) * (-2099.166) (-2099.302) [-2097.871] (-2099.000) -- 0:00:46 309500 -- (-2098.986) (-2097.482) (-2098.730) [-2097.299] * (-2099.014) [-2097.649] (-2098.032) (-2097.743) -- 0:00:46 310000 -- (-2097.623) [-2098.150] (-2101.644) (-2097.313) * (-2100.009) (-2097.443) [-2097.355] (-2096.245) -- 0:00:46 Average standard deviation of split frequencies: 0.012139 310500 -- (-2099.064) (-2097.536) (-2103.656) [-2098.449] * (-2100.627) (-2097.897) [-2097.346] (-2097.887) -- 0:00:46 311000 -- [-2098.061] (-2100.346) (-2100.124) (-2096.966) * [-2100.956] (-2098.920) (-2101.759) (-2097.732) -- 0:00:46 311500 -- [-2098.493] (-2102.935) (-2099.613) (-2098.718) * (-2101.252) (-2097.147) [-2100.210] (-2098.887) -- 0:00:46 312000 -- (-2098.675) [-2098.021] (-2098.295) (-2098.478) * (-2100.458) [-2098.993] (-2099.885) (-2098.510) -- 0:00:46 312500 -- [-2099.274] (-2098.038) (-2100.137) (-2097.520) * [-2101.161] (-2100.801) (-2097.580) (-2096.266) -- 0:00:46 313000 -- (-2099.327) [-2097.518] (-2099.511) (-2097.626) * (-2097.173) (-2099.965) [-2098.583] (-2100.959) -- 0:00:46 313500 -- (-2101.455) (-2097.853) (-2097.261) [-2098.411] * (-2097.613) (-2101.435) (-2097.202) [-2100.731] -- 0:00:48 314000 -- [-2099.057] (-2101.041) (-2098.567) (-2099.306) * (-2097.279) (-2101.191) [-2097.442] (-2099.804) -- 0:00:48 314500 -- (-2097.739) (-2096.350) (-2098.529) [-2097.422] * (-2099.271) (-2099.410) [-2097.808] (-2097.834) -- 0:00:47 315000 -- (-2097.541) (-2097.053) [-2096.895] (-2096.669) * [-2099.627] (-2097.706) (-2097.221) (-2096.845) -- 0:00:47 Average standard deviation of split frequencies: 0.012494 315500 -- (-2098.134) [-2097.997] (-2097.397) (-2097.297) * [-2097.616] (-2101.657) (-2098.204) (-2100.804) -- 0:00:47 316000 -- (-2097.325) (-2098.676) (-2100.132) [-2097.267] * (-2101.811) (-2100.834) [-2099.011] (-2099.365) -- 0:00:47 316500 -- (-2096.626) (-2097.467) [-2096.472] (-2097.882) * (-2097.215) (-2103.065) (-2099.119) [-2100.728] -- 0:00:47 317000 -- (-2097.733) (-2096.618) [-2098.570] (-2101.616) * [-2096.931] (-2101.093) (-2099.773) (-2098.332) -- 0:00:47 317500 -- (-2097.115) [-2096.797] (-2100.656) (-2097.673) * (-2097.571) (-2100.558) [-2099.356] (-2100.746) -- 0:00:47 318000 -- (-2101.367) (-2097.545) (-2104.314) [-2098.364] * (-2098.904) (-2096.380) (-2100.067) [-2097.392] -- 0:00:47 318500 -- (-2097.949) [-2097.777] (-2104.996) (-2098.861) * (-2096.858) [-2097.959] (-2098.059) (-2101.067) -- 0:00:47 319000 -- [-2097.075] (-2098.039) (-2100.652) (-2101.447) * [-2097.472] (-2099.933) (-2097.966) (-2101.549) -- 0:00:46 319500 -- (-2100.904) (-2096.578) (-2098.495) [-2099.810] * (-2099.126) (-2099.644) [-2097.187] (-2104.196) -- 0:00:46 320000 -- [-2096.928] (-2099.814) (-2097.352) (-2100.797) * (-2097.495) (-2099.264) (-2099.268) [-2100.267] -- 0:00:46 Average standard deviation of split frequencies: 0.011669 320500 -- (-2097.792) (-2096.939) [-2097.280] (-2099.891) * (-2097.495) [-2098.168] (-2098.059) (-2098.782) -- 0:00:46 321000 -- (-2098.893) [-2096.825] (-2097.504) (-2098.692) * (-2099.473) (-2099.416) (-2098.783) [-2096.693] -- 0:00:46 321500 -- (-2098.130) (-2097.169) [-2098.990] (-2099.917) * [-2097.457] (-2097.744) (-2101.615) (-2096.689) -- 0:00:46 322000 -- (-2097.134) [-2097.467] (-2097.779) (-2097.567) * (-2097.519) [-2097.993] (-2103.067) (-2096.923) -- 0:00:46 322500 -- (-2099.422) (-2096.831) [-2097.960] (-2099.142) * (-2097.468) (-2096.762) (-2101.789) [-2097.794] -- 0:00:46 323000 -- (-2099.192) [-2098.006] (-2099.003) (-2098.071) * (-2097.427) [-2096.624] (-2100.619) (-2098.983) -- 0:00:46 323500 -- [-2099.391] (-2098.099) (-2097.191) (-2100.082) * [-2097.434] (-2097.900) (-2099.955) (-2099.022) -- 0:00:46 324000 -- (-2099.437) (-2102.205) [-2099.512] (-2101.203) * (-2102.116) [-2097.676] (-2100.575) (-2102.742) -- 0:00:45 324500 -- (-2098.124) (-2099.797) (-2096.782) [-2099.752] * (-2099.711) [-2098.006] (-2097.793) (-2099.745) -- 0:00:45 325000 -- (-2097.036) (-2096.956) [-2097.311] (-2101.480) * (-2098.304) [-2097.008] (-2097.778) (-2099.584) -- 0:00:45 Average standard deviation of split frequencies: 0.011026 325500 -- [-2096.337] (-2096.941) (-2096.598) (-2099.718) * (-2098.521) [-2097.140] (-2098.407) (-2098.561) -- 0:00:45 326000 -- [-2096.605] (-2097.135) (-2096.637) (-2102.929) * (-2099.057) (-2099.660) [-2098.874] (-2099.355) -- 0:00:45 326500 -- (-2096.651) (-2097.890) [-2097.029] (-2099.013) * (-2097.697) [-2097.989] (-2098.408) (-2102.107) -- 0:00:45 327000 -- [-2097.390] (-2097.449) (-2097.293) (-2099.003) * [-2098.162] (-2101.919) (-2096.531) (-2103.456) -- 0:00:45 327500 -- (-2098.513) (-2097.604) [-2097.952] (-2097.960) * [-2097.046] (-2098.652) (-2098.440) (-2102.158) -- 0:00:47 328000 -- (-2096.483) (-2096.990) [-2098.475] (-2098.569) * [-2099.113] (-2097.303) (-2098.836) (-2099.226) -- 0:00:47 328500 -- (-2097.882) (-2098.420) (-2097.998) [-2101.192] * (-2098.709) (-2097.944) (-2108.189) [-2098.828] -- 0:00:47 329000 -- [-2099.182] (-2098.388) (-2097.223) (-2101.596) * (-2099.959) [-2097.664] (-2098.140) (-2103.251) -- 0:00:46 329500 -- (-2097.566) [-2098.062] (-2099.621) (-2098.638) * [-2099.248] (-2098.508) (-2097.716) (-2100.060) -- 0:00:46 330000 -- (-2098.004) (-2096.945) (-2098.760) [-2098.110] * (-2099.807) [-2098.415] (-2099.108) (-2097.982) -- 0:00:46 Average standard deviation of split frequencies: 0.011227 330500 -- (-2100.328) [-2099.167] (-2097.808) (-2096.806) * [-2097.359] (-2101.129) (-2097.506) (-2097.563) -- 0:00:46 331000 -- (-2098.421) (-2100.555) (-2099.510) [-2098.917] * (-2099.585) (-2098.823) (-2101.507) [-2099.417] -- 0:00:46 331500 -- (-2099.575) [-2096.450] (-2099.981) (-2099.947) * (-2097.828) (-2098.032) (-2098.489) [-2097.112] -- 0:00:46 332000 -- (-2103.751) (-2097.895) [-2099.980] (-2100.399) * [-2097.348] (-2101.280) (-2098.238) (-2099.763) -- 0:00:46 332500 -- [-2098.444] (-2097.150) (-2103.108) (-2100.679) * (-2097.795) (-2096.843) (-2098.074) [-2099.324] -- 0:00:46 333000 -- (-2099.849) [-2096.870] (-2098.959) (-2098.339) * (-2098.722) (-2099.448) (-2098.296) [-2098.358] -- 0:00:46 333500 -- (-2098.508) [-2096.311] (-2103.127) (-2097.877) * (-2098.269) (-2100.688) (-2099.365) [-2098.319] -- 0:00:45 334000 -- (-2099.260) [-2096.374] (-2097.010) (-2098.476) * [-2099.498] (-2100.520) (-2100.460) (-2097.322) -- 0:00:45 334500 -- (-2098.775) (-2096.374) [-2098.189] (-2100.222) * (-2100.119) (-2096.867) (-2099.560) [-2097.075] -- 0:00:45 335000 -- (-2097.022) [-2096.227] (-2099.493) (-2099.294) * [-2099.926] (-2097.472) (-2101.613) (-2098.989) -- 0:00:45 Average standard deviation of split frequencies: 0.011750 335500 -- [-2098.202] (-2098.918) (-2096.741) (-2098.335) * [-2098.576] (-2100.150) (-2100.598) (-2099.127) -- 0:00:45 336000 -- (-2096.721) (-2098.868) [-2097.616] (-2097.365) * [-2099.181] (-2098.308) (-2099.723) (-2097.107) -- 0:00:45 336500 -- (-2097.239) (-2097.617) (-2098.264) [-2096.404] * (-2097.928) (-2100.923) [-2100.440] (-2097.756) -- 0:00:45 337000 -- [-2097.055] (-2100.611) (-2097.574) (-2098.363) * [-2097.676] (-2099.172) (-2100.658) (-2097.029) -- 0:00:45 337500 -- (-2097.843) (-2099.293) (-2097.574) [-2097.095] * (-2103.422) (-2099.050) [-2098.765] (-2098.506) -- 0:00:45 338000 -- [-2098.999] (-2098.209) (-2097.568) (-2096.764) * (-2098.522) [-2100.415] (-2100.513) (-2097.003) -- 0:00:45 338500 -- (-2098.674) (-2101.040) [-2096.706] (-2096.754) * (-2098.684) (-2101.426) (-2098.744) [-2097.024] -- 0:00:44 339000 -- (-2096.251) [-2098.790] (-2096.656) (-2097.134) * [-2097.643] (-2096.592) (-2100.296) (-2096.594) -- 0:00:44 339500 -- (-2098.377) (-2098.141) [-2096.634] (-2098.503) * (-2098.150) (-2097.856) [-2099.643] (-2097.873) -- 0:00:44 340000 -- (-2098.451) (-2098.901) [-2096.685] (-2096.942) * [-2097.587] (-2096.615) (-2098.045) (-2097.415) -- 0:00:44 Average standard deviation of split frequencies: 0.011070 340500 -- [-2098.867] (-2099.749) (-2098.130) (-2097.551) * [-2098.349] (-2096.805) (-2098.499) (-2098.358) -- 0:00:44 341000 -- (-2100.518) (-2098.122) (-2097.243) [-2098.392] * (-2097.973) (-2102.177) (-2098.840) [-2097.892] -- 0:00:46 341500 -- (-2098.019) (-2100.270) [-2097.211] (-2099.613) * (-2098.604) (-2099.739) [-2098.153] (-2097.896) -- 0:00:46 342000 -- (-2096.662) (-2099.447) [-2097.522] (-2099.293) * (-2097.324) (-2100.248) [-2099.249] (-2099.612) -- 0:00:46 342500 -- (-2097.132) (-2097.843) [-2098.594] (-2099.470) * (-2097.269) (-2100.248) (-2098.917) [-2099.140] -- 0:00:46 343000 -- (-2099.441) (-2097.447) [-2097.303] (-2099.905) * (-2100.991) [-2100.101] (-2100.035) (-2100.463) -- 0:00:45 343500 -- (-2098.242) [-2097.162] (-2103.938) (-2097.310) * (-2099.121) (-2096.051) (-2099.255) [-2098.620] -- 0:00:45 344000 -- [-2096.687] (-2096.476) (-2098.703) (-2098.222) * (-2098.966) (-2096.046) [-2099.255] (-2098.248) -- 0:00:45 344500 -- (-2096.600) (-2096.569) (-2098.081) [-2098.234] * [-2096.611] (-2098.499) (-2099.538) (-2102.333) -- 0:00:45 345000 -- (-2101.346) [-2097.150] (-2099.206) (-2097.075) * (-2096.518) [-2096.651] (-2097.484) (-2101.372) -- 0:00:45 Average standard deviation of split frequencies: 0.011140 345500 -- (-2102.865) [-2096.595] (-2098.769) (-2097.026) * (-2103.458) [-2099.409] (-2097.336) (-2098.143) -- 0:00:45 346000 -- (-2099.806) [-2099.507] (-2098.677) (-2098.479) * (-2097.943) (-2098.804) [-2098.944] (-2099.748) -- 0:00:45 346500 -- (-2098.585) (-2100.843) [-2097.249] (-2101.112) * (-2098.394) (-2099.056) (-2097.990) [-2102.210] -- 0:00:45 347000 -- (-2099.382) [-2097.026] (-2096.965) (-2099.528) * [-2096.944] (-2098.515) (-2098.060) (-2099.033) -- 0:00:45 347500 -- (-2098.895) [-2096.994] (-2100.195) (-2100.177) * (-2097.077) (-2100.722) (-2100.665) [-2098.137] -- 0:00:45 348000 -- [-2096.370] (-2099.808) (-2097.059) (-2101.089) * [-2096.901] (-2098.483) (-2098.753) (-2099.610) -- 0:00:44 348500 -- (-2097.910) (-2099.486) (-2099.244) [-2097.373] * (-2097.937) [-2099.430] (-2098.423) (-2096.586) -- 0:00:44 349000 -- (-2102.117) (-2100.215) [-2103.051] (-2098.189) * [-2097.558] (-2097.378) (-2101.882) (-2096.731) -- 0:00:44 349500 -- [-2099.429] (-2099.854) (-2096.800) (-2096.835) * [-2099.779] (-2096.417) (-2099.501) (-2096.689) -- 0:00:44 350000 -- (-2101.075) [-2098.997] (-2099.531) (-2097.546) * (-2099.307) (-2096.523) [-2097.180] (-2096.582) -- 0:00:44 Average standard deviation of split frequencies: 0.011071 350500 -- [-2099.601] (-2097.997) (-2097.071) (-2096.655) * (-2099.737) [-2098.421] (-2098.298) (-2098.624) -- 0:00:44 351000 -- [-2100.859] (-2098.975) (-2097.396) (-2099.184) * (-2102.463) (-2097.208) [-2098.544] (-2100.381) -- 0:00:44 351500 -- (-2099.588) [-2097.655] (-2097.069) (-2097.521) * [-2099.194] (-2096.701) (-2102.054) (-2103.490) -- 0:00:44 352000 -- (-2098.731) [-2096.713] (-2096.529) (-2098.657) * [-2096.940] (-2099.932) (-2098.841) (-2101.174) -- 0:00:44 352500 -- (-2099.182) (-2100.192) [-2097.832] (-2099.426) * [-2097.446] (-2100.563) (-2097.982) (-2100.715) -- 0:00:45 353000 -- (-2097.743) (-2097.567) (-2097.036) [-2098.160] * [-2097.115] (-2099.895) (-2100.720) (-2108.258) -- 0:00:45 353500 -- [-2097.919] (-2098.799) (-2099.460) (-2097.647) * (-2100.760) [-2097.087] (-2098.203) (-2108.377) -- 0:00:45 354000 -- [-2097.239] (-2097.526) (-2098.155) (-2098.627) * (-2101.146) (-2097.348) (-2098.200) [-2100.430] -- 0:00:45 354500 -- (-2099.895) (-2099.410) [-2098.289] (-2098.587) * [-2101.177] (-2098.474) (-2098.983) (-2096.453) -- 0:00:45 355000 -- (-2101.398) (-2098.776) (-2098.904) [-2100.524] * (-2101.563) [-2099.843] (-2097.432) (-2096.616) -- 0:00:45 Average standard deviation of split frequencies: 0.011255 355500 -- (-2098.014) (-2099.249) (-2098.084) [-2099.314] * (-2100.487) (-2096.937) [-2098.795] (-2096.034) -- 0:00:45 356000 -- (-2100.839) (-2098.598) [-2099.209] (-2098.595) * [-2101.124] (-2098.356) (-2099.737) (-2097.033) -- 0:00:45 356500 -- (-2102.377) (-2099.164) (-2098.380) [-2098.415] * (-2101.573) (-2099.861) [-2103.489] (-2098.465) -- 