>C1
MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPAILAAGRGGHLVNVSSAA
GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
QPRSGEGGKSGN
>C2
MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPAILAAGRGGHLVNVSSAA
GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
QPRSGEGGKSGN
>C3
MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPPILAAGRGGHLVNVSSAA
GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
QPRSGEGGKSGN
>C4
MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPPILAAGRGGHLVNVSSAA
GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
QPRSGEGGKSGN
>C5
MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPPILAAGRGGHLVNVSSAA
GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
QPRSGEGGKSGN
>C6
MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPPILAAGRGGHLVNVSSAA
GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
QPRSGEGGKSGN
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=312
C1 MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
C2 MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
C3 MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
C4 MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
C5 MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
C6 MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
**************************************************
C1 VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
C2 VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
C3 VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
C4 VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
C5 VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
C6 VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
**************************************************
C1 WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPAILAAGRGGHLVNVSSAA
C2 WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPAILAAGRGGHLVNVSSAA
C3 WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPPILAAGRGGHLVNVSSAA
C4 WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPPILAAGRGGHLVNVSSAA
C5 WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPPILAAGRGGHLVNVSSAA
C6 WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPPILAAGRGGHLVNVSSAA
********************************.*****************
C1 GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
C2 GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
C3 GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
C4 GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
C5 GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
C6 GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
**************************************************
C1 TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
C2 TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
C3 TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
C4 TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
C5 TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
C6 TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
**************************************************
C1 DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
C2 DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
C3 DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
C4 DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
C5 DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
C6 DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
**************************************************
C1 QPRSGEGGKSGN
C2 QPRSGEGGKSGN
C3 QPRSGEGGKSGN
C4 QPRSGEGGKSGN
C5 QPRSGEGGKSGN
C6 QPRSGEGGKSGN
************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 312 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 312 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9360]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [9360]--->[9360]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.505 Mb, Max= 30.871 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
C2 MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
C3 MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
C4 MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
C5 MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
C6 MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
**************************************************
C1 VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
C2 VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
C3 VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
C4 VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
C5 VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
C6 VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
**************************************************
C1 WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPAILAAGRGGHLVNVSSAA
C2 WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPAILAAGRGGHLVNVSSAA
C3 WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPPILAAGRGGHLVNVSSAA
C4 WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPPILAAGRGGHLVNVSSAA
C5 WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPPILAAGRGGHLVNVSSAA
C6 WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPPILAAGRGGHLVNVSSAA
********************************.*****************
C1 GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
C2 GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
C3 GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
C4 GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
C5 GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
C6 GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
**************************************************
C1 TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
C2 TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
C3 TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
C4 TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
C5 TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
C6 TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
**************************************************
C1 DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
C2 DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
C3 DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
C4 DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
C5 DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
C6 DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
**************************************************
C1 QPRSGEGGKSGN
C2 QPRSGEGGKSGN
C3 QPRSGEGGKSGN
C4 QPRSGEGGKSGN
C5 QPRSGEGGKSGN
C6 QPRSGEGGKSGN
************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 99.68 C1 C3 99.68
TOP 2 0 99.68 C3 C1 99.68
BOT 0 3 99.68 C1 C4 99.68
TOP 3 0 99.68 C4 C1 99.68
BOT 0 4 99.68 C1 C5 99.68
TOP 4 0 99.68 C5 C1 99.68
BOT 0 5 99.68 C1 C6 99.68
TOP 5 0 99.68 C6 C1 99.68
BOT 1 2 99.68 C2 C3 99.68
TOP 2 1 99.68 C3 C2 99.68
BOT 1 3 99.68 C2 C4 99.68
TOP 3 1 99.68 C4 C2 99.68
BOT 1 4 99.68 C2 C5 99.68
TOP 4 1 99.68 C5 C2 99.68
BOT 1 5 99.68 C2 C6 99.68
TOP 5 1 99.68 C6 C2 99.68
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 99.74
AVG 1 C2 * 99.74
AVG 2 C3 * 99.87
AVG 3 C4 * 99.87
AVG 4 C5 * 99.87
AVG 5 C6 * 99.87
TOT TOT * 99.83
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGTGAAGACGGCACAATATTTCGTGGGGAAGCGGTGTTTTGTCACCGG
C2 ATGGTGAAGACGGCACAATATTTCGTGGGGAAGCGGTGTTTTGTCACCGG
C3 ATGGTGAAGACGGCACAATATTTCGTGGGGAAGCGGTGTTTTGTCACCGG
C4 ATGGTGAAGACGGCACAATATTTCGTGGGGAAGCGGTGTTTTGTCACCGG
C5 ATGGTGAAGACGGCACAATATTTCGTGGGGAAGCGGTGTTTTGTCACCGG
C6 ATGGTGAAGACGGCACAATATTTCGTGGGGAAGCGGTGTTTTGTCACCGG
**************************************************
C1 CGCGGCTAGTGGTATTGGCCGAGCCACCGCATTGCGGCTCGCCGCCTACG
C2 CGCGGCTAGTGGTATTGGCCGAGCCACCGCATTGCGGCTCGCCGCCTACG
C3 CGCGGCTAGTGGTATTGGCCGAGCCACCGCATTGCGGCTCGCCGCCTACG
C4 CGCGGCTAGTGGTATTGGCCGAGCCACCGCATTGCGGCTCGCCGCCTACG
C5 CGCGGCTAGTGGTATTGGCCGAGCCACCGCATTGCGGCTCGCCGCCTACG
C6 CGCGGCTAGTGGTATTGGCCGAGCCACCGCATTGCGGCTCGCCGCCTACG
**************************************************
C1 GTGCTGAGCTGTATCTGACCGACCGCCACTGCGATGGTTTGGCCCAAACC
C2 GTGCTGAGCTGTATCTGACCGACCGCCACTGCGATGGTTTGGCCCAAACC
C3 GTGCTGAGCTGTATCTGACCGACCGCCACTGCGATGGTTTGGCCCAAACC
C4 GTGCTGAGCTGTATCTGACCGACCGCCACTGCGATGGTTTGGCCCAAACC
C5 GTGCTGAGCTGTATCTGACCGACCGCCACTGCGATGGTTTGGCCCAAACC
C6 GTGCTGAGCTGTATCTGACCGACCGCCACTGCGATGGTTTGGCCCAAACC
**************************************************
C1 GTGTCCGAAGCACGGGCTCTCGGTGCACAGGTCCCCGAGTATCGTGCCCT
C2 GTGTCCGAAGCACGGGCTCTCGGTGCACAGGTCCCCGAGTATCGTGCCCT
C3 GTGTCCGAAGCACGGGCTCTCGGTGCACAGGTCCCCGAGTATCGTGCCCT
C4 GTGTCCGAAGCACGGGCTCTCGGTGCACAGGTCCCCGAGTATCGTGCCCT
C5 GTGTCCGAAGCACGGGCTCTCGGTGCACAGGTCCCCGAGTATCGTGCCCT
C6 GTGTCCGAAGCACGGGCTCTCGGTGCACAGGTCCCCGAGTATCGTGCCCT
**************************************************
C1 GGACATTTCCGACTACGACGAGGTGGCGGCATTCGGCGCTGACATCCACG
C2 GGACATTTCCGACTACGACGAGGTGGCGGCATTCGGCGCTGACATCCACG
C3 GGACATTTCCGACTACGACGAGGTGGCGGCATTCGGCGCTGACATCCACG
C4 GGACATTTCCGACTACGACGAGGTGGCGGCATTCGGCGCTGACATCCACG
C5 GGACATTTCCGACTACGACGAGGTGGCGGCATTCGGCGCTGACATCCACG
C6 GGACATTTCCGACTACGACGAGGTGGCGGCATTCGGCGCTGACATCCACG
**************************************************
C1 CAAGGCATCCCAGCATGGATATCGTGATGAATATCGCTGGCGTCTCGGTC
C2 CAAGGCATCCCAGCATGGATATCGTGATGAATATCGCTGGCGTCTCGGTC
C3 CAAGGCATCCCAGCATGGATATCGTGATGAATATCGCTGGCGTCTCGGTC
C4 CAAGGCATCCCAGCATGGATATCGTGATGAATATCGCTGGCGTCTCGGTC
C5 CAAGGCATCCCAGCATGGATATCGTGATGAATATCGCTGGCGTCTCGGTC
C6 CAAGGCATCCCAGCATGGATATCGTGATGAATATCGCTGGCGTCTCGGTC
**************************************************
C1 TGGGGGACTGTTGACCGACTCACCCACGACCAGTGGAGCAACGTGGTCGC
C2 TGGGGGACTGTTGACCGACTCACCCACGACCAGTGGAGCAACGTGGTCGC
C3 TGGGGGACTGTTGACCGACTCACCCACGACCAGTGGAGCAACGTGGTCGC
C4 TGGGGGACTGTTGACCGACTCACCCACGACCAGTGGAGCAACGTGGTCGC
C5 TGGGGGACTGTTGACCGACTCACCCACGACCAGTGGAGCAACGTGGTCGC
C6 TGGGGGACTGTTGACCGACTCACCCACGACCAGTGGAGCAACGTGGTCGC
**************************************************
C1 GATCAACCTGATGGGACCGATCCACATCATCGAGACGTTCGTGCCGGCGA
C2 GATCAACCTGATGGGACCGATCCACATCATCGAGACGTTCGTGCCGGCGA
C3 GATCAACCTGATGGGACCGATCCACATCATCGAGACGTTCGTGCCGCCGA
C4 GATCAACCTGATGGGACCGATCCACATCATCGAGACGTTCGTGCCGCCGA
C5 GATCAACCTGATGGGACCGATCCACATCATCGAGACGTTCGTGCCGCCGA
C6 GATCAACCTGATGGGACCGATCCACATCATCGAGACGTTCGTGCCGCCGA
********************************************** ***
C1 TCCTGGCCGCCGGCCGGGGTGGGCATTTGGTCAATGTCTCTTCGGCGGCT
C2 TCCTGGCCGCCGGCCGGGGTGGGCATTTGGTCAATGTCTCTTCGGCGGCT
C3 TCCTGGCCGCCGGCCGGGGTGGGCATTTGGTCAATGTCTCTTCGGCGGCT
C4 TCCTGGCCGCCGGCCGGGGTGGGCATTTGGTCAATGTCTCTTCGGCGGCT
C5 TCCTGGCCGCCGGCCGGGGTGGGCATTTGGTCAATGTCTCTTCGGCGGCT
C6 TCCTGGCCGCCGGCCGGGGTGGGCATTTGGTCAATGTCTCTTCGGCGGCT
**************************************************
C1 GGGCTGGTCGCCCTGCCCTGGCATGCGGCCTACAGTGCCAGCAAGTACGG
C2 GGGCTGGTCGCCCTGCCCTGGCATGCGGCCTACAGTGCCAGCAAGTACGG
C3 GGGCTGGTCGCCCTGCCCTGGCATGCGGCCTACAGTGCCAGCAAGTACGG
C4 GGGCTGGTCGCCCTGCCCTGGCATGCGGCCTACAGTGCCAGCAAGTACGG
C5 GGGCTGGTCGCCCTGCCCTGGCATGCGGCCTACAGTGCCAGCAAGTACGG
C6 GGGCTGGTCGCCCTGCCCTGGCATGCGGCCTACAGTGCCAGCAAGTACGG
**************************************************
C1 ATTGCGCGGACTTTCTGAGGTGCTGCGCTTCGACCTAGCCCGGTACCGCA
C2 ATTGCGCGGACTTTCTGAGGTGCTGCGCTTCGACCTAGCCCGGTACCGCA
C3 ATTGCGCGGACTTTCTGAGGTGCTGCGCTTCGACCTAGCCCGGTACCGCA
C4 ATTGCGCGGACTTTCTGAGGTGCTGCGCTTCGACCTAGCCCGGTACCGCA
C5 ATTGCGCGGACTTTCTGAGGTGCTGCGCTTCGACCTAGCCCGGTACCGCA
C6 ATTGCGCGGACTTTCTGAGGTGCTGCGCTTCGACCTAGCCCGGTACCGCA
**************************************************
C1 TCGGGGTGTCGGTTGTGGTGCCCGGTGCGGTACGGACGCCGCTAGTCGAT
C2 TCGGGGTGTCGGTTGTGGTGCCCGGTGCGGTACGGACGCCGCTAGTCGAT
C3 TCGGGGTGTCGGTTGTGGTGCCCGGTGCGGTACGGACGCCGCTAGTCGAT
C4 TCGGGGTGTCGGTTGTGGTGCCCGGTGCGGTACGGACGCCGCTAGTCGAT
C5 TCGGGGTGTCGGTTGTGGTGCCCGGTGCGGTACGGACGCCGCTAGTCGAT
C6 TCGGGGTGTCGGTTGTGGTGCCCGGTGCGGTACGGACGCCGCTAGTCGAT
**************************************************
C1 ACTATCGAAATTGCCGGGGTTGACCGCCAGGACCCGAGGTTCAGTCGATG
C2 ACTATCGAAATTGCCGGGGTTGACCGCCAGGACCCGAGGTTCAGTCGATG
C3 ACTATCGAAATTGCCGGGGTTGACCGCCAGGACCCGAGGTTCAGTCGATG
C4 ACTATCGAAATTGCCGGGGTTGACCGCCAGGACCCGAGGTTCAGTCGATG
C5 ACTATCGAAATTGCCGGGGTTGACCGCCAGGACCCGAGGTTCAGTCGATG
C6 ACTATCGAAATTGCCGGGGTTGACCGCCAGGACCCGAGGTTCAGTCGATG
**************************************************
C1 GGTTGACCGCTTCCGTGGTCATGCTGTGTCAGCGGAAAGGGCCGCCGAGA
C2 GGTTGACCGCTTCCGTGGTCATGCTGTGTCAGCGGAAAGGGCCGCCGAGA
C3 GGTTGACCGCTTCCGTGGTCATGCTGTGTCAGCGGAAAGGGCCGCCGAGA
C4 GGTTGACCGCTTCCGTGGTCATGCTGTGTCAGCGGAAAGGGCCGCCGAGA
C5 GGTTGACCGCTTCCGTGGTCATGCTGTGTCAGCGGAAAGGGCCGCCGAGA
C6 GGTTGACCGCTTCCGTGGTCATGCTGTGTCAGCGGAAAGGGCCGCCGAGA
**************************************************
C1 AGATCTTGGCCGGGGTCGCAAAGAACCGGTACCTGATCTACACCTCGCAC
C2 AGATCTTGGCCGGGGTCGCAAAGAACCGGTACCTGATCTACACCTCGCAC
C3 AGATCTTGGCCGGGGTCGCAAAGAACCGGTACCTGATCTACACCTCGCAC
C4 AGATCTTGGCCGGGGTCGCAAAGAACCGGTACCTGATCTACACCTCGCAC
C5 AGATCTTGGCCGGGGTCGCAAAGAACCGGTACCTGATCTACACCTCGCAC
C6 AGATCTTGGCCGGGGTCGCAAAGAACCGGTACCTGATCTACACCTCGCAC
**************************************************
C1 GATATTCGGGTGCTGTATGGGTTCAAGCGGCTGGCGTGGTGGCCGTACGG
C2 GATATTCGGGTGCTGTATGGGTTCAAGCGGCTGGCGTGGTGGCCGTACGG
C3 GATATTCGGGTGCTGTATGGGTTCAAGCGGCTGGCGTGGTGGCCGTACGG
C4 GATATTCGGGTGCTGTATGGGTTCAAGCGGCTGGCGTGGTGGCCGTACGG
C5 GATATTCGGGTGCTGTATGGGTTCAAGCGGCTGGCGTGGTGGCCGTACGG
C6 GATATTCGGGTGCTGTATGGGTTCAAGCGGCTGGCGTGGTGGCCGTACGG
**************************************************
C1 AGTGGTGATGAAGCAAGTCAACGTAGTTTTCACGCGGGCACTTCGGCCCA
C2 AGTGGTGATGAAGCAAGTCAACGTAGTTTTCACGCGGGCACTTCGGCCCA
C3 AGTGGTGATGAAGCAAGTCAACGTAGTTTTCACGCGGGCACTTCGGCCCA
C4 AGTGGTGATGAAGCAAGTCAACGTAGTTTTCACGCGGGCACTTCGGCCCA
C5 AGTGGTGATGAAGCAAGTCAACGTAGTTTTCACGCGGGCACTTCGGCCCA
C6 AGTGGTGATGAAGCAAGTCAACGTAGTTTTCACGCGGGCACTTCGGCCCA
**************************************************
C1 GTCCGGCGACGATGCGGTGCGTGGAGCCGATCAAGGTGGGGGTGTACTCC
C2 GTCCGGCGACGATGCGGTGCGTGGAGCCGATCAAGGTGGGGGTGTACTCC
C3 GTCCGGCGACGATGCGGTGCGTGGAGCCGATCAAGGTGGGGGTGTACTCC
C4 GTCCGGCGACGATGCGGTGCGTGGAGCCGATCAAGGTGGGGGTGTACTCC
C5 GTCCGGCGACGATGCGGTGCGTGGAGCCGATCAAGGTGGGGGTGTACTCC
C6 GTCCGGCGACGATGCGGTGCGTGGAGCCGATCAAGGTGGGGGTGTACTCC
**************************************************
C1 CAGCCGCGCAGCGGTGAGGGGGGCAAGTCGGGCAAT
C2 CAGCCGCGCAGCGGTGAGGGGGGCAAGTCGGGCAAT
C3 CAGCCGCGCAGCGGTGAGGGGGGCAAGTCGGGCAAT
C4 CAGCCGCGCAGCGGTGAGGGGGGCAAGTCGGGCAAT
C5 CAGCCGCGCAGCGGTGAGGGGGGCAAGTCGGGCAAT
C6 CAGCCGCGCAGCGGTGAGGGGGGCAAGTCGGGCAAT
************************************
>C1
ATGGTGAAGACGGCACAATATTTCGTGGGGAAGCGGTGTTTTGTCACCGG
CGCGGCTAGTGGTATTGGCCGAGCCACCGCATTGCGGCTCGCCGCCTACG
GTGCTGAGCTGTATCTGACCGACCGCCACTGCGATGGTTTGGCCCAAACC
GTGTCCGAAGCACGGGCTCTCGGTGCACAGGTCCCCGAGTATCGTGCCCT
GGACATTTCCGACTACGACGAGGTGGCGGCATTCGGCGCTGACATCCACG
CAAGGCATCCCAGCATGGATATCGTGATGAATATCGCTGGCGTCTCGGTC
TGGGGGACTGTTGACCGACTCACCCACGACCAGTGGAGCAACGTGGTCGC
GATCAACCTGATGGGACCGATCCACATCATCGAGACGTTCGTGCCGGCGA
TCCTGGCCGCCGGCCGGGGTGGGCATTTGGTCAATGTCTCTTCGGCGGCT
GGGCTGGTCGCCCTGCCCTGGCATGCGGCCTACAGTGCCAGCAAGTACGG
ATTGCGCGGACTTTCTGAGGTGCTGCGCTTCGACCTAGCCCGGTACCGCA
TCGGGGTGTCGGTTGTGGTGCCCGGTGCGGTACGGACGCCGCTAGTCGAT
ACTATCGAAATTGCCGGGGTTGACCGCCAGGACCCGAGGTTCAGTCGATG
GGTTGACCGCTTCCGTGGTCATGCTGTGTCAGCGGAAAGGGCCGCCGAGA
AGATCTTGGCCGGGGTCGCAAAGAACCGGTACCTGATCTACACCTCGCAC
GATATTCGGGTGCTGTATGGGTTCAAGCGGCTGGCGTGGTGGCCGTACGG