0:00:45 357000 -- (-2100.695) (-2099.424) (-2098.981) [-2099.189] * (-2098.146) [-2100.165] (-2103.580) (-2097.884) -- 0:00:45 357500 -- (-2099.263) (-2097.425) (-2099.303) [-2097.679] * (-2097.364) [-2099.492] (-2105.816) (-2097.101) -- 0:00:44 358000 -- [-2100.574] (-2097.289) (-2100.711) (-2098.280) * (-2097.628) (-2097.269) (-2098.458) [-2097.402] -- 0:00:44 358500 -- (-2100.583) (-2099.682) (-2101.908) [-2096.833] * [-2098.099] (-2097.454) (-2097.738) (-2098.684) -- 0:00:44 359000 -- (-2099.315) [-2097.931] (-2102.334) (-2097.028) * (-2097.124) [-2096.559] (-2098.925) (-2097.582) -- 0:00:44 359500 -- (-2100.537) [-2098.645] (-2099.889) (-2098.045) * (-2097.049) (-2096.670) (-2101.085) [-2099.699] -- 0:00:44 360000 -- [-2099.754] (-2102.058) (-2100.135) (-2099.038) * (-2096.983) (-2098.119) (-2101.860) [-2100.655] -- 0:00:44 Average standard deviation of split frequencies: 0.011355 360500 -- [-2099.307] (-2098.694) (-2101.016) (-2098.920) * [-2097.315] (-2100.938) (-2100.363) (-2100.957) -- 0:00:44 361000 -- (-2101.206) [-2096.778] (-2101.756) (-2097.727) * (-2098.110) (-2098.748) (-2101.435) [-2101.456] -- 0:00:44 361500 -- (-2097.109) (-2096.215) (-2097.516) [-2098.678] * (-2099.871) [-2098.145] (-2099.720) (-2097.840) -- 0:00:44 362000 -- (-2097.956) [-2097.445] (-2099.268) (-2098.886) * (-2101.754) (-2098.694) [-2102.742] (-2097.569) -- 0:00:44 362500 -- (-2097.034) (-2097.413) [-2097.940] (-2099.122) * [-2099.971] (-2098.092) (-2103.326) (-2097.711) -- 0:00:43 363000 -- (-2096.562) (-2098.567) [-2099.090] (-2101.516) * [-2099.265] (-2098.156) (-2105.785) (-2096.905) -- 0:00:43 363500 -- [-2097.215] (-2098.883) (-2098.908) (-2099.141) * (-2100.187) (-2099.782) (-2105.312) [-2098.633] -- 0:00:43 364000 -- (-2097.148) (-2103.018) [-2098.303] (-2096.500) * (-2099.373) [-2097.642] (-2102.423) (-2100.532) -- 0:00:43 364500 -- (-2097.396) [-2099.149] (-2100.074) (-2097.165) * [-2096.642] (-2097.445) (-2098.512) (-2100.203) -- 0:00:43 365000 -- [-2098.594] (-2098.208) (-2098.527) (-2098.548) * (-2097.317) (-2097.287) [-2097.274] (-2102.065) -- 0:00:43 Average standard deviation of split frequencies: 0.010304 365500 -- [-2099.885] (-2099.514) (-2099.706) (-2099.054) * (-2097.981) (-2098.751) (-2097.188) [-2097.697] -- 0:00:43 366000 -- (-2099.193) (-2099.513) [-2099.749] (-2099.643) * (-2096.857) (-2098.698) [-2097.396] (-2097.996) -- 0:00:43 366500 -- [-2098.073] (-2106.156) (-2104.844) (-2099.014) * (-2098.140) (-2097.643) (-2100.656) [-2097.671] -- 0:00:43 367000 -- (-2102.474) [-2100.107] (-2104.379) (-2098.837) * [-2098.209] (-2099.341) (-2098.650) (-2096.895) -- 0:00:44 367500 -- (-2098.823) [-2099.748] (-2104.662) (-2099.216) * (-2098.560) [-2098.030] (-2096.537) (-2100.504) -- 0:00:44 368000 -- [-2098.369] (-2096.985) (-2097.108) (-2096.767) * [-2098.540] (-2099.180) (-2096.542) (-2097.467) -- 0:00:44 368500 -- (-2099.771) [-2097.524] (-2096.603) (-2098.868) * (-2099.668) (-2101.625) [-2096.749] (-2096.979) -