AGTGGTGATGAAGCAAGTCAACGTAGTTTTCACGCGGGCACTTCGGCCCA
GTCCGGCGACGATGCGGTGCGTGGAGCCGATCAAGGTGGGGGTGTACTCC
CAGCCGCGCAGCGGTGAGGGGGGCAAGTCGGGCAAT
>C2
ATGGTGAAGACGGCACAATATTTCGTGGGGAAGCGGTGTTTTGTCACCGG
CGCGGCTAGTGGTATTGGCCGAGCCACCGCATTGCGGCTCGCCGCCTACG
GTGCTGAGCTGTATCTGACCGACCGCCACTGCGATGGTTTGGCCCAAACC
GTGTCCGAAGCACGGGCTCTCGGTGCACAGGTCCCCGAGTATCGTGCCCT
GGACATTTCCGACTACGACGAGGTGGCGGCATTCGGCGCTGACATCCACG
CAAGGCATCCCAGCATGGATATCGTGATGAATATCGCTGGCGTCTCGGTC
TGGGGGACTGTTGACCGACTCACCCACGACCAGTGGAGCAACGTGGTCGC
GATCAACCTGATGGGACCGATCCACATCATCGAGACGTTCGTGCCGGCGA
TCCTGGCCGCCGGCCGGGGTGGGCATTTGGTCAATGTCTCTTCGGCGGCT
GGGCTGGTCGCCCTGCCCTGGCATGCGGCCTACAGTGCCAGCAAGTACGG
ATTGCGCGGACTTTCTGAGGTGCTGCGCTTCGACCTAGCCCGGTACCGCA
TCGGGGTGTCGGTTGTGGTGCCCGGTGCGGTACGGACGCCGCTAGTCGAT
ACTATCGAAATTGCCGGGGTTGACCGCCAGGACCCGAGGTTCAGTCGATG
GGTTGACCGCTTCCGTGGTCATGCTGTGTCAGCGGAAAGGGCCGCCGAGA
AGATCTTGGCCGGGGTCGCAAAGAACCGGTACCTGATCTACACCTCGCAC
GATATTCGGGTGCTGTATGGGTTCAAGCGGCTGGCGTGGTGGCCGTACGG
AGTGGTGATGAAGCAAGTCAACGTAGTTTTCACGCGGGCACTTCGGCCCA
GTCCGGCGACGATGCGGTGCGTGGAGCCGATCAAGGTGGGGGTGTACTCC
CAGCCGCGCAGCGGTGAGGGGGGCAAGTCGGGCAAT
>C3
ATGGTGAAGACGGCACAATATTTCGTGGGGAAGCGGTGTTTTGTCACCGG
CGCGGCTAGTGGTATTGGCCGAGCCACCGCATTGCGGCTCGCCGCCTACG
GTGCTGAGCTGTATCTGACCGACCGCCACTGCGATGGTTTGGCCCAAACC
GTGTCCGAAGCACGGGCTCTCGGTGCACAGGTCCCCGAGTATCGTGCCCT
GGACATTTCCGACTACGACGAGGTGGCGGCATTCGGCGCTGACATCCACG
CAAGGCATCCCAGCATGGATATCGTGATGAATATCGCTGGCGTCTCGGTC
TGGGGGACTGTTGACCGACTCACCCACGACCAGTGGAGCAACGTGGTCGC
GATCAACCTGATGGGACCGATCCACATCATCGAGACGTTCGTGCCGCCGA
TCCTGGCCGCCGGCCGGGGTGGGCATTTGGTCAATGTCTCTTCGGCGGCT
GGGCTGGTCGCCCTGCCCTGGCATGCGGCCTACAGTGCCAGCAAGTACGG
ATTGCGCGGACTTTCTGAGGTGCTGCGCTTCGACCTAGCCCGGTACCGCA
TCGGGGTGTCGGTTGTGGTGCCCGGTGCGGTACGGACGCCGCTAGTCGAT
ACTATCGAAATTGCCGGGGTTGACCGCCAGGACCCGAGGTTCAGTCGATG
GGTTGACCGCTTCCGTGGTCATGCTGTGTCAGCGGAAAGGGCCGCCGAGA
AGATCTTGGCCGGGGTCGCAAAGAACCGGTACCTGATCTACACCTCGCAC
GATATTCGGGTGCTGTATGGGTTCAAGCGGCTGGCGTGGTGGCCGTACGG
AGTGGTGATGAAGCAAGTCAACGTAGTTTTCACGCGGGCACTTCGGCCCA
GTCCGGCGACGATGCGGTGCGTGGAGCCGATCAAGGTGGGGGTGTACTCC
CAGCCGCGCAGCGGTGAGGGGGGCAAGTCGGGCAAT
>C4
ATGGTGAAGACGGCACAATATTTCGTGGGGAAGCGGTGTTTTGTCACCGG
CGCGGCTAGTGGTATTGGCCGAGCCACCGCATTGCGGCTCGCCGCCTACG
GTGCTGAGCTGTATCTGACCGACCGCCACTGCGATGGTTTGGCCCAAACC
GTGTCCGAAGCACGGGCTCTCGGTGCACAGGTCCCCGAGTATCGTGCCCT
GGACATTTCCGACTACGACGAGGTGGCGGCATTCGGCGCTGACATCCACG
CAAGGCATCCCAGCATGGATATCGTGATGAATATCGCTGGCGTCTCGGTC
TGGGGGACTGTTGACCGACTCACCCACGACCAGTGGAGCAACGTGGTCGC
GATCAACCTGATGGGACCGATCCACATCATCGAGACGTTCGTGCCGCCGA
TCCTGGCCGCCGGCCGGGGTGGGCATTTGGTCAATGTCTCTTCGGCGGCT
GGGCTGGTCGCCCTGCCCTGGCATGCGGCCTACAGTGCCAGCAAGTACGG
ATTGCGCGGACTTTCTGAGGTGCTGCGCTTCGACCTAGCCCGGTACCGCA
TCGGGGTGTCGGTTGTGGTGCCCGGTGCGGTACGGACGCCGCTAGTCGAT
ACTATCGAAATTGCCGGGGTTGACCGCCAGGACCCGAGGTTCAGTCGATG
GGTTGACCGCTTCCGTGGTCATGCTGTGTCAGCGGAAAGGGCCGCCGAGA
AGATCTTGGCCGGGGTCGCAAAGAACCGGTACCTGATCTACACCTCGCAC
GATATTCGGGTGCTGTATGGGTTCAAGCGGCTGGCGTGGTGGCCGTACGG
AGTGGTGATGAAGCAAGTCAACGTAGTTTTCACGCGGGCACTTCGGCCCA
GTCCGGCGACGATGCGGTGCGTGGAGCCGATCAAGGTGGGGGTGTACTCC
CAGCCGCGCAGCGGTGAGGGGGGCAAGTCGGGCAAT
>C5
ATGGTGAAGACGGCACAATATTTCGTGGGGAAGCGGTGTTTTGTCACCGG
CGCGGCTAGTGGTATTGGCCGAGCCACCGCATTGCGGCTCGCCGCCTACG
GTGCTGAGCTGTATCTGACCGACCGCCACTGCGATGGTTTGGCCCAAACC
GTGTCCGAAGCACGGGCTCTCGGTGCACAGGTCCCCGAGTATCGTGCCCT
GGACATTTCCGACTACGACGAGGTGGCGGCATTCGGCGCTGACATCCACG
CAAGGCATCCCAGCATGGATATCGTGATGAATATCGCTGGCGTCTCGGTC
TGGGGGACTGTTGACCGACTCACCCACGACCAGTGGAGCAACGTGGTCGC
GATCAACCTGATGGGACCGATCCACATCATCGAGACGTTCGTGCCGCCGA
TCCTGGCCGCCGGCCGGGGTGGGCATTTGGTCAATGTCTCTTCGGCGGCT
GGGCTGGTCGCCCTGCCCTGGCATGCGGCCTACAGTGCCAGCAAGTACGG
ATTGCGCGGACTTTCTGAGGTGCTGCGCTTCGACCTAGCCCGGTACCGCA
TCGGGGTGTCGGTTGTGGTGCCCGGTGCGGTACGGACGCCGCTAGTCGAT
ACTATCGAAATTGCCGGGGTTGACCGCCAGGACCCGAGGTTCAGTCGATG
GGTTGACCGCTTCCGTGGTCATGCTGTGTCAGCGGAAAGGGCCGCCGAGA
AGATCTTGGCCGGGGTCGCAAAGAACCGGTACCTGATCTACACCTCGCAC
GATATTCGGGTGCTGTATGGGTTCAAGCGGCTGGCGTGGTGGCCGTACGG
AGTGGTGATGAAGCAAGTCAACGTAGTTTTCACGCGGGCACTTCGGCCCA
GTCCGGCGACGATGCGGTGCGTGGAGCCGATCAAGGTGGGGGTGTACTCC
CAGCCGCGCAGCGGTGAGGGGGGCAAGTCGGGCAAT
>C6
ATGGTGAAGACGGCACAATATTTCGTGGGGAAGCGGTGTTTTGTCACCGG
CGCGGCTAGTGGTATTGGCCGAGCCACCGCATTGCGGCTCGCCGCCTACG
GTGCTGAGCTGTATCTGACCGACCGCCACTGCGATGGTTTGGCCCAAACC
GTGTCCGAAGCACGGGCTCTCGGTGCACAGGTCCCCGAGTATCGTGCCCT
GGACATTTCCGACTACGACGAGGTGGCGGCATTCGGCGCTGACATCCACG
CAAGGCATCCCAGCATGGATATCGTGATGAATATCGCTGGCGTCTCGGTC
TGGGGGACTGTTGACCGACTCACCCACGACCAGTGGAGCAACGTGGTCGC
GATCAACCTGATGGGACCGATCCACATCATCGAGACGTTCGTGCCGCCGA
TCCTGGCCGCCGGCCGGGGTGGGCATTTGGTCAATGTCTCTTCGGCGGCT
GGGCTGGTCGCCCTGCCCTGGCATGCGGCCTACAGTGCCAGCAAGTACGG
ATTGCGCGGACTTTCTGAGGTGCTGCGCTTCGACCTAGCCCGGTACCGCA
TCGGGGTGTCGGTTGTGGTGCCCGGTGCGGTACGGACGCCGCTAGTCGAT
ACTATCGAAATTGCCGGGGTTGACCGCCAGGACCCGAGGTTCAGTCGATG
GGTTGACCGCTTCCGTGGTCATGCTGTGTCAGCGGAAAGGGCCGCCGAGA
AGATCTTGGCCGGGGTCGCAAAGAACCGGTACCTGATCTACACCTCGCAC
GATATTCGGGTGCTGTATGGGTTCAAGCGGCTGGCGTGGTGGCCGTACGG
AGTGGTGATGAAGCAAGTCAACGTAGTTTTCACGCGGGCACTTCGGCCCA
GTCCGGCGACGATGCGGTGCGTGGAGCCGATCAAGGTGGGGGTGTACTCC
CAGCCGCGCAGCGGTGAGGGGGGCAAGTCGGGCAAT
>C1
MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPAILAAGRGGHLVNVSSAA
GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
QPRSGEGGKSGN
>C2
MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPAILAAGRGGHLVNVSSAA
GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
QPRSGEGGKSGN
>C3
MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPPILAAGRGGHLVNVSSAA
GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
QPRSGEGGKSGN
>C4
MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPPILAAGRGGHLVNVSSAA
GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
QPRSGEGGKSGN
>C5
MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPPILAAGRGGHLVNVSSAA
GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
QPRSGEGGKSGN
>C6
MVKTAQYFVGKRCFVTGAASGIGRATALRLAAYGAELYLTDRHCDGLAQT
VSEARALGAQVPEYRALDISDYDEVAAFGADIHARHPSMDIVMNIAGVSV
WGTVDRLTHDQWSNVVAINLMGPIHIIETFVPPILAAGRGGHLVNVSSAA
GLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPLVD
TIEIAGVDRQDPRFSRWVDRFRGHAVSAERAAEKILAGVAKNRYLIYTSH
DIRVLYGFKRLAWWPYGVVMKQVNVVFTRALRPSPATMRCVEPIKVGVYS
QPRSGEGGKSGN
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 936 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579858183
Setting output file names to "/data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2056401008
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5930628042
Seed = 874148748
Swapseed = 1579858183
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 5 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2098.180150 -- -24.965149
Chain 2 -- -2101.483363 -- -24.965149
Chain 3 -- -2100.846517 -- -24.965149
Chain 4 -- -2100.846517 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2100.846517 -- -24.965149
Chain 2 -- -2101.519935 -- -24.965149
Chain 3 -- -2100.846396 -- -24.965149
Chain 4 -- -2098.180150 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2098.180] (-2101.483) (-2100.847) (-2100.847) * [-2100.847] (-2101.520) (-2100.846) (-2098.180)
500 -- (-1297.677) (-1282.301) (-1318.930) [-1291.543] * (-1302.571) [-1286.845] (-1298.566) (-1288.915) -- 0:00:00
1000 -- (-1283.283) (-1278.313) [-1285.288] (-1298.019) * [-1281.080] (-1285.590) (-1296.171) (-1276.359) -- 0:00:00
1500 -- (-1286.468) (-1285.702) [-1281.453] (-1284.132) * (-1291.636) (-1284.962) [-1288.725] (-1285.475) -- 0:00:00
2000 -- (-1280.143) (-1289.405) [-1281.339] (-1291.979) * [-1282.463] (-1291.809) (-1284.180) (-1282.123) -- 0:00:00
2500 -- (-1287.068) (-1281.042) [-1280.923] (-1287.793) * (-1285.572) [-1278.153] (-1285.736) (-1292.728) -- 0:00:00
3000 -- (-1285.830) [-1277.904] (-1282.563) (-1295.382) * [-1290.009] (-1286.189) (-1278.150) (-1284.284) -- 0:00:00
3500 -- (-1285.856) (-1291.261) (-1290.446) [-1281.928] * [-1279.873] (-1279.370) (-1291.757) (-1280.638) -- 0:00:00
4000 -- (-1282.707) (-1291.119) [-1281.109] (-1302.376) * (-1278.537) [-1283.731] (-1282.605) (-1288.665) -- 0:00:00
4500 -- [-1287.797] (-1283.356) (-1292.471) (-1285.441) * (-1286.462) [-1281.046] (-1278.328) (-1283.091) -- 0:00:00
5000 -- [-1283.933] (-1282.360) (-1291.428) (-1289.484) * (-1285.451) (-1285.357) [-1278.285] (-1281.984) -- 0:00:00
Average standard deviation of split frequencies: 0.099995
5500 -- (-1285.179) (-1290.286) [-1280.324] (-1288.752) * [-1280.362] (-1283.027) (-1290.165) (-1286.546) -- 0:03:00
6000 -- (-1286.270) (-1286.147) [-1283.492] (-1283.025) * [-1277.435] (-1288.820) (-1281.308) (-1285.063) -- 0:02:45
6500 -- [-1283.949] (-1293.640) (-1279.835) (-1279.941) * (-1285.809) (-1285.694) [-1282.287] (-1279.430) -- 0:02:32
7000 -- (-1283.666) (-1282.669) [-1279.954] (-1283.698) * (-1292.202) (-1281.893) [-1277.475] (-1280.644) -- 0:02:21
7500 -- (-1287.419) (-1283.187) [-1277.894] (-1291.728) * (-1282.946) (-1283.785) (-1286.925) [-1281.224] -- 0:02:12
8000 -- (-1279.940) (-1289.288) [-1288.511] (-1277.142) * (-1282.497) (-1283.652) (-1282.560) [-1280.321] -- 0:02:04
8500 -- (-1289.801) (-1281.235) (-1290.500) [-1277.784] * (-1288.648) (-1285.248) (-1284.977) [-1286.955] -- 0:01:56
9000 -- [-1283.779] (-1278.707) (-1293.163) (-1286.485) * (-1285.261) [-1287.865] (-1281.001) (-1284.523) -- 0:01:50
9500 -- [-1284.352] (-1287.631) (-1285.402) (-1285.827) * [-1286.416] (-1293.729) (-1283.795) (-1288.508) -- 0:01:44
10000 -- (-1282.877) (-1287.338) (-1285.845) [-1278.954] * (-1285.579) (-1284.479) [-1285.439] (-1277.098) -- 0:01:39
Average standard deviation of split frequencies: 0.088388
10500 -- [-1280.128] (-1285.655) (-1288.527) (-1292.344) * [-1284.830] (-1292.521) (-1290.325) (-1277.611) -- 0:01:34
11000 -- (-1286.225) (-1282.820) (-1283.261) [-1286.358] * (-1283.788) (-1279.364) (-1284.089) [-1282.155] -- 0:01:29
11500 -- [-1277.940] (-1296.643) (-1285.694) (-1282.792) * (-1280.376) [-1278.388] (-1280.311) (-1279.740) -- 0:01:25
12000 -- [-1282.750] (-1278.796) (-1287.376) (-1282.026) * (-1278.569) (-1278.932) (-1283.078) [-1277.101] -- 0:01:22
12500 -- (-1291.864) [-1286.144] (-1279.169) (-1283.593) * (-1277.553) (-1278.705) [-1282.370] (-1279.403) -- 0:01:19
13000 -- (-1283.046) (-1287.704) [-1280.156] (-1282.813) * (-1279.859) (-1281.353) [-1281.325] (-1285.399) -- 0:01:15
13500 -- [-1284.251] (-1283.278) (-1287.030) (-1284.570) * (-1279.718) (-1281.543) [-1280.526] (-1279.397) -- 0:01:13
14000 -- [-1288.392] (-1284.995) (-1285.663) (-1284.594) * (-1279.547) (-1278.153) [-1281.547] (-1277.538) -- 0:01:10
14500 -- (-1282.507) (-1279.990) (-1291.477) [-1284.321] * (-1278.349) (-1279.678) [-1284.518] (-1278.537) -- 0:01:07
15000 -- (-1284.905) [-1275.902] (-1284.980) (-1282.428) * (-1276.824) [-1278.077] (-1283.254) (-1279.219) -- 0:01:05
Average standard deviation of split frequencies: 0.064282
15500 -- (-1289.816) (-1284.305) [-1280.753] (-1283.717) * [-1277.967] (-1280.280) (-1281.296) (-1279.518) -- 0:01:03
16000 -- (-1282.227) [-1289.547] (-1281.476) (-1281.047) * (-1277.545) (-1280.007) [-1286.547] (-1278.015) -- 0:01:01
16500 -- (-1288.199) [-1285.559] (-1282.553) (-1279.301) * (-1276.683) (-1278.138) (-1290.360) [-1278.960] -- 0:00:59
17000 -- (-1286.873) [-1285.768] (-1280.395) (-1280.324) * (-1279.112) (-1280.018) [-1281.946] (-1277.517) -- 0:00:57
17500 -- (-1284.095) (-1281.210) (-1290.150) [-1286.064] * (-1278.610) (-1278.282) [-1280.862] (-1277.959) -- 0:00:56
18000 -- (-1289.251) (-1277.754) [-1279.517] (-1279.626) * (-1279.423) (-1278.507) [-1281.064] (-1278.934) -- 0:00:54
18500 -- (-1279.432) (-1290.912) [-1282.930] (-1281.614) * (-1279.299) (-1278.070) (-1281.541) [-1278.807] -- 0:01:46
19000 -- (-1282.144) (-1286.869) (-1282.057) [-1280.667] * (-1280.002) (-1277.838) (-1289.937) [-1278.968] -- 0:01:43
19500 -- (-1288.384) (-1279.339) [-1288.020] (-1284.623) * [-1278.300] (-1277.927) (-1285.105) (-1278.355) -- 0:01:40
20000 -- (-1287.108) [-1295.069] (-1285.995) (-1291.008) * [-1279.475] (-1279.490) (-1300.314) (-1279.635) -- 0:01:38
Average standard deviation of split frequencies: 0.078798
20500 -- (-1286.217) (-1287.008) (-1289.363) [-1286.988] * (-1280.436) (-1279.080) [-1280.235] (-1280.374) -- 0:01:35
21000 -- (-1283.162) (-1284.942) (-1281.961) [-1284.539] * (-1281.494) [-1279.524] (-1282.528) (-1277.791) -- 0:01:33
21500 -- (-1297.326) [-1283.371] (-1284.263) (-1284.051) * (-1280.238) (-1279.277) [-1276.108] (-1280.218) -- 0:01:31
22000 -- (-1297.347) [-1283.391] (-1285.062) (-1282.773) * (-1277.591) (-1283.756) (-1281.505) [-1278.840] -- 0:01:28
22500 -- (-1278.320) (-1278.727) (-1278.866) [-1274.964] * (-1277.742) (-1279.728) [-1289.479] (-1279.327) -- 0:01:26
23000 -- (-1280.733) [-1277.544] (-1280.263) (-1288.231) * (-1278.120) (-1277.122) [-1276.990] (-1279.302) -- 0:01:24
23500 -- (-1278.496) (-1282.880) (-1283.489) [-1289.030] * [-1277.388] (-1278.661) (-1285.976) (-1282.632) -- 0:01:23
24000 -- (-1278.787) [-1289.061] (-1285.983) (-1285.293) * [-1278.910] (-1277.595) (-1286.725) (-1279.674) -- 0:01:21
24500 -- (-1279.412) (-1287.466) (-1282.597) [-1284.949] * (-1278.315) (-1277.876) [-1281.945] (-1279.773) -- 0:01:19
25000 -- (-1285.419) (-1286.251) [-1280.173] (-1287.883) * [-1279.279] (-1282.099) (-1278.722) (-1279.239) -- 0:01:18
Average standard deviation of split frequencies: 0.073918
25500 -- (-1280.149) (-1280.346) (-1282.452) [-1279.037] * (-1280.775) (-1280.173) [-1285.961] (-1281.315) -- 0:01:16
26000 -- (-1277.805) [-1285.064] (-1282.800) (-1295.085) * (-1278.474) (-1278.500) (-1288.561) [-1278.390] -- 0:01:14
26500 -- [-1279.281] (-1282.872) (-1283.429) (-1277.738) * (-1280.817) (-1280.275) (-1289.345) [-1281.718] -- 0:01:13
27000 -- (-1278.153) [-1279.757] (-1279.739) (-1280.608) * (-1283.410) (-1282.561) (-1290.160) [-1278.406] -- 0:01:12
27500 -- (-1278.851) (-1279.220) (-1282.143) [-1278.820] * (-1279.398) (-1282.816) [-1287.387] (-1280.216) -- 0:01:10
28000 -- (-1279.716) (-1286.279) (-1285.205) [-1287.733] * (-1279.644) [-1281.510] (-1291.676) (-1280.380) -- 0:01:09
28500 -- (-1278.089) (-1280.399) (-1282.797) [-1283.460] * (-1281.569) (-1281.064) (-1282.239) [-1278.129] -- 0:01:08
29000 -- (-1275.925) (-1283.488) [-1280.772] (-1288.506) * [-1280.241] (-1281.098) (-1280.806) (-1278.198) -- 0:01:06
29500 -- (-1284.061) [-1284.127] (-1281.528) (-1285.524) * (-1280.374) (-1280.031) [-1283.470] (-1278.613) -- 0:01:05
30000 -- [-1277.939] (-1280.353) (-1290.176) (-1282.390) * [-1277.633] (-1279.630) (-1286.946) (-1279.030) -- 0:01:04
Average standard deviation of split frequencies: 0.058926
30500 -- (-1278.429) (-1285.653) (-1285.799) [-1284.317] * (-1284.561) (-1280.383) [-1286.934] (-1278.065) -- 0:01:03
31000 -- (-1279.375) [-1284.421] (-1282.919) (-1288.962) * (-1278.941) [-1277.336] (-1282.814) (-1276.526) -- 0:01:02
31500 -- (-1278.488) (-1284.934) (-1282.077) [-1281.993] * (-1279.200) (-1277.918) (-1287.380) [-1278.830] -- 0:01:01
32000 -- [-1278.034] (-1280.003) (-1285.868) (-1288.747) * (-1280.189) [-1278.964] (-1287.843) (-1280.982) -- 0:01:30
32500 -- (-1277.394) (-1290.901) (-1282.934) [-1284.885] * (-1279.472) (-1279.569) [-1277.730] (-1276.748) -- 0:01:29
33000 -- (-1279.052) (-1288.046) [-1287.022] (-1286.391) * (-1279.613) (-1279.606) (-1278.044) [-1278.285] -- 0:01:27
33500 -- (-1279.775) (-1278.646) (-1283.251) [-1282.535] * (-1278.942) (-1279.029) [-1283.551] (-1283.060) -- 0:01:26
34000 -- (-1278.364) [-1279.468] (-1286.289) (-1280.734) * [-1279.906] (-1279.568) (-1277.392) (-1281.705) -- 0:01:25
34500 -- [-1278.882] (-1277.451) (-1283.599) (-1279.949) * (-1278.738) [-1277.354] (-1285.878) (-1277.630) -- 0:01:23
35000 -- (-1280.072) (-1278.085) (-1283.341) [-1279.525] * (-1278.167) (-1278.030) (-1282.183) [-1278.735] -- 0:01:22
Average standard deviation of split frequencies: 0.047342
35500 -- (-1279.208) (-1278.480) [-1288.257] (-1277.425) * [-1278.946] (-1280.474) (-1287.263) (-1279.462) -- 0:01:21
36000 -- (-1278.302) [-1277.669] (-1288.705) (-1278.815) * (-1278.285) (-1283.196) [-1277.762] (-1281.235) -- 0:01:20
36500 -- [-1278.514] (-1277.287) (-1287.303) (-1280.511) * [-1278.498] (-1278.598) (-1279.700) (-1284.292) -- 0:01:19
37000 -- (-1278.316) (-1276.826) [-1289.745] (-1283.551) * (-1279.225) (-1278.189) [-1286.499] (-1280.731) -- 0:01:18
37500 -- (-1278.769) (-1278.161) (-1279.674) [-1282.033] * [-1278.729] (-1279.704) (-1284.001) (-1282.114) -- 0:01:17
38000 -- [-1277.627] (-1279.409) (-1279.887) (-1286.399) * [-1278.516] (-1279.595) (-1279.997) (-1278.834) -- 0:01:15
38500 -- (-1278.831) (-1283.770) [-1294.071] (-1280.102) * (-1280.198) (-1277.612) (-1283.552) [-1279.640] -- 0:01:14
39000 -- (-1279.444) (-1281.893) [-1278.416] (-1277.447) * (-1278.355) (-1278.277) (-1282.260) [-1279.241] -- 0:01:13
39500 -- (-1282.578) [-1281.983] (-1284.444) (-1285.236) * (-1277.718) (-1279.417) [-1280.780] (-1279.436) -- 0:01:12
40000 -- [-1281.427] (-1278.463) (-1284.200) (-1281.780) * [-1276.883] (-1281.061) (-1283.116) (-1278.597) -- 0:01:12
Average standard deviation of split frequencies: 0.050826
40500 -- (-1282.880) (-1280.333) [-1283.950] (-1285.812) * (-1279.417) (-1278.352) (-1284.651) [-1277.061] -- 0:01:11
41000 -- [-1278.791] (-1278.226) (-1279.502) (-1276.852) * (-1278.705) (-1280.572) (-1294.401) [-1279.312] -- 0:01:10
41500 -- (-1279.351) (-1276.522) (-1282.550) [-1276.657] * (-1280.675) [-1278.899] (-1281.179) (-1277.254) -- 0:01:09
42000 -- [-1278.048] (-1276.762) (-1281.022) (-1287.867) * (-1278.504) (-1277.893) [-1279.493] (-1277.737) -- 0:01:08
42500 -- (-1278.232) (-1276.990) (-1283.523) [-1285.224] * (-1282.276) (-1278.935) [-1282.396] (-1278.510) -- 0:01:07
43000 -- (-1278.993) (-1277.638) (-1281.878) [-1282.132] * (-1281.445) [-1278.218] (-1284.584) (-1282.373) -- 0:01:06
43500 -- (-1278.522) (-1279.783) (-1280.441) [-1278.343] * [-1286.614] (-1278.374) (-1293.739) (-1283.887) -- 0:01:05
44000 -- (-1278.624) (-1277.442) (-1284.280) [-1277.972] * (-1280.323) [-1277.702] (-1282.231) (-1280.186) -- 0:01:05
44500 -- [-1281.235] (-1279.115) (-1288.125) (-1282.487) * (-1278.310) [-1279.828] (-1286.639) (-1278.228) -- 0:01:04
45000 -- (-1278.963) (-1277.013) (-1297.092) [-1277.877] * (-1278.965) (-1278.441) [-1296.426] (-1278.180) -- 0:01:03
Average standard deviation of split frequencies: 0.045722
45500 -- (-1279.603) (-1275.761) (-1285.006) [-1281.131] * [-1278.807] (-1277.986) (-1283.497) (-1279.158) -- 0:01:02
46000 -- (-1281.513) [-1277.827] (-1291.812) (-1283.580) * (-1276.603) [-1281.843] (-1283.665) (-1279.041) -- 0:01:02
46500 -- (-1281.884) (-1276.183) [-1284.104] (-1284.085) * (-1279.886) (-1280.765) (-1282.227) [-1279.129] -- 0:01:22
47000 -- (-1279.790) (-1278.069) [-1278.472] (-1286.396) * (-1277.714) (-1277.729) [-1278.198] (-1278.750) -- 0:01:21
47500 -- (-1280.526) (-1279.909) [-1280.096] (-1279.401) * [-1280.467] (-1277.870) (-1276.930) (-1278.996) -- 0:01:20
48000 -- (-1279.545) (-1280.483) (-1299.573) [-1282.007] * (-1279.485) (-1278.266) [-1277.698] (-1279.493) -- 0:01:19
48500 -- (-1278.410) (-1279.760) (-1277.502) [-1276.483] * (-1283.587) (-1279.747) (-1278.100) [-1278.470] -- 0:01:18
49000 -- (-1278.040) (-1277.076) (-1280.408) [-1279.417] * (-1279.644) (-1281.945) [-1281.148] (-1281.003) -- 0:01:17
49500 -- (-1279.629) (-1278.357) (-1281.320) [-1288.766] * (-1280.076) (-1279.890) [-1283.757] (-1277.627) -- 0:01:16
50000 -- [-1279.367] (-1277.549) (-1278.370) (-1280.398) * (-1282.428) [-1279.206] (-1286.447) (-1281.799) -- 0:01:16
Average standard deviation of split frequencies: 0.049843
50500 -- (-1279.050) (-1283.609) [-1279.694] (-1283.004) * [-1278.764] (-1281.222) (-1277.668) (-1278.990) -- 0:01:15
51000 -- (-1277.652) [-1278.084] (-1280.122) (-1278.065) * (-1277.979) (-1278.188) (-1280.178) [-1279.229] -- 0:01:14
51500 -- (-1277.737) (-1276.391) [-1279.375] (-1279.325) * (-1278.443) (-1280.497) [-1277.114] (-1278.682) -- 0:01:13
52000 -- (-1279.028) [-1278.885] (-1278.127) (-1283.015) * (-1278.784) [-1277.831] (-1277.313) (-1279.577) -- 0:01:12
52500 -- [-1281.205] (-1282.863) (-1278.589) (-1277.982) * (-1278.126) [-1278.845] (-1280.047) (-1283.054) -- 0:01:12
53000 -- (-1279.637) [-1280.691] (-1277.736) (-1280.727) * [-1277.658] (-1278.890) (-1278.204) (-1278.989) -- 0:01:11
53500 -- [-1280.277] (-1276.462) (-1278.563) (-1278.796) * [-1277.824] (-1278.321) (-1276.229) (-1280.529) -- 0:01:10
54000 -- [-1278.327] (-1278.328) (-1280.782) (-1277.985) * (-1277.200) [-1278.109] (-1280.065) (-1279.777) -- 0:01:10
54500 -- [-1277.410] (-1279.365) (-1278.026) (-1277.882) * [-1277.693] (-1277.758) (-1280.945) (-1279.475) -- 0:01:09
55000 -- (-1277.149) [-1278.232] (-1277.775) (-1277.835) * (-1278.554) (-1280.864) [-1281.868] (-1279.922) -- 0:01:08
Average standard deviation of split frequencies: 0.042691
55500 -- (-1280.119) [-1278.005] (-1279.663) (-1278.058) * (-1280.978) (-1279.752) [-1278.319] (-1278.438) -- 0:01:08
56000 -- [-1281.113] (-1276.958) (-1278.927) (-1278.624) * (-1278.816) (-1278.361) (-1278.291) [-1278.050] -- 0:01:07
56500 -- [-1280.945] (-1277.707) (-1279.951) (-1278.109) * (-1281.525) [-1277.571] (-1279.817) (-1278.718) -- 0:01:06
57000 -- (-1279.051) (-1278.281) [-1278.833] (-1279.493) * (-1278.561) [-1278.002] (-1278.620) (-1280.039) -- 0:01:06
57500 -- (-1279.413) [-1277.540] (-1279.949) (-1279.294) * (-1279.984) [-1278.778] (-1276.921) (-1277.852) -- 0:01:05
58000 -- (-1279.101) (-1276.329) [-1281.581] (-1278.892) * [-1279.382] (-1278.567) (-1276.550) (-1280.227) -- 0:01:04
58500 -- (-1279.199) (-1278.465) [-1280.983] (-1277.621) * (-1279.045) (-1278.755) [-1276.846] (-1279.198) -- 0:01:04
59000 -- (-1279.076) [-1279.161] (-1277.886) (-1280.255) * [-1280.836] (-1279.758) (-1279.937) (-1279.797) -- 0:01:03
59500 -- (-1278.170) (-1277.854) (-1279.289) [-1278.935] * [-1280.358] (-1281.261) (-1281.197) (-1279.428) -- 0:01:03
60000 -- (-1276.070) [-1277.307] (-1277.976) (-1281.104) * (-1278.331) (-1276.897) [-1280.672] (-1282.310) -- 0:01:02
Average standard deviation of split frequencies: 0.041627
60500 -- (-1279.360) [-1279.654] (-1281.743) (-1279.497) * [-1278.905] (-1281.568) (-1278.676) (-1281.164) -- 0:01:02
61000 -- (-1280.137) (-1278.515) [-1279.947] (-1277.353) * (-1279.678) [-1279.195] (-1279.348) (-1282.182) -- 0:01:01
61500 -- [-1279.473] (-1284.963) (-1279.152) (-1277.372) * (-1280.221) (-1280.553) [-1279.052] (-1279.171) -- 0:01:16
62000 -- (-1278.803) (-1285.127) (-1277.159) [-1278.479] * (-1281.077) [-1280.785] (-1278.725) (-1280.357) -- 0:01:15
62500 -- (-1278.008) (-1278.215) (-1278.196) [-1277.192] * [-1280.547] (-1279.807) (-1279.189) (-1278.578) -- 0:01:15
63000 -- (-1278.597) (-1279.511) (-1278.864) [-1278.773] * (-1281.818) (-1278.572) [-1279.766] (-1278.900) -- 0:01:14
63500 -- (-1278.168) (-1282.263) (-1279.735) [-1279.511] * (-1278.438) [-1279.133] (-1277.844) (-1279.976) -- 0:01:13
64000 -- [-1279.406] (-1280.811) (-1280.673) (-1279.928) * (-1280.666) (-1280.502) [-1278.034] (-1281.612) -- 0:01:13
64500 -- [-1279.753] (-1280.360) (-1279.065) (-1277.777) * (-1279.170) (-1280.891) [-1278.849] (-1277.871) -- 0:01:12
65000 -- (-1279.119) (-1277.147) (-1278.785) [-1278.118] * (-1279.178) (-1281.763) [-1279.825] (-1279.197) -- 0:01:11
Average standard deviation of split frequencies: 0.035292
65500 -- (-1277.269) (-1277.013) (-1279.416) [-1277.805] * (-1280.047) (-1278.246) (-1280.064) [-1278.007] -- 0:01:11
66000 -- (-1277.705) [-1276.918] (-1278.407) (-1277.544) * (-1278.806) [-1279.965] (-1278.415) (-1278.570) -- 0:01:10
66500 -- (-1279.516) (-1280.618) [-1280.100] (-1277.392) * (-1278.307) (-1283.401) (-1276.568) [-1279.186] -- 0:01:10
67000 -- (-1277.251) (-1279.703) (-1280.718) [-1278.548] * (-1279.198) (-1278.103) [-1277.831] (-1277.586) -- 0:01:09
67500 -- [-1277.416] (-1277.606) (-1280.248) (-1278.023) * (-1282.921) [-1278.482] (-1279.601) (-1277.620) -- 0:01:09
68000 -- [-1277.920] (-1281.543) (-1279.423) (-1278.136) * [-1281.002] (-1278.501) (-1279.002) (-1278.816) -- 0:01:08
68500 -- (-1282.010) (-1278.411) (-1279.481) [-1277.160] * (-1278.324) [-1278.205] (-1277.127) (-1283.932) -- 0:01:07
69000 -- (-1285.586) [-1278.788] (-1278.018) (-1279.531) * (-1278.579) (-1278.053) [-1277.180] (-1278.227) -- 0:01:07
69500 -- (-1284.663) (-1276.574) [-1277.780] (-1280.799) * (-1278.597) (-1278.087) [-1276.446] (-1280.762) -- 0:01:06
70000 -- (-1281.264) (-1279.133) [-1279.228] (-1281.249) * (-1277.953) (-1279.024) [-1277.622] (-1281.243) -- 0:01:06
Average standard deviation of split frequencies: 0.034466
70500 -- [-1277.883] (-1279.532) (-1278.926) (-1278.736) * [-1285.862] (-1283.708) (-1277.494) (-1279.316) -- 0:01:05
71000 -- [-1278.098] (-1280.989) (-1286.156) (-1282.153) * (-1285.937) (-1279.943) (-1277.835) [-1281.005] -- 0:01:05
71500 -- (-1279.793) [-1278.680] (-1281.894) (-1281.399) * (-1278.722) (-1279.273) [-1278.435] (-1278.781) -- 0:01:04
72000 -- [-1280.607] (-1277.909) (-1281.857) (-1281.184) * (-1280.841) [-1278.149] (-1277.704) (-1278.575) -- 0:01:04
72500 -- (-1278.252) [-1278.668] (-1283.076) (-1280.585) * [-1277.906] (-1281.256) (-1278.463) (-1282.199) -- 0:01:03
73000 -- (-1279.645) (-1277.697) (-1281.287) [-1280.719] * (-1277.796) [-1280.756] (-1281.756) (-1277.213) -- 0:01:03
73500 -- (-1281.961) [-1277.942] (-1283.443) (-1280.266) * (-1279.795) [-1280.028] (-1282.571) (-1280.572) -- 0:01:03
74000 -- (-1277.509) [-1280.189] (-1278.408) (-1279.009) * [-1280.463] (-1280.719) (-1280.097) (-1282.814) -- 0:01:02
74500 -- [-1278.059] (-1279.389) (-1282.313) (-1280.371) * (-1278.672) (-1277.855) (-1279.741) [-1282.159] -- 0:01:02
75000 -- [-1278.268] (-1281.637) (-1280.575) (-1275.908) * (-1281.817) (-1282.415) [-1278.931] (-1280.933) -- 0:01:01
Average standard deviation of split frequencies: 0.036872
75500 -- (-1281.965) (-1280.749) [-1278.798] (-1278.358) * (-1277.914) (-1283.710) [-1277.449] (-1282.224) -- 0:01:13
76000 -- (-1278.604) (-1280.951) [-1279.491] (-1277.422) * [-1278.162] (-1280.865) (-1279.371) (-1280.896) -- 0:01:12
76500 -- (-1278.815) (-1276.529) [-1279.502] (-1277.478) * (-1286.771) [-1280.899] (-1278.071) (-1278.528) -- 0:01:12
77000 -- (-1278.835) (-1280.609) [-1279.221] (-1276.818) * (-1280.489) [-1277.864] (-1283.924) (-1278.482) -- 0:01:11
77500 -- (-1278.198) [-1278.295] (-1280.092) (-1276.061) * (-1282.722) (-1279.079) [-1278.171] (-1282.417) -- 0:01:11
78000 -- (-1279.698) (-1277.115) (-1283.370) [-1278.795] * (-1279.261) (-1278.738) [-1281.076] (-1279.399) -- 0:01:10
78500 -- (-1285.136) [-1277.667] (-1283.744) (-1281.380) * (-1277.755) (-1277.659) (-1277.128) [-1283.744] -- 0:01:10
79000 -- (-1281.827) (-1277.971) (-1279.244) [-1280.185] * (-1278.509) [-1278.655] (-1277.826) (-1279.492) -- 0:01:09
79500 -- (-1280.453) [-1276.312] (-1279.780) (-1281.970) * (-1278.480) (-1282.010) [-1275.843] (-1280.909) -- 0:01:09
80000 -- [-1280.379] (-1277.260) (-1283.513) (-1283.283) * (-1277.715) (-1280.441) (-1278.959) [-1281.790] -- 0:01:09
Average standard deviation of split frequencies: 0.036037
80500 -- (-1280.233) (-1278.613) [-1281.411] (-1280.879) * (-1278.393) (-1278.535) [-1278.428] (-1283.096) -- 0:01:08
81000 -- (-1279.735) [-1277.668] (-1279.026) (-1278.225) * (-1278.927) (-1285.212) [-1278.524] (-1281.378) -- 0:01:08
81500 -- (-1280.164) (-1282.004) [-1278.235] (-1277.966) * (-1278.616) (-1280.437) (-1281.039) [-1278.620] -- 0:01:07
82000 -- (-1278.664) [-1278.409] (-1278.427) (-1277.981) * (-1277.604) (-1281.957) (-1286.304) [-1278.120] -- 0:01:07
82500 -- (-1278.208) [-1278.885] (-1279.649) (-1278.495) * (-1280.751) (-1278.789) (-1281.128) [-1279.418] -- 0:01:06
83000 -- [-1278.822] (-1278.654) (-1277.858) (-1279.188) * [-1282.511] (-1276.299) (-1277.357) (-1279.080) -- 0:01:06
83500 -- (-1279.063) [-1280.099] (-1278.555) (-1278.050) * [-1280.363] (-1278.171) (-1279.412) (-1278.453) -- 0:01:05
84000 -- (-1277.839) [-1277.818] (-1279.713) (-1278.769) * (-1280.508) (-1280.569) [-1279.581] (-1278.744) -- 0:01:05
84500 -- (-1276.832) (-1278.187) (-1278.474) [-1278.986] * (-1280.621) (-1280.309) (-1282.277) [-1277.501] -- 0:01:05
85000 -- [-1278.864] (-1279.154) (-1280.761) (-1279.809) * (-1278.332) (-1282.404) (-1280.764) [-1277.212] -- 0:01:04
Average standard deviation of split frequencies: 0.035629
85500 -- (-1280.096) [-1278.774] (-1278.787) (-1279.231) * (-1278.270) (-1278.518) (-1281.334) [-1281.258] -- 0:01:04
86000 -- (-1279.249) (-1280.168) (-1279.225) [-1282.261] * (-1280.249) [-1278.496] (-1276.926) (-1278.487) -- 0:01:03
86500 -- [-1279.246] (-1279.232) (-1279.330) (-1281.986) * (-1279.290) (-1282.958) (-1277.692) [-1281.231] -- 0:01:03
87000 -- (-1279.248) [-1277.729] (-1277.299) (-1280.359) * (-1280.196) [-1278.440] (-1278.139) (-1280.214) -- 0:01:02
87500 -- (-1279.168) (-1280.097) (-1279.424) [-1280.173] * [-1277.885] (-1278.796) (-1279.230) (-1278.657) -- 0:01:02
88000 -- [-1279.002] (-1279.062) (-1278.322) (-1281.467) * (-1282.155) [-1278.524] (-1280.056) (-1278.000) -- 0:01:02
88500 -- (-1278.825) (-1277.861) [-1276.296] (-1281.397) * [-1279.038] (-1278.310) (-1279.600) (-1279.732) -- 0:01:01
89000 -- (-1279.875) (-1277.837) [-1277.063] (-1281.169) * (-1281.135) (-1281.646) [-1277.361] (-1278.691) -- 0:01:01
89500 -- [-1277.515] (-1279.279) (-1281.750) (-1280.399) * (-1281.970) (-1277.773) [-1277.970] (-1278.526) -- 0:01:11
90000 -- (-1282.029) [-1277.219] (-1287.682) (-1280.483) * [-1278.920] (-1277.383) (-1278.576) (-1278.301) -- 0:01:10
Average standard deviation of split frequencies: 0.037839
90500 -- (-1281.417) (-1279.252) (-1285.462) [-1278.981] * (-1278.943) [-1277.564] (-1279.906) (-1277.574) -- 0:01:10
91000 -- [-1281.824] (-1277.956) (-1280.785) (-1279.292) * (-1278.739) (-1277.652) [-1276.575] (-1277.621) -- 0:01:09
91500 -- (-1281.003) (-1280.804) [-1280.837] (-1279.301) * (-1279.125) [-1279.732] (-1277.499) (-1280.336) -- 0:01:09
92000 -- [-1277.867] (-1277.224) (-1283.526) (-1280.511) * [-1280.058] (-1278.829) (-1278.290) (-1281.669) -- 0:01:09
92500 -- (-1277.833) [-1280.000] (-1281.073) (-1284.418) * (-1278.606) [-1279.031] (-1279.244) (-1280.616) -- 0:01:08
93000 -- (-1278.361) (-1277.815) [-1282.927] (-1278.898) * [-1278.330] (-1278.125) (-1278.856) (-1275.843) -- 0:01:08
93500 -- (-1280.817) [-1279.734] (-1286.340) (-1278.299) * [-1277.925] (-1278.360) (-1278.974) (-1279.159) -- 0:01:07
94000 -- (-1281.428) [-1277.388] (-1287.612) (-1280.786) * (-1278.501) [-1277.560] (-1277.898) (-1278.647) -- 0:01:07
94500 -- (-1281.316) (-1277.830) (-1280.372) [-1278.189] * (-1278.954) (-1280.862) [-1277.328] (-1279.314) -- 0:01:07
95000 -- (-1281.356) (-1280.849) (-1279.668) [-1283.478] * (-1281.470) [-1279.115] (-1276.133) (-1278.249) -- 0:01:06
Average standard deviation of split frequencies: 0.035464
95500 -- (-1278.590) [-1277.974] (-1277.740) (-1283.433) * (-1279.519) (-1281.846) [-1276.337] (-1277.166) -- 0:01:06
96000 -- (-1280.588) (-1280.579) (-1278.128) [-1280.476] * [-1277.700] (-1275.350) (-1281.626) (-1277.530) -- 0:01:05
96500 -- (-1280.212) (-1279.943) [-1279.150] (-1280.918) * (-1278.532) (-1277.888) [-1275.384] (-1281.039) -- 0:01:05
97000 -- (-1278.946) (-1278.894) [-1279.626] (-1278.758) * (-1281.906) (-1280.241) (-1279.884) [-1277.015] -- 0:01:05
97500 -- (-1277.592) [-1279.475] (-1278.973) (-1281.632) * (-1278.357) (-1287.314) (-1280.209) [-1277.303] -- 0:01:04
98000 -- (-1278.122) (-1278.008) [-1279.922] (-1279.478) * (-1279.465) (-1278.123) (-1277.993) [-1278.324] -- 0:01:04
98500 -- (-1278.148) [-1278.168] (-1279.848) (-1277.850) * (-1280.062) [-1280.773] (-1277.911) (-1278.415) -- 0:01:04
99000 -- (-1280.575) (-1279.782) [-1277.444] (-1280.203) * (-1279.146) (-1281.407) [-1280.219] (-1277.765) -- 0:01:03
99500 -- [-1279.208] (-1282.223) (-1280.686) (-1285.765) * [-1277.418] (-1277.239) (-1278.499) (-1279.101) -- 0:01:03
100000 -- (-1280.867) [-1279.195] (-1279.184) (-1281.068) * (-1278.311) (-1281.278) (-1281.528) [-1278.656] -- 0:01:02
Average standard deviation of split frequencies: 0.033820
100500 -- (-1280.142) [-1279.785] (-1277.238) (-1282.148) * (-1278.342) (-1278.015) [-1275.956] (-1277.959) -- 0:01:02
101000 -- [-1278.209] (-1278.682) (-1279.934) (-1281.981) * (-1278.309) (-1277.578) (-1278.468) [-1277.460] -- 0:01:02
101500 -- (-1278.214) [-1279.582] (-1282.728) (-1279.554) * (-1286.171) [-1277.765] (-1278.140) (-1278.912) -- 0:01:01
102000 -- (-1276.132) (-1279.344) [-1279.169] (-1278.185) * (-1280.444) (-1277.763) [-1280.829] (-1277.357) -- 0:01:01
102500 -- (-1281.981) (-1277.374) (-1279.587) [-1278.810] * (-1284.321) (-1278.516) (-1279.674) [-1279.993] -- 0:01:01
103000 -- [-1279.209] (-1279.747) (-1279.602) (-1278.084) * [-1278.798] (-1278.375) (-1279.928) (-1278.433) -- 0:01:00
103500 -- (-1276.353) (-1278.088) [-1279.352] (-1278.084) * [-1276.527] (-1279.509) (-1278.720) (-1278.966) -- 0:01:09
104000 -- (-1277.688) [-1279.102] (-1278.331) (-1280.387) * (-1280.650) [-1276.466] (-1279.171) (-1279.309) -- 0:01:08
104500 -- [-1279.066] (-1280.411) (-1279.358) (-1281.386) * (-1277.905) (-1280.946) (-1279.935) [-1277.429] -- 0:01:08
105000 -- (-1279.547) (-1278.579) [-1280.560] (-1277.668) * [-1278.383] (-1278.786) (-1279.746) (-1276.650) -- 0:01:08
Average standard deviation of split frequencies: 0.029154
105500 -- (-1278.916) (-1277.638) (-1278.194) [-1277.772] * (-1282.504) [-1280.886] (-1278.001) (-1279.596) -- 0:01:07
106000 -- (-1278.751) [-1277.731] (-1278.340) (-1277.113) * (-1280.414) (-1282.541) [-1278.821] (-1278.479) -- 0:01:07
106500 -- [-1280.815] (-1279.103) (-1281.770) (-1278.272) * (-1277.112) [-1281.241] (-1279.991) (-1278.804) -- 0:01:07
107000 -- (-1280.941) (-1282.945) (-1281.148) [-1279.338] * (-1280.801) (-1281.650) (-1279.615) [-1277.355] -- 0:01:06
107500 -- (-1278.317) (-1280.286) [-1279.886] (-1283.799) * (-1280.065) (-1279.837) (-1279.128) [-1277.389] -- 0:01:06
108000 -- (-1278.670) (-1281.766) (-1282.607) [-1280.566] * [-1284.026] (-1278.666) (-1281.897) (-1277.429) -- 0:01:06
108500 -- (-1277.501) [-1281.129] (-1278.998) (-1278.442) * (-1277.911) (-1277.494) (-1282.816) [-1277.149] -- 0:01:05
109000 -- (-1279.358) (-1280.194) (-1278.658) [-1278.003] * (-1280.173) (-1277.213) [-1280.325] (-1279.175) -- 0:01:05
109500 -- (-1278.657) (-1278.449) [-1278.669] (-1278.082) * (-1278.130) (-1278.038) [-1279.246] (-1278.758) -- 0:01:05
110000 -- (-1277.202) (-1280.450) [-1279.331] (-1279.110) * (-1278.398) (-1281.272) (-1280.818) [-1279.656] -- 0:01:04
Average standard deviation of split frequencies: 0.028635
110500 -- (-1280.019) [-1278.754] (-1278.756) (-1281.192) * [-1278.563] (-1278.031) (-1282.156) (-1279.517) -- 0:01:04
111000 -- (-1281.842) [-1279.261] (-1279.723) (-1278.804) * (-1278.489) (-1279.763) (-1279.112) [-1277.684] -- 0:01:04
111500 -- (-1279.048) (-1278.677) (-1277.699) [-1279.820] * (-1280.515) (-1278.437) [-1279.622] (-1282.540) -- 0:01:03
112000 -- [-1280.707] (-1278.911) (-1279.462) (-1287.520) * (-1279.865) [-1279.310] (-1278.432) (-1279.242) -- 0:01:03
112500 -- (-1278.780) (-1278.360) (-1277.996) [-1277.897] * (-1280.224) (-1279.577) (-1277.422) [-1277.499] -- 0:01:03
113000 -- (-1284.891) (-1280.339) (-1277.988) [-1279.049] * (-1278.313) [-1278.075] (-1278.676) (-1278.555) -- 0:01:02
113500 -- (-1284.397) (-1279.449) (-1278.255) [-1278.337] * (-1280.883) (-1276.276) (-1277.961) [-1278.984] -- 0:01:02
114000 -- (-1279.254) (-1279.905) (-1280.642) [-1280.307] * (-1281.382) (-1276.390) [-1278.941] (-1279.443) -- 0:01:02
114500 -- (-1278.270) [-1278.999] (-1278.546) (-1280.893) * [-1278.504] (-1277.132) (-1279.161) (-1278.902) -- 0:01:01
115000 -- (-1279.831) [-1278.347] (-1278.106) (-1278.107) * (-1278.866) (-1280.139) (-1277.975) [-1277.410] -- 0:01:01
Average standard deviation of split frequencies: 0.029576
115500 -- [-1276.870] (-1280.220) (-1279.683) (-1279.890) * (-1278.289) [-1278.204] (-1277.483) (-1277.333) -- 0:01:01
116000 -- (-1279.183) (-1278.421) (-1279.596) [-1280.100] * (-1277.882) [-1280.015] (-1279.912) (-1281.162) -- 0:01:00
116500 -- [-1279.718] (-1277.792) (-1278.058) (-1281.429) * (-1283.793) [-1279.358] (-1279.506) (-1277.814) -- 0:01:00
117000 -- (-1277.899) [-1278.432] (-1280.558) (-1277.847) * (-1278.099) (-1277.000) [-1278.861] (-1278.117) -- 0:01:00
117500 -- [-1280.689] (-1278.703) (-1278.559) (-1284.492) * (-1279.494) (-1279.223) (-1279.000) [-1277.916] -- 0:01:07
118000 -- (-1278.553) [-1278.270] (-1277.378) (-1277.257) * (-1280.468) [-1278.358] (-1278.805) (-1277.923) -- 0:01:07
118500 -- (-1279.649) (-1281.653) [-1278.998] (-1280.259) * [-1279.424] (-1279.763) (-1278.351) (-1279.487) -- 0:01:06
119000 -- [-1278.733] (-1281.531) (-1276.455) (-1277.946) * [-1278.759] (-1281.059) (-1284.042) (-1276.126) -- 0:01:06
119500 -- (-1279.019) (-1281.539) [-1281.637] (-1279.789) * [-1280.473] (-1281.098) (-1279.747) (-1278.833) -- 0:01:06
120000 -- (-1277.539) (-1281.851) (-1282.209) [-1277.726] * [-1283.407] (-1279.532) (-1278.330) (-1277.775) -- 0:01:06
Average standard deviation of split frequencies: 0.030334
120500 -- (-1278.060) (-1278.394) [-1279.604] (-1275.423) * (-1281.701) (-1279.983) (-1279.011) [-1280.900] -- 0:01:05
121000 -- (-1277.519) (-1278.808) [-1277.866] (-1283.006) * (-1278.469) (-1277.787) (-1280.726) [-1278.177] -- 0:01:05
121500 -- (-1279.029) (-1280.746) [-1278.089] (-1278.410) * (-1280.346) [-1278.513] (-1278.716) (-1277.177) -- 0:01:05
122000 -- (-1281.644) (-1278.136) (-1278.891) [-1277.413] * [-1277.492] (-1278.494) (-1277.904) (-1278.089) -- 0:01:04
122500 -- (-1281.488) (-1283.043) (-1278.407) [-1276.785] * (-1278.472) [-1278.677] (-1281.363) (-1277.464) -- 0:01:04
123000 -- (-1279.186) (-1286.433) [-1279.500] (-1278.314) * [-1277.017] (-1276.432) (-1278.890) (-1277.572) -- 0:01:04
123500 -- [-1278.385] (-1281.519) (-1280.781) (-1278.213) * (-1277.256) (-1280.147) (-1278.043) [-1279.272] -- 0:01:03
124000 -- [-1281.420] (-1281.650) (-1278.801) (-1279.693) * (-1278.824) [-1277.786] (-1278.900) (-1279.270) -- 0:01:03
124500 -- (-1280.490) [-1278.330] (-1283.429) (-1278.784) * (-1286.239) (-1278.841) [-1280.179] (-1278.818) -- 0:01:03
125000 -- (-1279.633) [-1277.088] (-1281.046) (-1278.719) * [-1281.320] (-1276.776) (-1279.194) (-1279.527) -- 0:01:03
Average standard deviation of split frequencies: 0.028268
125500 -- (-1280.597) (-1280.037) [-1279.425] (-1279.126) * (-1280.894) [-1278.854] (-1279.766) (-1278.443) -- 0:01:02
126000 -- (-1280.527) (-1279.043) (-1284.390) [-1279.722] * (-1279.074) (-1281.080) [-1278.514] (-1279.216) -- 0:01:02
126500 -- (-1282.556) (-1278.209) (-1279.623) [-1278.841] * (-1280.368) (-1278.461) [-1280.341] (-1279.693) -- 0:01:02
127000 -- (-1279.838) (-1283.000) (-1278.633) [-1277.640] * (-1279.351) (-1279.138) (-1280.628) [-1285.561] -- 0:01:01
127500 -- (-1280.339) (-1281.014) [-1280.228] (-1277.976) * (-1278.004) [-1279.911] (-1279.445) (-1281.340) -- 0:01:01
128000 -- (-1277.715) [-1277.851] (-1281.132) (-1285.287) * (-1277.386) (-1277.122) [-1277.912] (-1282.509) -- 0:01:01
128500 -- [-1277.550] (-1280.960) (-1281.418) (-1277.150) * (-1277.709) (-1279.473) [-1278.898] (-1282.911) -- 0:01:01
129000 -- (-1278.054) (-1281.701) (-1280.938) [-1278.150] * (-1280.019) (-1281.454) (-1280.474) [-1278.554] -- 0:01:00
129500 -- (-1279.270) (-1281.435) [-1281.686] (-1277.938) * (-1279.706) (-1278.164) (-1279.468) [-1281.991] -- 0:01:00
130000 -- (-1279.434) (-1281.178) (-1283.393) [-1277.675] * (-1278.473) (-1280.757) (-1280.531) [-1279.222] -- 0:01:00
Average standard deviation of split frequencies: 0.024452
130500 -- (-1279.895) (-1278.787) [-1282.454] (-1278.040) * (-1279.811) (-1277.638) (-1277.764) [-1278.899] -- 0:00:59
131000 -- [-1278.273] (-1277.618) (-1281.672) (-1277.980) * [-1278.550] (-1278.304) (-1277.990) (-1279.357) -- 0:00:59
131500 -- [-1277.627] (-1277.833) (-1280.375) (-1281.761) * [-1276.628] (-1277.233) (-1278.799) (-1278.419) -- 0:00:59
132000 -- [-1277.942] (-1278.447) (-1279.632) (-1280.564) * [-1278.147] (-1282.183) (-1278.597) (-1281.228) -- 0:01:05
132500 -- [-1279.827] (-1278.370) (-1279.377) (-1280.780) * [-1276.251] (-1277.606) (-1280.980) (-1282.435) -- 0:01:05
133000 -- (-1277.575) (-1277.679) [-1277.630] (-1282.889) * (-1279.586) (-1279.140) (-1280.299) [-1282.698] -- 0:01:05
133500 -- (-1279.023) (-1281.175) (-1278.231) [-1278.557] * (-1276.494) (-1280.547) (-1279.134) [-1280.847] -- 0:01:04
134000 -- [-1280.961] (-1277.660) (-1278.173) (-1280.517) * (-1279.167) (-1278.261) [-1279.313] (-1278.104) -- 0:01:04
134500 -- [-1280.037] (-1278.342) (-1281.322) (-1284.840) * [-1278.991] (-1279.376) (-1278.480) (-1277.670) -- 0:01:04
135000 -- (-1278.591) (-1279.109) [-1282.380] (-1278.958) * (-1279.565) [-1278.686] (-1277.322) (-1280.151) -- 0:01:04
Average standard deviation of split frequencies: 0.024456
135500 -- (-1279.778) [-1279.175] (-1283.406) (-1277.162) * (-1278.039) (-1277.739) [-1279.615] (-1280.693) -- 0:01:03
136000 -- (-1277.037) [-1279.618] (-1279.439) (-1276.492) * (-1277.907) (-1284.154) [-1279.058] (-1278.212) -- 0:01:03
136500 -- [-1279.259] (-1278.423) (-1279.507) (-1278.022) * (-1278.904) (-1280.588) [-1277.745] (-1278.355) -- 0:01:03
137000 -- (-1280.806) (-1279.759) (-1279.329) [-1280.739] * [-1278.540] (-1278.380) (-1276.532) (-1278.265) -- 0:01:02
137500 -- (-1277.062) (-1280.960) [-1278.622] (-1278.684) * (-1290.042) (-1277.121) [-1277.656] (-1278.322) -- 0:01:02
138000 -- (-1278.001) (-1279.276) (-1279.469) [-1283.549] * (-1286.966) [-1280.464] (-1278.721) (-1277.889) -- 0:01:02
138500 -- (-1275.695) (-1279.765) (-1277.326) [-1277.446] * (-1281.371) [-1276.954] (-1277.371) (-1280.287) -- 0:01:02
139000 -- (-1282.449) (-1278.602) [-1278.694] (-1276.662) * (-1279.098) (-1278.528) (-1277.868) [-1279.031] -- 0:01:01
139500 -- (-1278.168) (-1279.108) (-1279.619) [-1278.546] * [-1281.349] (-1277.508) (-1278.320) (-1280.003) -- 0:01:01
140000 -- [-1278.350] (-1279.468) (-1277.768) (-1278.127) * (-1280.179) (-1280.007) [-1280.620] (-1280.054) -- 0:01:01
Average standard deviation of split frequencies: 0.022341
140500 -- [-1279.656] (-1283.359) (-1282.178) (-1279.283) * (-1277.724) (-1278.795) (-1283.409) [-1281.774] -- 0:01:01
141000 -- [-1280.096] (-1280.570) (-1281.873) (-1278.396) * (-1278.917) [-1279.928] (-1277.992) (-1278.352) -- 0:01:00
141500 -- (-1277.611) (-1277.449) [-1280.823] (-1278.103) * (-1277.510) (-1282.286) [-1277.729] (-1279.620) -- 0:01:00
142000 -- [-1281.102] (-1277.315) (-1280.970) (-1278.257) * (-1278.574) (-1278.060) [-1277.465] (-1278.088) -- 0:01:00
142500 -- (-1278.936) [-1277.511] (-1277.946) (-1279.518) * (-1279.055) (-1277.895) (-1277.997) [-1276.884] -- 0:01:00
143000 -- (-1278.604) (-1276.254) [-1279.280] (-1279.551) * (-1278.271) (-1278.906) [-1275.625] (-1281.604) -- 0:00:59
143500 -- (-1277.411) (-1277.516) [-1281.100] (-1279.656) * (-1277.250) (-1280.275) [-1277.877] (-1279.180) -- 0:00:59
144000 -- [-1281.297] (-1277.331) (-1283.260) (-1277.202) * [-1278.601] (-1278.830) (-1278.514) (-1279.906) -- 0:00:59
144500 -- [-1279.914] (-1277.566) (-1279.578) (-1276.529) * (-1279.104) (-1283.664) [-1276.425] (-1276.098) -- 0:00:59
145000 -- [-1283.745] (-1278.195) (-1278.806) (-1281.361) * (-1277.314) (-1278.100) (-1275.134) [-1277.271] -- 0:00:58
Average standard deviation of split frequencies: 0.021072
145500 -- (-1276.143) (-1278.416) (-1280.354) [-1278.659] * (-1277.962) (-1279.528) (-1276.850) [-1276.902] -- 0:00:58
146000 -- (-1277.115) (-1277.634) (-1279.641) [-1278.126] * [-1278.340] (-1280.239) (-1279.006) (-1279.096) -- 0:01:04
146500 -- (-1277.370) [-1279.574] (-1283.747) (-1281.533) * (-1278.091) [-1277.767] (-1278.652) (-1279.032) -- 0:01:04
147000 -- (-1279.342) (-1277.250) [-1278.078] (-1279.004) * [-1278.829] (-1278.946) (-1277.549) (-1281.328) -- 0:01:03
147500 -- [-1279.579] (-1279.244) (-1277.906) (-1278.429) * (-1277.741) (-1278.942) [-1280.243] (-1277.430) -- 0:01:03
148000 -- (-1277.854) [-1278.093] (-1277.423) (-1276.163) * (-1282.831) (-1279.550) [-1280.972] (-1277.468) -- 0:01:03
148500 -- (-1275.945) (-1280.740) (-1277.593) [-1276.927] * [-1278.689] (-1280.577) (-1281.034) (-1278.174) -- 0:01:03
149000 -- (-1275.072) [-1281.894] (-1278.699) (-1283.879) * [-1277.327] (-1280.535) (-1277.544) (-1277.400) -- 0:01:02
149500 -- (-1276.200) [-1277.676] (-1278.042) (-1280.476) * (-1277.232) (-1278.387) [-1278.194] (-1279.066) -- 0:01:02
150000 -- (-1277.837) (-1278.472) [-1278.273] (-1280.047) * [-1278.883] (-1280.332) (-1277.885) (-1277.808) -- 0:01:02
Average standard deviation of split frequencies: 0.019468
150500 -- [-1282.431] (-1278.353) (-1281.038) (-1282.883) * [-1281.113] (-1282.376) (-1280.110) (-1279.950) -- 0:01:02
151000 -- [-1281.411] (-1278.100) (-1279.023) (-1280.107) * (-1279.348) [-1281.380] (-1280.683) (-1281.092) -- 0:01:01
151500 -- (-1278.852) (-1288.718) [-1278.207] (-1280.607) * (-1279.344) [-1279.243] (-1278.243) (-1277.383) -- 0:01:01
152000 -- (-1283.127) (-1281.459) [-1282.815] (-1280.626) * (-1280.599) [-1281.444] (-1277.443) (-1279.526) -- 0:01:01
152500 -- (-1281.859) [-1281.060] (-1282.129) (-1277.776) * (-1280.744) (-1280.181) (-1277.301) [-1276.569] -- 0:01:01
153000 -- (-1277.707) (-1282.383) [-1278.208] (-1288.014) * (-1277.439) [-1282.288] (-1277.741) (-1277.346) -- 0:01:00
153500 -- [-1279.820] (-1279.346) (-1277.135) (-1280.589) * (-1278.854) [-1283.438] (-1277.544) (-1277.986) -- 0:01:00
154000 -- (-1278.526) (-1279.032) [-1280.759] (-1285.081) * (-1281.553) (-1281.845) [-1277.784] (-1279.107) -- 0:01:00
154500 -- (-1277.300) [-1278.499] (-1286.059) (-1278.004) * (-1281.602) [-1281.837] (-1277.324) (-1278.128) -- 0:01:00
155000 -- (-1277.967) (-1280.034) (-1280.259) [-1279.008] * (-1281.183) (-1279.510) [-1279.299] (-1278.341) -- 0:00:59
Average standard deviation of split frequencies: 0.018802
155500 -- [-1278.722] (-1282.645) (-1279.034) (-1283.171) * (-1280.496) [-1277.936] (-1278.205) (-1278.751) -- 0:00:59
156000 -- (-1277.990) (-1281.939) [-1281.009] (-1277.831) * (-1281.721) [-1279.703] (-1279.712) (-1281.011) -- 0:00:59
156500 -- [-1280.031] (-1281.170) (-1279.672) (-1277.779) * (-1282.655) (-1280.887) [-1278.162] (-1280.034) -- 0:00:59
157000 -- (-1279.766) (-1281.116) [-1279.847] (-1285.152) * (-1280.689) (-1283.160) [-1278.536] (-1279.787) -- 0:00:59
157500 -- (-1280.140) [-1276.931] (-1279.476) (-1279.396) * [-1278.715] (-1280.016) (-1277.197) (-1282.750) -- 0:00:58
158000 -- (-1278.145) (-1280.562) [-1279.793] (-1281.679) * (-1278.904) (-1278.963) (-1279.968) [-1282.018] -- 0:00:58
158500 -- (-1278.335) [-1282.736] (-1277.985) (-1283.112) * (-1279.885) [-1278.034] (-1280.750) (-1282.383) -- 0:00:58
159000 -- (-1279.795) (-1280.753) [-1278.369] (-1281.484) * (-1280.718) [-1278.833] (-1279.089) (-1284.378) -- 0:00:58
159500 -- (-1282.006) (-1279.128) (-1278.133) [-1278.804] * (-1281.885) (-1276.688) [-1279.123] (-1281.973) -- 0:00:57
160000 -- (-1276.956) (-1280.894) (-1277.987) [-1278.293] * (-1280.336) (-1278.445) (-1278.478) [-1279.714] -- 0:01:02
Average standard deviation of split frequencies: 0.018908
160500 -- (-1280.092) (-1278.431) [-1277.546] (-1279.966) * (-1280.447) (-1277.934) (-1278.538) [-1278.724] -- 0:01:02
161000 -- (-1281.968) (-1280.736) [-1279.343] (-1279.457) * (-1281.051) [-1278.035] (-1279.537) (-1277.896) -- 0:01:02
161500 -- (-1284.269) (-1279.568) (-1281.052) [-1279.601] * [-1279.176] (-1278.034) (-1278.732) (-1284.666) -- 0:01:02
162000 -- (-1286.112) [-1278.835] (-1278.165) (-1278.276) * (-1277.906) (-1279.535) (-1277.887) [-1278.659] -- 0:01:02
162500 -- (-1279.394) (-1279.118) [-1276.707] (-1280.198) * [-1280.798] (-1279.440) (-1277.718) (-1277.089) -- 0:01:01
163000 -- (-1275.714) (-1280.494) (-1278.152) [-1280.049] * (-1279.075) (-1278.937) [-1276.389] (-1277.108) -- 0:01:01
163500 -- [-1278.166] (-1281.499) (-1279.209) (-1280.855) * (-1278.553) (-1278.493) (-1277.725) [-1279.718] -- 0:01:01
164000 -- (-1278.739) [-1279.349] (-1278.552) (-1278.673) * (-1277.953) [-1278.706] (-1281.474) (-1281.761) -- 0:01:01
164500 -- (-1277.452) (-1280.934) [-1279.298] (-1281.188) * (-1278.382) (-1277.491) [-1277.693] (-1279.110) -- 0:01:00
165000 -- (-1279.779) [-1280.146] (-1279.644) (-1277.977) * (-1280.056) [-1278.559] (-1279.385) (-1277.133) -- 0:01:00
Average standard deviation of split frequencies: 0.016889
165500 -- (-1278.301) [-1277.809] (-1282.062) (-1278.085) * (-1277.832) (-1278.701) [-1278.372] (-1277.331) -- 0:01:00
166000 -- (-1279.226) (-1278.310) [-1279.836] (-1281.685) * (-1278.100) [-1277.975] (-1279.551) (-1280.079) -- 0:01:00
166500 -- (-1277.333) (-1278.931) [-1277.212] (-1278.525) * (-1277.187) (-1278.998) [-1279.852] (-1285.191) -- 0:01:00
167000 -- [-1278.116] (-1279.574) (-1277.006) (-1278.385) * (-1282.387) (-1277.809) [-1279.918] (-1280.993) -- 0:00:59
167500 -- [-1277.900] (-1278.108) (-1278.894) (-1278.948) * (-1278.371) (-1280.618) (-1279.865) [-1279.051] -- 0:00:59
168000 -- [-1277.167] (-1279.185) (-1278.061) (-1282.202) * [-1282.417] (-1278.947) (-1278.537) (-1278.484) -- 0:00:59
168500 -- [-1276.979] (-1279.446) (-1277.846) (-1278.277) * (-1279.090) (-1279.457) [-1278.016] (-1277.628) -- 0:00:59
169000 -- (-1278.177) (-1279.362) (-1278.509) [-1277.561] * (-1278.969) [-1277.583] (-1282.099) (-1278.767) -- 0:00:59
169500 -- (-1275.428) [-1277.760] (-1277.653) (-1278.695) * (-1279.368) [-1278.388] (-1277.761) (-1278.087) -- 0:00:58
170000 -- [-1279.131] (-1278.521) (-1277.989) (-1277.636) * (-1281.115) (-1278.246) (-1277.988) [-1278.714] -- 0:00:58
Average standard deviation of split frequencies: 0.015846
170500 -- [-1278.057] (-1282.273) (-1277.689) (-1281.950) * (-1280.374) [-1279.722] (-1280.757) (-1281.222) -- 0:00:58
171000 -- (-1277.118) [-1277.677] (-1278.625) (-1278.413) * (-1283.149) (-1279.536) (-1279.717) [-1278.299] -- 0:00:58
171500 -- (-1276.435) [-1279.123] (-1278.019) (-1281.363) * [-1281.265] (-1279.823) (-1281.515) (-1278.089) -- 0:00:57
172000 -- (-1278.161) [-1281.149] (-1278.151) (-1283.887) * (-1277.835) [-1279.770] (-1280.927) (-1278.670) -- 0:01:02
172500 -- (-1280.032) (-1281.935) (-1278.401) [-1277.787] * (-1278.009) (-1278.547) (-1282.320) [-1279.981] -- 0:01:02
173000 -- (-1279.275) (-1280.210) (-1282.426) [-1277.356] * (-1278.770) (-1280.653) [-1282.681] (-1280.700) -- 0:01:02
173500 -- (-1278.826) (-1279.039) [-1277.155] (-1277.810) * (-1280.043) (-1280.831) [-1282.753] (-1280.542) -- 0:01:01
174000 -- [-1277.319] (-1282.386) (-1282.619) (-1279.021) * (-1277.125) (-1281.987) (-1277.576) [-1279.214] -- 0:01:01
174500 -- (-1277.868) (-1279.799) [-1279.841] (-1283.943) * (-1277.295) [-1278.386] (-1276.655) (-1277.940) -- 0:01:01
175000 -- (-1279.641) (-1282.284) (-1280.062) [-1281.012] * (-1277.354) (-1279.223) (-1279.591) [-1277.888] -- 0:01:01
Average standard deviation of split frequencies: 0.018276
175500 -- (-1283.618) [-1278.652] (-1279.967) (-1279.245) * (-1277.950) [-1279.499] (-1277.556) (-1277.878) -- 0:01:01
176000 -- (-1284.231) [-1278.670] (-1279.931) (-1279.422) * (-1277.509) [-1279.604] (-1277.835) (-1280.902) -- 0:01:00
176500 -- (-1278.665) (-1279.872) [-1279.878] (-1278.236) * (-1278.240) (-1280.737) (-1277.459) [-1278.949] -- 0:01:00
177000 -- (-1285.126) [-1277.986] (-1280.809) (-1277.924) * (-1279.891) [-1278.466] (-1277.285) (-1280.015) -- 0:01:00
177500 -- [-1281.724] (-1280.075) (-1280.341) (-1281.043) * [-1279.087] (-1279.848) (-1278.357) (-1278.208) -- 0:01:00
178000 -- (-1282.360) (-1278.800) (-1279.060) [-1279.060] * (-1278.444) [-1282.024] (-1280.356) (-1280.567) -- 0:01:00
178500 -- (-1278.967) (-1278.376) (-1278.601) [-1279.034] * (-1278.313) (-1278.668) (-1279.818) [-1282.392] -- 0:00:59
179000 -- [-1277.183] (-1278.374) (-1276.883) (-1278.999) * (-1281.169) (-1278.144) (-1279.460) [-1282.624] -- 0:00:59
179500 -- [-1281.475] (-1284.700) (-1277.696) (-1278.091) * (-1280.078) (-1277.088) [-1278.782] (-1280.833) -- 0:00:59
180000 -- [-1280.934] (-1279.673) (-1278.156) (-1281.373) * (-1277.633) (-1276.413) [-1279.603] (-1281.332) -- 0:00:59
Average standard deviation of split frequencies: 0.018410
180500 -- (-1282.573) (-1281.031) (-1279.034) [-1280.024] * (-1278.114) (-1276.541) (-1278.013) [-1280.406] -- 0:00:59
181000 -- [-1281.109] (-1278.279) (-1279.639) (-1280.798) * (-1279.675) (-1283.610) (-1278.558) [-1281.992] -- 0:00:58
181500 -- (-1282.477) (-1280.624) [-1278.694] (-1278.172) * (-1277.783) (-1280.717) (-1279.146) [-1279.004] -- 0:00:58
182000 -- (-1282.012) (-1278.240) [-1278.658] (-1282.433) * (-1278.202) (-1280.392) (-1281.404) [-1279.612] -- 0:00:58
182500 -- (-1282.593) [-1278.183] (-1279.678) (-1282.050) * (-1277.623) (-1279.059) [-1278.047] (-1278.171) -- 0:00:58
183000 -- (-1284.805) (-1278.305) [-1279.278] (-1283.368) * (-1278.165) (-1281.652) (-1278.914) [-1278.163] -- 0:00:58
183500 -- (-1279.742) (-1280.370) (-1278.459) [-1282.394] * [-1276.379] (-1281.765) (-1279.888) (-1278.012) -- 0:00:57
184000 -- (-1281.371) (-1278.311) (-1282.100) [-1279.546] * [-1286.890] (-1278.217) (-1278.639) (-1277.759) -- 0:00:57
184500 -- (-1280.355) (-1278.373) [-1279.983] (-1279.726) * [-1281.915] (-1280.325) (-1281.085) (-1278.909) -- 0:00:57
185000 -- (-1278.130) (-1284.286) (-1281.574) [-1282.997] * (-1276.561) [-1280.286] (-1278.534) (-1279.879) -- 0:00:57
Average standard deviation of split frequencies: 0.018445
185500 -- [-1277.376] (-1281.289) (-1277.273) (-1283.951) * [-1275.609] (-1278.314) (-1281.059) (-1281.869) -- 0:01:01
186000 -- [-1277.649] (-1281.259) (-1277.309) (-1279.949) * [-1277.689] (-1277.365) (-1280.315) (-1277.568) -- 0:01:01
186500 -- (-1277.403) (-1278.756) [-1280.934] (-1278.473) * [-1281.721] (-1277.654) (-1280.012) (-1280.265) -- 0:01:01
187000 -- (-1277.516) [-1279.384] (-1281.521) (-1278.538) * [-1275.857] (-1277.952) (-1278.100) (-1283.769) -- 0:01:00
187500 -- (-1279.046) (-1281.338) (-1282.470) [-1276.607] * (-1276.313) [-1278.314] (-1278.456) (-1280.587) -- 0:01:00
188000 -- [-1277.696] (-1278.346) (-1277.988) (-1281.099) * (-1278.159) (-1279.181) [-1280.635] (-1280.321) -- 0:01:00
188500 -- (-1277.883) (-1278.117) [-1278.951] (-1277.665) * (-1278.008) (-1279.243) (-1280.612) [-1278.097] -- 0:01:00
189000 -- [-1277.977] (-1278.655) (-1280.112) (-1278.433) * [-1278.103] (-1278.577) (-1277.697) (-1277.701) -- 0:01:00
189500 -- [-1278.086] (-1279.698) (-1279.145) (-1278.128) * (-1280.773) [-1280.085] (-1279.136) (-1277.389) -- 0:00:59
190000 -- [-1278.192] (-1277.556) (-1277.070) (-1279.112) * (-1278.765) (-1279.700) (-1277.515) [-1280.512] -- 0:00:59
Average standard deviation of split frequencies: 0.018179
190500 -- [-1277.373] (-1282.491) (-1277.902) (-1283.086) * (-1282.736) (-1281.508) (-1276.640) [-1278.608] -- 0:00:59
191000 -- [-1277.202] (-1282.673) (-1277.390) (-1279.881) * [-1280.311] (-1281.256) (-1282.211) (-1278.651) -- 0:00:59
191500 -- (-1278.861) (-1284.441) (-1278.728) [-1281.752] * (-1280.161) (-1281.275) (-1279.546) [-1277.503] -- 0:00:59
192000 -- (-1279.305) (-1279.352) (-1277.918) [-1279.162] * [-1280.925] (-1278.323) (-1281.704) (-1278.738) -- 0:00:58
192500 -- (-1278.751) (-1278.428) (-1278.109) [-1276.788] * (-1278.162) (-1280.032) (-1279.495) [-1280.000] -- 0:00:58
193000 -- (-1281.421) (-1278.101) [-1275.873] (-1279.949) * (-1279.422) (-1278.569) [-1280.202] (-1279.713) -- 0:00:58
193500 -- (-1279.756) (-1280.194) [-1279.292] (-1278.924) * [-1282.913] (-1278.673) (-1277.038) (-1277.978) -- 0:00:58
194000 -- (-1281.480) (-1277.513) (-1276.880) [-1276.057] * (-1280.152) (-1284.759) (-1281.821) [-1278.190] -- 0:00:58
194500 -- (-1278.034) [-1278.244] (-1279.230) (-1278.863) * (-1279.484) (-1275.856) [-1279.764] (-1278.189) -- 0:00:57
195000 -- (-1279.590) (-1279.132) [-1279.060] (-1279.482) * (-1279.115) [-1278.474] (-1280.947) (-1278.199) -- 0:00:57
Average standard deviation of split frequencies: 0.018817
195500 -- (-1277.504) (-1283.681) (-1278.641) [-1277.025] * [-1280.425] (-1278.733) (-1278.671) (-1278.359) -- 0:00:57
196000 -- (-1278.217) (-1279.530) (-1281.931) [-1277.989] * (-1280.347) (-1279.711) [-1278.344] (-1280.281) -- 0:00:57
196500 -- (-1281.370) (-1279.567) (-1279.413) [-1277.455] * (-1278.506) (-1283.646) [-1276.748] (-1281.370) -- 0:00:57
197000 -- (-1277.806) [-1279.763] (-1280.202) (-1277.620) * [-1278.923] (-1283.208) (-1279.776) (-1282.990) -- 0:00:57
197500 -- [-1277.504] (-1283.722) (-1280.223) (-1277.865) * (-1279.363) [-1278.006] (-1284.562) (-1278.630) -- 0:00:56
198000 -- [-1277.858] (-1279.006) (-1280.530) (-1278.361) * (-1280.449) (-1280.174) (-1277.916) [-1277.614] -- 0:00:56
198500 -- (-1277.453) (-1282.298) (-1277.249) [-1279.988] * (-1279.603) [-1278.375] (-1276.933) (-1277.677) -- 0:00:56
199000 -- (-1278.064) (-1281.746) (-1280.861) [-1278.155] * (-1279.231) (-1277.589) [-1278.345] (-1279.824) -- 0:01:00
199500 -- (-1278.153) (-1282.082) (-1278.815) [-1277.502] * (-1278.028) (-1278.842) (-1281.747) [-1278.385] -- 0:01:00
200000 -- (-1284.758) (-1278.800) [-1279.030] (-1281.873) * (-1277.169) (-1279.764) [-1279.199] (-1277.748) -- 0:00:59
Average standard deviation of split frequencies: 0.016168
200500 -- (-1277.645) [-1278.707] (-1278.807) (-1278.138) * (-1278.508) (-1279.866) [-1278.831] (-1278.244) -- 0:00:59
201000 -- (-1278.220) (-1280.440) [-1278.399] (-1278.420) * [-1277.998] (-1278.865) (-1278.742) (-1280.934) -- 0:00:59
201500 -- (-1280.218) (-1285.798) (-1279.219) [-1279.772] * [-1281.377] (-1278.657) (-1279.272) (-1279.922) -- 0:00:59
202000 -- (-1279.219) (-1281.230) [-1278.164] (-1281.155) * [-1279.782] (-1277.535) (-1278.860) (-1278.612) -- 0:00:59
202500 -- (-1278.583) (-1279.334) (-1280.413) [-1279.239] * (-1279.815) (-1279.175) [-1278.386] (-1281.197) -- 0:00:59
203000 -- (-1277.599) (-1277.175) (-1279.156) [-1277.625] * (-1282.791) [-1280.180] (-1278.096) (-1279.669) -- 0:00:58
203500 -- [-1280.841] (-1277.987) (-1280.218) (-1277.713) * (-1281.784) [-1279.032] (-1277.697) (-1278.383) -- 0:00:58
204000 -- (-1277.398) [-1280.447] (-1281.220) (-1280.341) * (-1278.702) [-1277.480] (-1279.920) (-1278.801) -- 0:00:58
204500 -- (-1278.392) (-1277.956) (-1281.108) [-1278.101] * [-1278.314] (-1283.967) (-1284.283) (-1276.832) -- 0:00:58
205000 -- (-1278.068) [-1276.900] (-1278.868) (-1278.841) * (-1278.573) [-1278.506] (-1278.803) (-1280.487) -- 0:00:58
Average standard deviation of split frequencies: 0.014620
205500 -- (-1278.207) [-1279.240] (-1280.930) (-1278.498) * [-1281.232] (-1279.204) (-1277.002) (-1279.489) -- 0:00:57
206000 -- (-1277.621) (-1279.884) (-1279.840) [-1279.651] * (-1278.511) (-1282.549) (-1277.889) [-1279.130] -- 0:00:57
206500 -- [-1277.457] (-1278.151) (-1279.812) (-1281.054) * (-1277.432) [-1278.977] (-1277.817) (-1279.202) -- 0:00:57
207000 -- (-1277.984) (-1279.070) [-1280.172] (-1280.746) * (-1281.278) (-1278.401) (-1277.724) [-1278.696] -- 0:00:57
207500 -- [-1278.512] (-1278.294) (-1282.660) (-1278.885) * (-1281.345) [-1278.247] (-1277.856) (-1278.344) -- 0:00:57
208000 -- (-1278.429) [-1278.271] (-1282.716) (-1278.469) * (-1281.366) (-1278.007) [-1279.543] (-1282.699) -- 0:00:57
208500 -- (-1279.073) (-1278.291) (-1277.978) [-1279.336] * (-1278.625) (-1277.651) [-1281.282] (-1281.845) -- 0:00:56
209000 -- (-1279.410) (-1278.600) (-1279.318) [-1279.316] * (-1278.423) (-1278.224) [-1281.288] (-1278.863) -- 0:00:56
209500 -- (-1290.430) (-1279.043) [-1278.156] (-1277.282) * (-1281.787) (-1278.420) (-1278.721) [-1278.772] -- 0:00:56
210000 -- (-1281.093) (-1277.024) (-1280.021) [-1278.220] * (-1280.495) [-1278.463] (-1279.007) (-1280.445) -- 0:00:56
Average standard deviation of split frequencies: 0.014839
210500 -- [-1277.592] (-1277.677) (-1277.767) (-1278.916) * (-1279.332) (-1278.797) [-1283.393] (-1280.134) -- 0:00:56
211000 -- (-1278.878) [-1279.001] (-1277.406) (-1278.547) * (-1279.670) [-1279.059] (-1279.564) (-1280.121) -- 0:00:56
211500 -- (-1279.098) (-1277.581) [-1280.050] (-1277.985) * [-1280.077] (-1278.732) (-1279.042) (-1281.619) -- 0:00:59
212000 -- (-1278.408) (-1281.843) [-1280.485] (-1280.859) * (-1280.255) (-1278.956) (-1278.221) [-1277.663] -- 0:00:59
212500 -- (-1280.375) (-1277.885) (-1277.937) [-1279.313] * (-1279.252) (-1277.190) [-1279.794] (-1278.481) -- 0:00:59
213000 -- (-1280.770) (-1279.731) [-1279.912] (-1277.771) * (-1281.095) [-1279.508] (-1281.072) (-1277.997) -- 0:00:59
213500 -- (-1279.447) (-1279.704) (-1277.677) [-1279.793] * (-1279.114) [-1279.380] (-1277.840) (-1278.803) -- 0:00:58
214000 -- (-1281.486) (-1278.649) (-1280.690) [-1277.133] * (-1278.515) [-1278.491] (-1278.777) (-1278.514) -- 0:00:58
214500 -- (-1279.532) [-1278.309] (-1280.828) (-1281.510) * (-1278.462) [-1276.719] (-1278.661) (-1278.086) -- 0:00:58
215000 -- (-1278.299) [-1283.673] (-1278.127) (-1284.738) * (-1280.041) [-1280.011] (-1277.908) (-1283.072) -- 0:00:58
Average standard deviation of split frequencies: 0.015277
215500 -- (-1278.609) (-1279.247) [-1278.930] (-1278.685) * [-1279.617] (-1276.982) (-1278.768) (-1279.034) -- 0:00:58
216000 -- (-1278.632) (-1280.404) (-1278.618) [-1279.762] * [-1279.779] (-1279.105) (-1277.738) (-1280.027) -- 0:00:58
216500 -- (-1277.714) (-1280.391) (-1278.447) [-1277.977] * (-1278.655) (-1278.438) [-1280.673] (-1280.428) -- 0:00:57
217000 -- [-1282.561] (-1279.318) (-1280.167) (-1278.143) * (-1277.359) [-1276.270] (-1277.987) (-1278.043) -- 0:00:57
217500 -- (-1278.431) [-1285.523] (-1278.581) (-1278.498) * (-1276.990) (-1278.747) [-1276.838] (-1278.078) -- 0:00:57
218000 -- (-1278.077) (-1279.680) (-1280.332) [-1277.898] * (-1276.233) (-1278.274) (-1276.249) [-1277.284] -- 0:00:57
218500 -- (-1280.322) (-1278.510) (-1277.773) [-1279.518] * (-1281.911) (-1278.602) [-1279.056] (-1277.768) -- 0:00:57
219000 -- (-1278.152) [-1277.642] (-1278.414) (-1279.636) * [-1277.078] (-1279.973) (-1280.053) (-1278.319) -- 0:00:57
219500 -- (-1279.463) (-1279.838) (-1279.000) [-1279.714] * (-1278.667) (-1281.846) (-1280.215) [-1279.408] -- 0:00:56
220000 -- (-1284.639) (-1279.922) [-1278.262] (-1280.303) * (-1277.987) [-1282.123] (-1278.400) (-1280.023) -- 0:00:56
Average standard deviation of split frequencies: 0.013648
220500 -- (-1278.712) (-1284.747) (-1278.330) [-1282.176] * (-1278.790) [-1278.624] (-1277.287) (-1278.654) -- 0:00:56
221000 -- [-1283.674] (-1285.268) (-1278.641) (-1279.381) * (-1279.001) [-1279.169] (-1281.450) (-1278.345) -- 0:00:56
221500 -- (-1279.622) (-1278.828) [-1279.517] (-1277.634) * (-1279.254) [-1278.408] (-1281.619) (-1279.086) -- 0:00:56
222000 -- (-1280.304) (-1280.464) (-1282.050) [-1279.563] * (-1282.882) (-1278.089) (-1277.093) [-1278.918] -- 0:00:56
222500 -- [-1277.996] (-1279.089) (-1277.273) (-1279.206) * [-1278.202] (-1279.960) (-1278.952) (-1277.464) -- 0:00:55
223000 -- (-1278.502) (-1280.790) (-1278.929) [-1280.006] * (-1277.823) [-1280.417] (-1279.066) (-1280.585) -- 0:00:55
223500 -- (-1280.484) (-1286.658) [-1278.624] (-1278.604) * (-1278.291) [-1282.961] (-1279.356) (-1282.869) -- 0:00:55
224000 -- (-1279.093) (-1282.098) (-1282.965) [-1278.324] * (-1282.332) [-1280.111] (-1279.391) (-1280.308) -- 0:00:58
224500 -- (-1280.417) [-1282.429] (-1280.430) (-1278.389) * [-1279.413] (-1278.835) (-1278.339) (-1279.862) -- 0:00:58
225000 -- (-1277.066) (-1280.209) (-1279.577) [-1279.066] * (-1281.275) (-1282.231) [-1276.897] (-1280.849) -- 0:00:58
Average standard deviation of split frequencies: 0.012076
225500 -- (-1279.940) [-1280.194] (-1277.767) (-1279.329) * (-1281.843) (-1279.551) [-1280.517] (-1281.198) -- 0:00:58
226000 -- (-1279.768) [-1278.083] (-1278.321) (-1278.790) * (-1278.350) [-1278.829] (-1278.064) (-1280.787) -- 0:00:58
226500 -- (-1285.064) [-1279.610] (-1277.476) (-1280.144) * (-1277.940) (-1280.476) [-1276.923] (-1278.313) -- 0:00:58
227000 -- (-1282.968) [-1276.968] (-1281.135) (-1279.163) * (-1279.898) (-1277.505) [-1277.281] (-1279.707) -- 0:00:57
227500 -- [-1280.066] (-1281.739) (-1282.208) (-1279.499) * (-1280.312) (-1284.472) (-1281.268) [-1279.410] -- 0:00:57
228000 -- (-1280.513) (-1282.587) [-1280.475] (-1278.931) * [-1278.760] (-1280.035) (-1277.227) (-1283.187) -- 0:00:57
228500 -- [-1280.499] (-1278.769) (-1279.011) (-1278.783) * (-1281.052) (-1279.087) [-1279.754] (-1277.083) -- 0:00:57
229000 -- (-1279.643) [-1284.002] (-1277.418) (-1278.574) * [-1280.107] (-1280.448) (-1279.218) (-1277.102) -- 0:00:57
229500 -- [-1279.113] (-1281.964) (-1277.584) (-1277.288) * (-1278.457) [-1281.176] (-1277.514) (-1277.285) -- 0:00:57
230000 -- [-1280.329] (-1280.019) (-1280.483) (-1279.381) * [-1277.386] (-1279.620) (-1277.590) (-1278.317) -- 0:00:56
Average standard deviation of split frequencies: 0.013122
230500 -- (-1279.225) (-1279.501) [-1277.246] (-1279.086) * (-1280.434) (-1280.889) [-1279.419] (-1278.472) -- 0:00:56
231000 -- [-1280.094] (-1278.230) (-1278.473) (-1278.682) * (-1278.744) (-1277.112) (-1281.143) [-1274.849] -- 0:00:56
231500 -- (-1276.488) (-1275.286) (-1278.358) [-1278.664] * [-1279.934] (-1278.527) (-1282.774) (-1282.831) -- 0:00:56
232000 -- [-1280.836] (-1280.031) (-1277.893) (-1277.973) * (-1282.046) (-1280.847) (-1277.897) [-1278.242] -- 0:00:56
232500 -- (-1277.836) (-1279.666) (-1280.907) [-1277.009] * (-1281.124) (-1280.543) (-1284.188) [-1280.538] -- 0:00:56
233000 -- [-1277.544] (-1278.757) (-1284.312) (-1275.247) * (-1282.204) [-1278.386] (-1280.900) (-1279.810) -- 0:00:55
233500 -- [-1278.686] (-1278.127) (-1278.357) (-1279.217) * (-1279.531) (-1276.973) [-1277.358] (-1280.765) -- 0:00:55
234000 -- (-1278.056) (-1279.217) (-1280.867) [-1278.347] * [-1281.346] (-1278.616) (-1277.610) (-1282.386) -- 0:00:55
234500 -- [-1280.309] (-1279.034) (-1280.666) (-1279.040) * (-1279.033) [-1278.863] (-1277.813) (-1277.679) -- 0:00:55
235000 -- (-1280.065) [-1281.085] (-1282.229) (-1279.011) * (-1277.983) (-1278.602) (-1279.087) [-1278.340] -- 0:00:55
Average standard deviation of split frequencies: 0.012405
235500 -- [-1280.828] (-1284.006) (-1281.173) (-1278.449) * [-1278.969] (-1278.382) (-1280.427) (-1278.422) -- 0:00:55
236000 -- (-1280.470) (-1280.084) [-1281.018] (-1277.925) * [-1277.963] (-1278.755) (-1281.991) (-1284.356) -- 0:00:58
236500 -- [-1277.155] (-1279.697) (-1279.044) (-1277.774) * (-1278.318) (-1282.702) (-1281.504) [-1277.209] -- 0:00:58
237000 -- [-1279.570] (-1279.039) (-1279.067) (-1279.616) * (-1277.779) (-1278.318) (-1278.023) [-1275.719] -- 0:00:57
237500 -- (-1278.553) [-1279.087] (-1279.509) (-1279.506) * (-1277.747) (-1278.721) (-1278.268) [-1277.889] -- 0:00:57
238000 -- (-1277.984) [-1279.834] (-1279.734) (-1277.118) * (-1277.705) (-1277.957) (-1278.612) [-1277.999] -- 0:00:57
238500 -- (-1277.909) (-1279.066) [-1279.058] (-1276.733) * (-1279.133) (-1278.657) [-1279.037] (-1276.902) -- 0:00:57
239000 -- (-1281.640) (-1278.645) (-1278.617) [-1278.231] * (-1283.673) (-1278.536) [-1278.466] (-1278.630) -- 0:00:57
239500 -- (-1287.549) (-1281.423) (-1281.401) [-1277.722] * (-1283.926) (-1280.828) (-1278.480) [-1278.628] -- 0:00:57
240000 -- (-1281.041) [-1281.644] (-1277.570) (-1278.419) * (-1281.674) (-1279.724) [-1276.219] (-1278.090) -- 0:00:56
Average standard deviation of split frequencies: 0.012577
240500 -- (-1278.448) [-1280.226] (-1277.941) (-1278.014) * (-1279.129) (-1279.158) (-1276.388) [-1276.959] -- 0:00:56
241000 -- (-1279.908) [-1280.203] (-1281.279) (-1281.395) * (-1279.947) (-1283.201) (-1277.216) [-1279.047] -- 0:00:56
241500 -- (-1278.186) (-1277.997) [-1281.727] (-1280.449) * (-1281.339) (-1279.507) (-1277.993) [-1277.687] -- 0:00:56
242000 -- (-1277.110) [-1278.905] (-1277.834) (-1279.632) * (-1277.979) (-1277.890) [-1281.005] (-1282.898) -- 0:00:56
242500 -- (-1285.181) (-1278.274) [-1277.448] (-1280.286) * [-1280.163] (-1278.490) (-1278.894) (-1277.945) -- 0:00:56
243000 -- (-1281.782) [-1275.930] (-1277.495) (-1283.778) * (-1280.010) [-1277.708] (-1280.720) (-1276.614) -- 0:00:56
243500 -- (-1278.652) (-1283.176) (-1277.822) [-1279.303] * (-1281.851) (-1278.597) [-1278.473] (-1278.866) -- 0:00:55
244000 -- (-1277.293) (-1282.026) [-1279.062] (-1279.171) * (-1278.831) (-1278.038) [-1280.912] (-1282.632) -- 0:00:55
244500 -- (-1278.419) [-1281.115] (-1277.927) (-1278.933) * (-1279.417) [-1278.134] (-1278.327) (-1278.269) -- 0:00:55
245000 -- (-1278.168) (-1282.148) (-1279.584) [-1278.338] * (-1279.132) (-1278.881) (-1278.297) [-1278.465] -- 0:00:55
Average standard deviation of split frequencies: 0.013011
245500 -- (-1281.695) (-1280.557) [-1279.695] (-1280.882) * (-1277.939) (-1279.126) [-1277.860] (-1278.806) -- 0:00:55
246000 -- (-1279.286) [-1276.640] (-1278.329) (-1276.865) * (-1279.908) (-1278.477) [-1277.055] (-1278.801) -- 0:00:55
246500 -- (-1279.696) [-1280.021] (-1279.792) (-1278.092) * (-1280.809) (-1279.713) (-1277.941) [-1279.266] -- 0:00:55
247000 -- (-1279.036) (-1277.498) (-1281.309) [-1278.704] * (-1280.386) (-1280.051) (-1277.958) [-1285.307] -- 0:00:54
247500 -- (-1281.322) [-1276.880] (-1279.223) (-1276.985) * (-1280.144) (-1277.966) (-1279.649) [-1285.144] -- 0:00:54
248000 -- (-1279.754) (-1276.400) (-1279.536) [-1279.201] * (-1277.432) (-1282.527) (-1277.054) [-1284.603] -- 0:00:57
248500 -- (-1283.155) (-1277.901) (-1278.494) [-1276.990] * (-1281.789) [-1279.276] (-1277.565) (-1282.307) -- 0:00:57
249000 -- (-1285.780) (-1277.654) (-1279.543) [-1276.079] * (-1281.673) (-1277.571) [-1279.673] (-1283.441) -- 0:00:57
249500 -- [-1282.230] (-1281.497) (-1278.373) (-1278.969) * (-1281.750) [-1277.199] (-1276.941) (-1281.542) -- 0:00:57
250000 -- (-1278.447) (-1277.571) [-1279.013] (-1277.688) * [-1278.151] (-1280.983) (-1279.606) (-1281.631) -- 0:00:57
Average standard deviation of split frequencies: 0.014253
250500 -- (-1278.419) (-1277.159) (-1278.509) [-1276.252] * (-1278.137) (-1279.321) (-1278.503) [-1279.288] -- 0:00:56
251000 -- (-1278.485) [-1277.052] (-1283.498) (-1277.150) * [-1281.106] (-1280.327) (-1277.521) (-1278.178) -- 0:00:56
251500 -- (-1280.598) [-1275.915] (-1279.983) (-1277.324) * (-1277.669) (-1280.956) (-1281.873) [-1279.478] -- 0:00:56
252000 -- (-1277.221) (-1278.719) (-1280.709) [-1277.736] * (-1278.595) (-1281.093) [-1277.893] (-1278.104) -- 0:00:56
252500 -- [-1280.396] (-1278.757) (-1281.284) (-1284.940) * [-1278.433] (-1281.113) (-1277.962) (-1277.507) -- 0:00:56
253000 -- (-1277.956) [-1277.332] (-1280.579) (-1279.612) * (-1280.628) (-1278.997) (-1277.254) [-1279.034] -- 0:00:56
253500 -- (-1280.063) (-1278.112) [-1280.520] (-1278.132) * (-1278.980) (-1276.129) (-1277.933) [-1279.887] -- 0:00:55
254000 -- (-1277.934) (-1278.380) (-1279.002) [-1277.166] * (-1278.880) (-1279.039) [-1280.984] (-1280.164) -- 0:00:55
254500 -- [-1280.666] (-1278.255) (-1278.615) (-1279.022) * [-1282.540] (-1278.933) (-1278.754) (-1283.179) -- 0:00:55
255000 -- (-1278.270) [-1278.697] (-1277.985) (-1278.561) * (-1280.897) [-1282.093] (-1279.773) (-1279.636) -- 0:00:55
Average standard deviation of split frequencies: 0.016088
255500 -- (-1279.780) (-1278.286) [-1278.030] (-1277.278) * (-1278.741) [-1280.699] (-1279.035) (-1282.315) -- 0:00:55
256000 -- (-1279.341) (-1279.479) [-1278.043] (-1279.520) * (-1283.993) [-1277.469] (-1280.251) (-1279.341) -- 0:00:55
256500 -- [-1278.869] (-1279.223) (-1278.373) (-1277.038) * (-1279.868) (-1283.144) (-1280.076) [-1277.797] -- 0:00:55
257000 -- (-1278.829) (-1280.089) [-1279.022] (-1277.983) * (-1281.859) (-1283.097) [-1281.018] (-1277.661) -- 0:00:54
257500 -- (-1278.195) (-1282.428) (-1279.978) [-1276.582] * (-1278.894) [-1279.104] (-1278.471) (-1277.844) -- 0:00:54
258000 -- (-1278.195) (-1281.952) (-1279.010) [-1278.589] * (-1278.058) [-1279.553] (-1275.774) (-1276.756) -- 0:00:54
258500 -- (-1278.196) (-1278.339) (-1277.323) [-1279.139] * [-1278.034] (-1277.434) (-1278.302) (-1280.750) -- 0:00:54
259000 -- (-1277.714) [-1279.173] (-1278.825) (-1277.586) * (-1280.856) (-1279.540) [-1281.259] (-1279.975) -- 0:00:54
259500 -- (-1279.437) (-1278.446) (-1278.114) [-1277.675] * (-1279.675) (-1276.136) [-1278.789] (-1278.696) -- 0:00:54
260000 -- [-1279.221] (-1280.309) (-1279.036) (-1281.050) * (-1278.818) (-1277.787) [-1277.994] (-1279.065) -- 0:00:54
Average standard deviation of split frequencies: 0.015610
260500 -- (-1284.639) [-1277.457] (-1280.647) (-1281.771) * (-1279.141) (-1279.281) (-1281.447) [-1280.783] -- 0:00:53
261000 -- (-1285.907) (-1276.393) (-1280.062) [-1279.620] * [-1278.720] (-1277.578) (-1278.119) (-1281.544) -- 0:00:53
261500 -- (-1285.729) [-1277.328] (-1278.506) (-1280.197) * [-1278.212] (-1278.733) (-1278.928) (-1275.973) -- 0:00:53
262000 -- [-1279.065] (-1276.583) (-1278.299) (-1278.660) * (-1279.810) [-1279.987] (-1277.694) (-1282.224) -- 0:00:56
262500 -- (-1278.039) [-1278.784] (-1279.004) (-1278.938) * [-1278.993] (-1280.445) (-1276.081) (-1278.054) -- 0:00:56
263000 -- (-1278.001) (-1281.752) (-1282.944) [-1279.324] * (-1280.130) (-1278.657) (-1277.984) [-1279.664] -- 0:00:56
263500 -- (-1275.888) [-1277.520] (-1284.185) (-1277.752) * (-1281.297) [-1278.660] (-1278.281) (-1280.284) -- 0:00:55
264000 -- (-1278.711) [-1280.041] (-1277.729) (-1278.681) * (-1286.794) [-1277.476] (-1281.229) (-1278.254) -- 0:00:55
264500 -- [-1279.736] (-1278.362) (-1280.695) (-1279.811) * [-1278.735] (-1277.519) (-1279.354) (-1277.595) -- 0:00:55
265000 -- (-1278.759) (-1277.282) (-1282.199) [-1283.786] * (-1277.671) [-1277.382] (-1279.020) (-1280.300) -- 0:00:55
Average standard deviation of split frequencies: 0.013618
265500 -- (-1280.705) (-1279.711) [-1278.696] (-1280.963) * (-1278.292) (-1279.146) [-1277.249] (-1278.675) -- 0:00:55
266000 -- (-1277.116) [-1275.627] (-1281.202) (-1281.048) * (-1276.707) (-1279.320) [-1277.598] (-1279.130) -- 0:00:55
266500 -- [-1278.683] (-1280.996) (-1279.523) (-1280.193) * [-1278.799] (-1279.815) (-1280.125) (-1277.222) -- 0:00:55
267000 -- (-1278.197) (-1282.869) [-1280.464] (-1277.111) * (-1278.563) (-1277.861) [-1279.908] (-1278.017) -- 0:00:54
267500 -- (-1278.054) (-1287.484) [-1277.755] (-1278.935) * (-1278.875) (-1278.982) (-1278.767) [-1279.004] -- 0:00:54
268000 -- [-1280.841] (-1283.742) (-1279.016) (-1279.285) * [-1278.698] (-1284.101) (-1279.876) (-1278.125) -- 0:00:54
268500 -- [-1279.713] (-1283.322) (-1278.950) (-1277.891) * (-1280.775) (-1286.615) [-1277.671] (-1278.809) -- 0:00:54
269000 -- (-1280.085) (-1286.165) [-1278.608] (-1280.346) * (-1279.883) (-1279.146) (-1277.710) [-1279.719] -- 0:00:54
269500 -- [-1277.438] (-1280.558) (-1279.472) (-1278.659) * (-1279.736) (-1280.028) [-1281.052] (-1280.454) -- 0:00:54
270000 -- (-1277.878) (-1279.567) (-1278.555) [-1278.907] * (-1278.926) (-1278.764) [-1277.767] (-1280.796) -- 0:00:54
Average standard deviation of split frequencies: 0.014391
270500 -- [-1275.640] (-1282.712) (-1277.441) (-1280.470) * (-1279.858) [-1280.297] (-1277.819) (-1278.473) -- 0:00:53
271000 -- (-1282.093) [-1277.254] (-1278.854) (-1284.744) * (-1277.811) (-1281.186) (-1281.637) [-1279.016] -- 0:00:53
271500 -- (-1281.582) [-1277.550] (-1278.755) (-1285.506) * (-1278.205) (-1279.027) [-1281.879] (-1279.912) -- 0:00:53
272000 -- (-1279.981) (-1277.888) [-1281.378] (-1285.631) * (-1279.847) (-1281.911) [-1278.992] (-1279.710) -- 0:00:53
272500 -- (-1278.636) [-1278.134] (-1278.547) (-1280.047) * (-1280.812) (-1278.733) (-1279.408) [-1278.480] -- 0:00:53
273000 -- (-1280.517) (-1278.009) [-1277.840] (-1278.560) * (-1279.972) (-1278.788) (-1279.495) [-1277.867] -- 0:00:53
273500 -- (-1280.000) (-1279.572) (-1280.447) [-1279.413] * [-1281.675] (-1279.013) (-1277.661) (-1279.653) -- 0:00:53
274000 -- (-1280.742) (-1279.667) [-1277.715] (-1277.564) * (-1278.315) (-1279.052) [-1279.777] (-1279.282) -- 0:00:52
274500 -- (-1279.869) [-1278.809] (-1279.215) (-1277.531) * [-1281.542] (-1279.059) (-1277.804) (-1284.606) -- 0:00:52
275000 -- (-1279.760) [-1279.662] (-1278.511) (-1277.604) * [-1279.798] (-1279.611) (-1277.073) (-1281.460) -- 0:00:52
Average standard deviation of split frequencies: 0.014023
275500 -- [-1276.727] (-1279.345) (-1281.919) (-1283.233) * [-1278.292] (-1278.079) (-1276.336) (-1281.482) -- 0:00:55
276000 -- (-1278.876) [-1278.135] (-1280.866) (-1278.496) * [-1279.724] (-1277.303) (-1283.490) (-1281.396) -- 0:00:55
276500 -- (-1278.198) (-1278.794) (-1279.615) [-1279.846] * (-1280.119) [-1279.999] (-1277.916) (-1283.253) -- 0:00:54
277000 -- (-1280.388) (-1277.776) (-1282.389) [-1278.794] * (-1277.833) [-1280.356] (-1278.704) (-1277.581) -- 0:00:54
277500 -- (-1278.731) (-1278.379) (-1278.370) [-1276.429] * (-1279.920) (-1281.306) [-1277.870] (-1277.978) -- 0:00:54
278000 -- (-1278.991) (-1278.109) [-1278.232] (-1276.337) * (-1277.826) (-1279.850) [-1278.567] (-1279.571) -- 0:00:54
278500 -- (-1276.927) (-1280.341) [-1281.294] (-1276.129) * (-1279.082) (-1282.496) (-1278.227) [-1277.621] -- 0:00:54
279000 -- (-1278.993) [-1281.111] (-1277.783) (-1279.576) * (-1278.809) (-1283.586) (-1278.506) [-1278.001] -- 0:00:54
279500 -- (-1281.142) (-1279.974) [-1279.686] (-1278.007) * (-1279.622) (-1281.272) [-1277.571] (-1278.677) -- 0:00:54
280000 -- (-1278.477) (-1278.323) [-1277.658] (-1283.486) * (-1280.802) (-1278.179) (-1277.866) [-1278.947] -- 0:00:53
Average standard deviation of split frequencies: 0.012111
280500 -- (-1278.176) [-1280.062] (-1278.772) (-1278.995) * (-1277.636) [-1278.698] (-1279.476) (-1280.833) -- 0:00:53
281000 -- (-1279.309) [-1277.902] (-1280.197) (-1278.970) * (-1278.740) [-1278.943] (-1277.738) (-1278.480) -- 0:00:53
281500 -- (-1278.737) (-1278.827) (-1278.265) [-1276.392] * (-1280.763) [-1277.598] (-1278.888) (-1277.600) -- 0:00:53
282000 -- (-1281.595) [-1277.620] (-1278.443) (-1280.316) * (-1282.526) (-1280.943) (-1282.426) [-1277.128] -- 0:00:53
282500 -- (-1277.903) (-1277.824) [-1278.045] (-1279.042) * (-1282.412) (-1280.767) [-1276.143] (-1278.277) -- 0:00:53
283000 -- (-1278.447) (-1278.257) [-1281.248] (-1277.796) * (-1277.719) [-1277.969] (-1278.835) (-1279.005) -- 0:00:53
283500 -- (-1281.367) (-1277.660) (-1279.189) [-1281.837] * (-1278.307) (-1285.588) (-1278.210) [-1280.147] -- 0:00:53
284000 -- (-1278.620) (-1279.317) [-1278.419] (-1280.405) * (-1277.225) (-1280.353) [-1280.348] (-1278.729) -- 0:00:52
284500 -- (-1278.550) (-1277.368) [-1278.980] (-1282.259) * [-1281.631] (-1276.726) (-1278.429) (-1280.024) -- 0:00:52
285000 -- (-1277.922) (-1277.770) [-1277.862] (-1278.225) * [-1277.369] (-1279.358) (-1278.167) (-1279.449) -- 0:00:52
Average standard deviation of split frequencies: 0.011538
285500 -- [-1278.359] (-1280.089) (-1280.243) (-1280.028) * (-1277.636) [-1280.036] (-1281.228) (-1278.147) -- 0:00:52
286000 -- [-1278.347] (-1279.503) (-1279.124) (-1280.168) * (-1278.495) [-1278.522] (-1283.237) (-1278.040) -- 0:00:52
286500 -- (-1278.401) (-1281.080) [-1281.530] (-1281.101) * (-1279.294) (-1279.867) [-1285.421] (-1279.796) -- 0:00:52
287000 -- (-1278.498) [-1280.082] (-1281.522) (-1278.633) * (-1279.989) (-1280.868) [-1279.570] (-1278.919) -- 0:00:52
287500 -- (-1276.761) [-1277.348] (-1280.975) (-1278.255) * (-1279.369) [-1279.159] (-1279.356) (-1278.178) -- 0:00:52
288000 -- (-1282.041) (-1280.575) (-1278.605) [-1278.254] * (-1279.842) (-1284.671) (-1281.025) [-1278.348] -- 0:00:51
288500 -- [-1280.153] (-1282.653) (-1277.861) (-1278.002) * (-1283.036) [-1281.289] (-1279.915) (-1279.959) -- 0:00:54
289000 -- [-1278.909] (-1279.377) (-1278.863) (-1277.857) * (-1283.197) (-1280.617) (-1279.879) [-1277.025] -- 0:00:54
289500 -- (-1278.864) (-1281.482) (-1277.854) [-1277.520] * [-1283.945] (-1281.885) (-1277.277) (-1281.994) -- 0:00:53
290000 -- (-1282.442) (-1279.295) [-1277.971] (-1277.667) * [-1279.210] (-1278.156) (-1277.156) (-1279.886) -- 0:00:53
Average standard deviation of split frequencies: 0.010499
290500 -- [-1276.969] (-1280.855) (-1277.396) (-1277.676) * (-1279.119) (-1277.643) (-1282.237) [-1280.474] -- 0:00:53
291000 -- (-1278.425) (-1281.265) [-1279.696] (-1277.925) * (-1278.975) (-1278.512) (-1283.647) [-1281.330] -- 0:00:53
291500 -- (-1278.669) (-1280.350) [-1281.811] (-1280.428) * [-1278.656] (-1278.324) (-1279.050) (-1276.833) -- 0:00:53
292000 -- [-1278.997] (-1281.927) (-1279.055) (-1278.468) * (-1278.776) (-1278.339) [-1279.622] (-1282.578) -- 0:00:53
292500 -- (-1278.031) (-1280.279) [-1275.505] (-1279.515) * (-1278.910) (-1279.665) (-1284.242) [-1278.624] -- 0:00:53
293000 -- (-1279.788) (-1277.578) (-1275.571) [-1278.201] * (-1279.498) (-1279.335) (-1279.852) [-1277.884] -- 0:00:53
293500 -- (-1280.042) (-1279.417) [-1278.682] (-1278.011) * (-1276.377) (-1281.866) [-1280.258] (-1279.764) -- 0:00:52
294000 -- (-1279.925) (-1277.242) [-1276.487] (-1278.590) * (-1279.400) (-1278.629) (-1280.387) [-1277.312] -- 0:00:52
294500 -- [-1278.635] (-1275.427) (-1277.910) (-1282.208) * (-1283.254) [-1280.677] (-1279.915) (-1279.237) -- 0:00:52
295000 -- (-1279.168) [-1277.592] (-1277.837) (-1279.717) * [-1277.575] (-1278.921) (-1284.463) (-1278.852) -- 0:00:52
Average standard deviation of split frequencies: 0.011060
295500 -- [-1279.664] (-1277.485) (-1278.757) (-1278.915) * [-1280.241] (-1278.175) (-1279.140) (-1277.508) -- 0:00:52
296000 -- [-1277.993] (-1278.013) (-1276.000) (-1277.906) * (-1279.621) [-1277.780] (-1279.309) (-1277.375) -- 0:00:52
296500 -- (-1283.942) (-1280.660) (-1281.045) [-1277.854] * (-1277.417) (-1279.039) (-1278.690) [-1278.086] -- 0:00:52
297000 -- (-1279.028) (-1280.709) (-1278.078) [-1277.629] * (-1278.673) (-1278.627) (-1278.765) [-1280.918] -- 0:00:52
297500 -- [-1280.285] (-1280.133) (-1278.090) (-1279.028) * (-1278.986) [-1279.303] (-1281.256) (-1278.346) -- 0:00:51
298000 -- (-1280.324) [-1277.361] (-1278.568) (-1281.367) * [-1279.408] (-1277.898) (-1278.803) (-1278.381) -- 0:00:51
298500 -- (-1277.010) (-1277.387) [-1279.586] (-1278.940) * (-1278.628) [-1277.843] (-1279.043) (-1280.857) -- 0:00:51
299000 -- (-1280.278) (-1278.458) [-1278.189] (-1277.733) * (-1278.268) (-1278.101) [-1280.797] (-1279.290) -- 0:00:51
299500 -- (-1277.677) (-1278.425) [-1280.949] (-1276.982) * (-1279.959) (-1280.140) [-1277.513] (-1277.671) -- 0:00:51
300000 -- (-1278.070) (-1278.090) [-1280.099] (-1277.602) * (-1278.908) (-1280.879) (-1277.711) [-1279.475] -- 0:00:51
Average standard deviation of split frequencies: 0.012727
300500 -- (-1278.626) [-1281.325] (-1278.462) (-1278.727) * [-1278.635] (-1281.269) (-1282.506) (-1279.938) -- 0:00:53
301000 -- (-1278.608) (-1281.219) [-1278.121] (-1278.827) * [-1281.389] (-1285.855) (-1280.513) (-1277.792) -- 0:00:53
301500 -- (-1279.393) (-1283.561) (-1281.500) [-1278.019] * (-1280.997) [-1280.828] (-1279.439) (-1277.945) -- 0:00:53
302000 -- (-1277.992) (-1278.715) [-1277.304] (-1279.610) * [-1279.611] (-1278.501) (-1279.165) (-1280.751) -- 0:00:53
302500 -- (-1275.720) (-1277.818) [-1277.264] (-1278.742) * (-1281.951) [-1278.316] (-1279.843) (-1278.916) -- 0:00:53
303000 -- (-1278.371) [-1279.122] (-1278.208) (-1279.102) * [-1281.733] (-1279.298) (-1278.705) (-1281.399) -- 0:00:52
303500 -- (-1277.264) (-1278.162) [-1278.561] (-1282.424) * (-1281.098) (-1278.407) [-1277.441] (-1278.898) -- 0:00:52
304000 -- [-1278.387] (-1279.332) (-1278.295) (-1278.215) * [-1280.221] (-1281.756) (-1280.249) (-1278.397) -- 0:00:52
304500 -- (-1278.333) (-1280.366) (-1276.894) [-1278.385] * [-1277.166] (-1275.170) (-1277.135) (-1278.237) -- 0:00:52
305000 -- (-1278.622) [-1279.067] (-1279.539) (-1278.808) * [-1277.044] (-1275.693) (-1277.409) (-1282.428) -- 0:00:52
Average standard deviation of split frequencies: 0.011351
305500 -- (-1278.520) (-1279.311) [-1279.980] (-1276.003) * (-1278.311) (-1277.807) [-1276.049] (-1281.122) -- 0:00:52
306000 -- (-1278.780) (-1278.181) [-1282.168] (-1278.365) * (-1280.058) (-1277.740) [-1276.072] (-1276.576) -- 0:00:52
306500 -- (-1278.563) [-1278.698] (-1278.406) (-1281.291) * (-1278.800) [-1277.397] (-1277.324) (-1279.717) -- 0:00:52
307000 -- (-1278.821) [-1278.262] (-1278.792) (-1278.280) * (-1278.232) (-1277.604) [-1276.774] (-1287.627) -- 0:00:51
307500 -- [-1280.827] (-1279.173) (-1277.656) (-1280.845) * (-1279.634) (-1278.153) [-1276.176] (-1278.489) -- 0:00:51
308000 -- (-1283.329) (-1278.413) [-1277.757] (-1279.180) * (-1277.536) [-1277.511] (-1277.373) (-1277.917) -- 0:00:51
308500 -- [-1277.300] (-1279.860) (-1278.419) (-1279.541) * (-1282.002) (-1275.814) (-1278.617) [-1278.461] -- 0:00:51
309000 -- (-1277.721) (-1284.843) (-1279.978) [-1278.825] * [-1281.633] (-1277.433) (-1282.099) (-1280.157) -- 0:00:51
309500 -- (-1278.063) (-1280.838) [-1280.103] (-1278.532) * (-1279.993) (-1285.067) [-1279.100] (-1278.413) -- 0:00:51
310000 -- (-1280.386) (-1281.091) (-1282.792) [-1278.991] * (-1279.445) (-1277.342) (-1282.579) [-1277.977] -- 0:00:51
Average standard deviation of split frequencies: 0.010790
310500 -- (-1279.323) (-1277.960) [-1279.388] (-1279.810) * [-1278.933] (-1277.570) (-1280.579) (-1277.668) -- 0:00:51
311000 -- [-1279.476] (-1280.978) (-1277.896) (-1279.825) * (-1280.976) (-1275.658) [-1278.669] (-1279.683) -- 0:00:50
311500 -- (-1286.010) (-1284.226) [-1277.683] (-1279.399) * (-1277.805) (-1283.321) (-1280.143) [-1279.833] -- 0:00:50
312000 -- (-1278.152) (-1285.308) [-1280.765] (-1278.344) * (-1279.565) (-1279.230) (-1278.506) [-1282.365] -- 0:00:50
312500 -- (-1280.757) [-1284.226] (-1280.378) (-1279.037) * (-1277.965) (-1280.973) [-1278.868] (-1278.860) -- 0:00:50
313000 -- (-1279.748) (-1279.603) (-1275.645) [-1277.189] * [-1279.613] (-1280.285) (-1282.743) (-1278.271) -- 0:00:52
313500 -- [-1278.474] (-1278.009) (-1283.255) (-1276.241) * [-1278.445] (-1277.941) (-1281.605) (-1279.540) -- 0:00:52
314000 -- (-1278.733) [-1278.300] (-1279.297) (-1280.154) * [-1277.928] (-1277.417) (-1279.649) (-1279.220) -- 0:00:52
314500 -- (-1283.138) (-1280.321) (-1282.369) [-1281.122] * [-1277.009] (-1279.202) (-1280.159) (-1279.783) -- 0:00:52
315000 -- [-1279.188] (-1278.719) (-1282.246) (-1280.888) * [-1279.126] (-1275.599) (-1276.447) (-1278.895) -- 0:00:52
Average standard deviation of split frequencies: 0.010608
315500 -- (-1279.420) (-1278.767) (-1279.535) [-1278.056] * (-1279.377) (-1277.340) (-1278.180) [-1278.511] -- 0:00:52
316000 -- (-1278.494) (-1278.972) (-1279.293) [-1279.464] * (-1279.151) (-1278.449) [-1278.167] (-1276.207) -- 0:00:51
316500 -- (-1278.017) [-1279.470] (-1284.555) (-1279.192) * (-1279.329) (-1279.949) [-1278.133] (-1277.643) -- 0:00:51
317000 -- (-1277.527) (-1280.184) [-1282.696] (-1278.030) * (-1279.746) (-1278.841) [-1277.521] (-1280.994) -- 0:00:51
317500 -- (-1277.338) (-1283.500) (-1279.941) [-1280.089] * (-1280.457) (-1278.797) [-1278.611] (-1278.546) -- 0:00:51
318000 -- (-1279.469) (-1284.033) (-1280.991) [-1277.805] * (-1280.484) (-1277.775) (-1279.001) [-1277.675] -- 0:00:51
318500 -- [-1282.186] (-1288.073) (-1278.965) (-1279.060) * (-1279.543) (-1280.439) [-1278.378] (-1279.180) -- 0:00:51
319000 -- (-1279.662) (-1283.044) [-1278.861] (-1279.133) * [-1278.043] (-1279.505) (-1277.189) (-1280.732) -- 0:00:51
319500 -- [-1280.370] (-1281.890) (-1282.051) (-1280.018) * [-1280.442] (-1280.740) (-1277.554) (-1280.781) -- 0:00:51
320000 -- [-1279.164] (-1281.465) (-1280.266) (-1280.227) * (-1279.390) (-1280.102) (-1279.073) [-1281.189] -- 0:00:50
Average standard deviation of split frequencies: 0.009882
320500 -- (-1281.503) (-1278.339) (-1279.404) [-1277.055] * (-1282.202) [-1279.648] (-1279.206) (-1278.851) -- 0:00:50
321000 -- (-1278.287) [-1278.408] (-1280.087) (-1282.227) * (-1278.897) (-1277.963) (-1277.631) [-1280.083] -- 0:00:50
321500 -- [-1283.238] (-1277.586) (-1284.423) (-1278.891) * (-1278.741) (-1279.558) [-1276.451] (-1277.962) -- 0:00:50
322000 -- (-1279.223) (-1278.294) (-1284.829) [-1278.807] * [-1278.256] (-1278.238) (-1284.460) (-1282.337) -- 0:00:50
322500 -- (-1276.284) (-1276.774) (-1280.750) [-1276.744] * [-1276.726] (-1280.404) (-1279.110) (-1282.390) -- 0:00:50
323000 -- [-1279.560] (-1281.003) (-1281.912) (-1278.235) * [-1279.358] (-1277.792) (-1280.071) (-1277.442) -- 0:00:50
323500 -- [-1278.557] (-1278.725) (-1283.284) (-1278.002) * (-1277.866) (-1278.525) [-1280.760] (-1277.760) -- 0:00:50
324000 -- (-1279.259) (-1287.657) [-1283.607] (-1278.451) * (-1278.108) (-1278.654) [-1283.010] (-1278.085) -- 0:00:50
324500 -- (-1281.559) [-1278.836] (-1278.280) (-1282.065) * (-1278.403) (-1279.886) [-1278.648] (-1280.023) -- 0:00:49
325000 -- (-1279.449) (-1278.705) [-1278.760] (-1279.498) * (-1278.507) (-1277.114) (-1278.180) [-1280.246] -- 0:00:51
Average standard deviation of split frequencies: 0.009721
325500 -- (-1277.001) [-1278.170] (-1278.035) (-1279.078) * (-1282.675) (-1276.347) (-1277.132) [-1278.945] -- 0:00:51
326000 -- (-1279.902) (-1277.957) [-1277.899] (-1280.836) * [-1280.471] (-1279.201) (-1278.493) (-1277.683) -- 0:00:51
326500 -- (-1279.641) [-1282.991] (-1280.713) (-1280.429) * [-1280.249] (-1282.960) (-1277.644) (-1280.821) -- 0:00:51
327000 -- [-1279.389] (-1279.332) (-1279.812) (-1280.805) * [-1280.182] (-1278.488) (-1279.405) (-1281.329) -- 0:00:51
327500 -- [-1278.464] (-1279.626) (-1279.514) (-1281.218) * (-1280.113) (-1279.657) (-1278.085) [-1275.970] -- 0:00:51
328000 -- (-1277.416) (-1279.684) (-1281.411) [-1277.877] * (-1279.562) [-1284.184] (-1278.645) (-1277.126) -- 0:00:51
328500 -- [-1276.963] (-1284.915) (-1279.178) (-1277.777) * (-1278.502) (-1282.169) [-1280.112] (-1279.105) -- 0:00:51
329000 -- (-1279.870) (-1277.950) (-1280.501) [-1278.482] * (-1279.800) (-1281.348) (-1278.133) [-1278.423] -- 0:00:50
329500 -- (-1278.124) (-1279.233) (-1279.731) [-1278.730] * [-1279.855] (-1279.434) (-1279.756) (-1277.909) -- 0:00:50
330000 -- (-1278.118) (-1278.831) [-1279.446] (-1281.730) * (-1275.564) (-1279.128) [-1279.386] (-1278.240) -- 0:00:50
Average standard deviation of split frequencies: 0.010138
330500 -- (-1279.999) (-1279.412) [-1278.907] (-1278.764) * [-1279.671] (-1281.002) (-1277.706) (-1281.054) -- 0:00:50
331000 -- [-1279.710] (-1279.373) (-1278.424) (-1278.165) * (-1280.381) (-1282.007) [-1280.060] (-1279.648) -- 0:00:50
331500 -- (-1278.518) (-1279.188) (-1279.355) [-1280.235] * (-1277.928) (-1280.230) (-1281.262) [-1278.876] -- 0:00:50
332000 -- (-1278.707) (-1280.964) (-1281.363) [-1280.569] * [-1279.186] (-1279.148) (-1277.952) (-1278.057) -- 0:00:50
332500 -- (-1284.030) (-1282.949) (-1278.147) [-1279.434] * (-1279.525) (-1281.058) [-1280.717] (-1276.962) -- 0:00:50
333000 -- (-1279.169) (-1278.675) [-1281.132] (-1278.078) * [-1276.067] (-1279.841) (-1286.025) (-1278.328) -- 0:00:50
333500 -- (-1280.504) (-1279.821) (-1279.798) [-1280.113] * [-1280.208] (-1279.848) (-1288.041) (-1280.236) -- 0:00:49
334000 -- (-1278.470) (-1282.179) (-1278.909) [-1278.200] * (-1276.996) (-1278.861) (-1283.045) [-1281.724] -- 0:00:49
334500 -- (-1277.829) [-1279.681] (-1280.469) (-1279.050) * [-1275.817] (-1279.461) (-1278.878) (-1283.746) -- 0:00:49
335000 -- (-1279.154) (-1279.486) (-1279.414) [-1278.597] * (-1277.471) (-1279.521) [-1281.048] (-1279.443) -- 0:00:49
Average standard deviation of split frequencies: 0.009821
335500 -- (-1279.950) (-1281.104) [-1280.878] (-1278.013) * (-1281.571) (-1282.352) [-1280.468] (-1277.509) -- 0:00:49
336000 -- (-1281.653) (-1277.284) (-1285.257) [-1277.998] * (-1279.767) (-1279.128) [-1278.189] (-1277.163) -- 0:00:49
336500 -- (-1279.611) [-1281.058] (-1278.746) (-1278.331) * (-1278.045) (-1278.549) [-1279.296] (-1278.049) -- 0:00:51
337000 -- (-1285.812) [-1277.734] (-1278.939) (-1278.845) * (-1281.509) (-1278.546) (-1281.082) [-1278.842] -- 0:00:51
337500 -- (-1279.916) [-1281.438] (-1279.805) (-1277.946) * (-1279.916) [-1281.041] (-1281.892) (-1279.437) -- 0:00:51
338000 -- (-1280.905) [-1281.144] (-1281.437) (-1280.963) * (-1279.377) (-1276.657) [-1279.148] (-1280.855) -- 0:00:50
338500 -- (-1278.497) (-1281.862) (-1280.099) [-1280.104] * [-1277.872] (-1278.059) (-1278.142) (-1279.225) -- 0:00:50
339000 -- (-1278.197) (-1278.465) (-1282.606) [-1280.430] * (-1277.145) [-1278.526] (-1278.958) (-1280.645) -- 0:00:50
339500 -- (-1277.632) (-1280.549) [-1278.469] (-1279.757) * [-1280.698] (-1279.268) (-1283.100) (-1277.950) -- 0:00:50
340000 -- (-1278.078) (-1282.998) (-1279.142) [-1279.257] * (-1278.397) (-1278.552) (-1279.843) [-1283.297] -- 0:00:50
Average standard deviation of split frequencies: 0.010123
340500 -- [-1278.717] (-1278.331) (-1278.837) (-1280.618) * (-1277.740) (-1278.527) [-1281.901] (-1280.817) -- 0:00:50
341000 -- (-1279.020) (-1280.918) [-1278.497] (-1278.536) * [-1278.172] (-1278.091) (-1282.868) (-1280.379) -- 0:00:50
341500 -- (-1278.910) (-1281.882) [-1277.999] (-1278.734) * (-1279.285) (-1280.106) (-1278.097) [-1279.955] -- 0:00:50
342000 -- (-1279.813) (-1282.026) [-1278.102] (-1277.766) * (-1279.205) [-1278.737] (-1280.375) (-1279.923) -- 0:00:50
342500 -- [-1277.622] (-1283.888) (-1278.624) (-1279.290) * [-1278.676] (-1282.592) (-1281.055) (-1279.070) -- 0:00:49
343000 -- (-1280.341) (-1282.167) (-1276.483) [-1278.918] * [-1279.628] (-1281.546) (-1278.661) (-1279.620) -- 0:00:49
343500 -- (-1280.860) (-1278.456) [-1277.465] (-1280.422) * (-1279.257) (-1278.427) (-1278.626) [-1278.026] -- 0:00:49
344000 -- (-1278.309) (-1277.743) [-1277.619] (-1281.958) * (-1276.637) (-1278.409) [-1279.129] (-1281.746) -- 0:00:49
344500 -- (-1283.011) (-1277.278) [-1277.478] (-1279.661) * [-1281.016] (-1278.664) (-1277.852) (-1282.435) -- 0:00:49
345000 -- (-1280.689) (-1278.430) [-1279.385] (-1279.318) * (-1279.284) (-1278.320) [-1279.633] (-1280.572) -- 0:00:49
Average standard deviation of split frequencies: 0.011330
345500 -- (-1280.059) (-1277.246) [-1282.206] (-1276.291) * (-1280.728) (-1279.238) [-1280.674] (-1280.570) -- 0:00:49
346000 -- (-1279.869) [-1279.234] (-1279.680) (-1279.939) * (-1279.016) [-1277.711] (-1281.393) (-1280.216) -- 0:00:49
346500 -- (-1278.575) [-1280.026] (-1279.546) (-1279.978) * (-1280.715) (-1279.718) (-1280.785) [-1278.226] -- 0:00:49
347000 -- (-1277.708) [-1278.282] (-1279.255) (-1278.966) * (-1277.748) (-1281.855) (-1279.904) [-1277.982] -- 0:00:48
347500 -- [-1279.554] (-1278.555) (-1280.088) (-1280.710) * (-1278.866) [-1279.628] (-1278.296) (-1282.162) -- 0:00:50
348000 -- (-1279.794) (-1278.373) (-1281.762) [-1279.951] * (-1280.219) [-1277.875] (-1278.757) (-1279.788) -- 0:00:50
348500 -- (-1277.618) (-1280.996) [-1280.256] (-1278.201) * [-1279.875] (-1277.999) (-1277.826) (-1280.560) -- 0:00:50
349000 -- (-1278.165) (-1280.242) (-1280.202) [-1281.090] * (-1278.896) [-1274.852] (-1277.866) (-1282.082) -- 0:00:50
349500 -- (-1279.494) (-1281.229) (-1279.596) [-1282.398] * (-1280.887) (-1276.092) [-1277.217] (-1281.119) -- 0:00:50
350000 -- [-1279.041] (-1278.932) (-1280.258) (-1281.837) * (-1280.302) [-1278.723] (-1277.920) (-1282.369) -- 0:00:50
Average standard deviation of split frequencies: 0.011887
350500 -- (-1278.349) (-1280.650) (-1279.820) [-1280.129] * (-1279.129) [-1278.485] (-1280.327) (-1281.531) -- 0:00:50
351000 -- (-1279.940) [-1278.773] (-1278.278) (-1278.239) * (-1279.919) (-1279.793) (-1281.011) [-1279.039] -- 0:00:49
351500 -- (-1277.088) [-1279.304] (-1278.842) (-1279.614) * (-1278.371) (-1278.447) [-1277.443] (-1283.635) -- 0:00:49
352000 -- (-1282.610) (-1284.281) (-1278.372) [-1278.548] * (-1277.863) (-1281.501) [-1279.406] (-1281.696) -- 0:00:49
352500 -- [-1278.976] (-1278.569) (-1281.803) (-1280.245) * (-1278.414) (-1283.989) (-1277.019) [-1281.692] -- 0:00:49
353000 -- (-1278.889) (-1281.242) [-1278.283] (-1279.355) * (-1281.897) (-1277.197) (-1276.251) [-1279.762] -- 0:00:49
353500 -- (-1278.713) (-1277.482) [-1276.297] (-1280.045) * (-1279.838) (-1281.071) [-1277.407] (-1280.082) -- 0:00:49
354000 -- [-1281.105] (-1278.258) (-1279.036) (-1278.256) * (-1279.467) [-1280.650] (-1277.953) (-1279.131) -- 0:00:49
354500 -- (-1279.226) (-1278.001) [-1276.944] (-1278.946) * (-1279.204) (-1279.782) (-1277.536) [-1280.661] -- 0:00:49
355000 -- (-1278.737) (-1279.014) [-1277.314] (-1280.127) * [-1276.271] (-1277.107) (-1278.165) (-1280.246) -- 0:00:49
Average standard deviation of split frequencies: 0.012475
355500 -- (-1279.484) [-1279.509] (-1277.046) (-1278.355) * [-1278.414] (-1278.508) (-1283.495) (-1278.506) -- 0:00:48
356000 -- [-1278.785] (-1277.882) (-1279.789) (-1278.374) * [-1276.926] (-1277.711) (-1278.237) (-1280.504) -- 0:00:48
356500 -- [-1277.882] (-1278.374) (-1278.679) (-1277.651) * (-1282.177) (-1276.388) (-1279.884) [-1278.024] -- 0:00:48
357000 -- [-1278.410] (-1280.735) (-1279.648) (-1279.567) * (-1277.622) [-1276.960] (-1279.191) (-1277.657) -- 0:00:48
357500 -- (-1279.576) [-1278.150] (-1279.841) (-1280.300) * [-1276.900] (-1276.622) (-1281.529) (-1278.900) -- 0:00:48
358000 -- (-1279.487) (-1278.410) [-1281.159] (-1281.155) * [-1279.140] (-1277.491) (-1281.844) (-1279.178) -- 0:00:48
358500 -- [-1278.522] (-1278.411) (-1280.395) (-1276.342) * (-1280.164) [-1277.176] (-1280.730) (-1278.764) -- 0:00:48
359000 -- (-1281.525) (-1277.741) [-1278.844] (-1281.280) * (-1277.339) [-1279.715] (-1283.560) (-1281.618) -- 0:00:48
359500 -- [-1277.408] (-1279.809) (-1279.581) (-1279.030) * (-1276.754) (-1280.428) [-1279.332] (-1279.596) -- 0:00:48
360000 -- (-1278.313) [-1278.094] (-1281.904) (-1279.135) * (-1279.786) (-1279.143) [-1277.470] (-1278.457) -- 0:00:49
Average standard deviation of split frequencies: 0.013483
360500 -- [-1278.785] (-1275.694) (-1281.158) (-1279.353) * (-1280.688) (-1281.368) [-1280.457] (-1283.382) -- 0:00:49
361000 -- [-1277.864] (-1278.595) (-1279.470) (-1278.462) * [-1281.380] (-1282.445) (-1278.300) (-1277.927) -- 0:00:49
361500 -- [-1284.098] (-1280.323) (-1276.977) (-1277.798) * (-1278.629) [-1276.820] (-1281.054) (-1279.604) -- 0:00:49
362000 -- [-1278.000] (-1278.862) (-1278.840) (-1278.196) * [-1280.080] (-1281.252) (-1279.686) (-1279.116) -- 0:00:49
362500 -- [-1277.934] (-1282.689) (-1277.974) (-1283.396) * (-1277.399) [-1279.165] (-1280.905) (-1280.390) -- 0:00:49
363000 -- (-1278.128) (-1281.188) [-1276.969] (-1279.493) * (-1281.127) [-1278.472] (-1281.360) (-1280.068) -- 0:00:49
363500 -- [-1278.312] (-1280.030) (-1279.570) (-1279.718) * (-1278.756) [-1277.813] (-1278.810) (-1277.996) -- 0:00:49
364000 -- (-1278.231) (-1279.117) [-1277.725] (-1280.134) * (-1278.101) (-1280.034) [-1278.155] (-1278.986) -- 0:00:48
364500 -- (-1279.806) (-1282.083) [-1277.917] (-1281.739) * (-1277.728) [-1280.392] (-1279.830) (-1279.338) -- 0:00:48
365000 -- [-1280.384] (-1282.770) (-1281.480) (-1278.279) * (-1277.969) (-1277.378) (-1279.006) [-1278.787] -- 0:00:48
Average standard deviation of split frequencies: 0.012405
365500 -- (-1279.313) (-1281.771) [-1278.736] (-1279.489) * [-1278.976] (-1276.603) (-1277.781) (-1279.110) -- 0:00:48
366000 -- (-1279.848) (-1278.315) [-1277.152] (-1278.846) * (-1280.895) [-1277.141] (-1279.173) (-1281.166) -- 0:00:48
366500 -- (-1287.221) [-1281.691] (-1277.470) (-1277.323) * (-1279.207) [-1278.008] (-1278.971) (-1277.961) -- 0:00:48
367000 -- (-1280.641) (-1279.918) (-1277.848) [-1277.380] * (-1278.511) (-1279.080) [-1278.822] (-1278.137) -- 0:00:48
367500 -- (-1286.029) (-1279.069) (-1278.896) [-1280.096] * (-1278.047) (-1278.970) (-1279.080) [-1280.406] -- 0:00:48
368000 -- (-1285.479) (-1280.927) (-1277.005) [-1280.239] * (-1276.645) (-1277.855) [-1277.939] (-1278.266) -- 0:00:48
368500 -- (-1278.344) (-1279.463) [-1277.603] (-1278.457) * (-1277.779) (-1279.559) [-1278.881] (-1278.322) -- 0:00:47
369000 -- (-1277.746) (-1278.771) [-1278.214] (-1277.151) * (-1277.554) [-1278.591] (-1279.314) (-1279.760) -- 0:00:47
369500 -- (-1279.026) [-1277.993] (-1278.213) (-1279.788) * (-1281.259) (-1278.332) (-1279.534) [-1279.353] -- 0:00:47
370000 -- [-1278.628] (-1279.658) (-1282.146) (-1282.296) * (-1279.587) [-1277.659] (-1280.183) (-1280.200) -- 0:00:47
Average standard deviation of split frequencies: 0.012048
370500 -- (-1278.463) [-1279.079] (-1277.502) (-1279.648) * (-1276.779) (-1280.222) (-1279.653) [-1278.914] -- 0:00:47
371000 -- (-1277.324) [-1279.059] (-1276.338) (-1279.120) * (-1277.096) (-1280.208) (-1281.253) [-1278.638] -- 0:00:47
371500 -- (-1280.387) (-1281.385) (-1278.623) [-1278.063] * (-1282.450) (-1278.080) (-1279.674) [-1278.373] -- 0:00:47
372000 -- [-1278.561] (-1282.248) (-1277.510) (-1279.564) * (-1282.102) (-1278.207) (-1280.160) [-1279.453] -- 0:00:47
372500 -- [-1280.857] (-1278.739) (-1278.342) (-1280.049) * (-1278.622) [-1277.478] (-1280.049) (-1279.792) -- 0:00:47
373000 -- [-1280.681] (-1277.835) (-1279.125) (-1279.694) * (-1279.458) [-1278.586] (-1280.265) (-1279.696) -- 0:00:47
373500 -- (-1278.637) (-1279.698) [-1279.692] (-1279.921) * (-1278.774) (-1277.655) [-1279.157] (-1279.457) -- 0:00:46
374000 -- [-1278.480] (-1277.988) (-1284.103) (-1281.251) * (-1282.230) (-1277.040) (-1280.987) [-1279.442] -- 0:00:48
374500 -- (-1278.545) (-1278.154) (-1281.702) [-1278.848] * (-1277.804) [-1278.096] (-1278.714) (-1277.745) -- 0:00:48
375000 -- (-1280.496) (-1277.908) (-1280.416) [-1277.070] * (-1278.082) (-1277.451) [-1282.071] (-1278.827) -- 0:00:48
Average standard deviation of split frequencies: 0.011614
375500 -- (-1277.656) (-1278.306) [-1276.020] (-1281.713) * [-1277.646] (-1278.430) (-1282.126) (-1277.994) -- 0:00:48
376000 -- (-1278.055) [-1278.675] (-1278.884) (-1280.821) * [-1279.756] (-1279.339) (-1281.971) (-1278.752) -- 0:00:48
376500 -- (-1278.197) (-1281.721) (-1277.769) [-1280.442] * (-1280.299) [-1280.878] (-1280.382) (-1278.195) -- 0:00:48
377000 -- (-1277.939) (-1278.454) [-1279.060] (-1277.255) * (-1278.127) (-1281.601) [-1278.133] (-1276.406) -- 0:00:47
377500 -- (-1278.268) (-1278.662) (-1281.012) [-1280.439] * (-1278.486) [-1280.105] (-1283.482) (-1280.083) -- 0:00:47
378000 -- (-1281.544) (-1280.678) (-1277.452) [-1276.930] * [-1278.917] (-1279.705) (-1280.296) (-1278.520) -- 0:00:47
378500 -- (-1277.787) (-1280.572) (-1278.323) [-1275.761] * [-1280.173] (-1278.181) (-1278.422) (-1279.675) -- 0:00:47
379000 -- (-1278.020) (-1279.323) (-1278.762) [-1278.602] * (-1285.317) [-1277.897] (-1281.717) (-1280.303) -- 0:00:47
379500 -- (-1278.374) (-1277.935) (-1277.559) [-1277.490] * (-1279.454) (-1279.392) [-1277.506] (-1279.559) -- 0:00:47
380000 -- (-1276.872) (-1279.007) (-1277.498) [-1278.856] * [-1278.634] (-1279.500) (-1278.154) (-1280.005) -- 0:00:47
Average standard deviation of split frequencies: 0.011602
380500 -- [-1278.560] (-1276.853) (-1277.440) (-1283.273) * (-1280.904) (-1280.636) (-1278.335) [-1283.454] -- 0:00:47
381000 -- (-1280.759) (-1275.721) [-1279.776] (-1283.007) * (-1282.106) [-1278.048] (-1278.797) (-1277.563) -- 0:00:47
381500 -- (-1277.924) [-1280.666] (-1282.008) (-1281.097) * (-1276.937) [-1280.394] (-1279.409) (-1278.882) -- 0:00:47
382000 -- (-1277.918) (-1278.869) [-1277.846] (-1278.577) * (-1279.816) (-1279.134) [-1275.679] (-1279.918) -- 0:00:46
382500 -- (-1278.765) (-1279.798) [-1278.970] (-1279.694) * (-1279.322) [-1278.755] (-1279.661) (-1279.083) -- 0:00:46
383000 -- (-1282.092) (-1277.583) (-1278.359) [-1277.742] * (-1279.538) [-1278.610] (-1278.490) (-1281.347) -- 0:00:46
383500 -- (-1279.137) (-1277.405) [-1279.767] (-1281.875) * (-1278.788) [-1278.745] (-1277.100) (-1282.351) -- 0:00:46
384000 -- (-1277.448) [-1279.041] (-1280.333) (-1282.850) * [-1278.242] (-1285.785) (-1279.067) (-1281.891) -- 0:00:46
384500 -- (-1278.191) (-1277.301) [-1276.665] (-1281.026) * (-1276.250) [-1278.210] (-1280.662) (-1280.928) -- 0:00:46
385000 -- (-1278.501) (-1279.344) [-1277.360] (-1278.497) * (-1278.678) [-1280.344] (-1281.965) (-1280.207) -- 0:00:46
Average standard deviation of split frequencies: 0.011313
385500 -- (-1278.283) (-1280.892) [-1278.252] (-1278.357) * (-1279.543) (-1279.858) [-1278.683] (-1278.968) -- 0:00:46
386000 -- [-1276.110] (-1277.979) (-1278.914) (-1278.194) * (-1280.133) [-1279.731] (-1277.738) (-1281.644) -- 0:00:47
386500 -- [-1279.920] (-1278.098) (-1278.109) (-1280.424) * [-1280.266] (-1277.209) (-1278.307) (-1277.366) -- 0:00:47
387000 -- [-1280.426] (-1278.641) (-1281.682) (-1277.757) * (-1276.902) (-1278.221) (-1278.822) [-1276.502] -- 0:00:47
387500 -- (-1281.202) [-1279.757] (-1281.606) (-1279.789) * (-1277.838) (-1278.166) (-1278.465) [-1278.363] -- 0:00:47
388000 -- [-1277.976] (-1284.550) (-1279.081) (-1280.035) * [-1277.957] (-1277.670) (-1277.395) (-1279.840) -- 0:00:47
388500 -- (-1277.778) [-1279.968] (-1278.156) (-1279.182) * (-1277.736) [-1278.098] (-1279.352) (-1279.517) -- 0:00:47
389000 -- (-1277.475) [-1277.916] (-1280.267) (-1280.775) * (-1278.462) (-1281.037) (-1278.415) [-1278.283] -- 0:00:47
389500 -- (-1279.340) [-1277.546] (-1278.456) (-1279.907) * [-1278.368] (-1281.886) (-1277.233) (-1280.114) -- 0:00:47
390000 -- [-1278.835] (-1280.111) (-1278.316) (-1279.832) * (-1278.053) [-1279.695] (-1280.503) (-1279.011) -- 0:00:46
Average standard deviation of split frequencies: 0.013019
390500 -- [-1279.639] (-1280.692) (-1277.825) (-1279.428) * (-1280.723) (-1276.758) [-1278.955] (-1279.636) -- 0:00:46
391000 -- (-1281.614) (-1280.171) [-1276.960] (-1279.372) * (-1277.976) [-1278.523] (-1279.033) (-1278.733) -- 0:00:46
391500 -- [-1278.035] (-1277.818) (-1282.125) (-1278.864) * (-1279.128) (-1279.364) [-1277.774] (-1278.834) -- 0:00:46
392000 -- (-1278.813) (-1285.394) (-1280.266) [-1278.177] * [-1280.041] (-1281.117) (-1279.527) (-1278.567) -- 0:00:46
392500 -- (-1278.448) [-1279.445] (-1278.453) (-1278.683) * [-1277.074] (-1281.518) (-1279.672) (-1279.502) -- 0:00:46
393000 -- (-1278.018) (-1280.934) (-1281.462) [-1277.932] * (-1278.136) [-1277.219] (-1279.315) (-1278.997) -- 0:00:46
393500 -- [-1277.474] (-1280.029) (-1279.506) (-1277.308) * [-1278.255] (-1281.403) (-1277.541) (-1277.607) -- 0:00:46
394000 -- (-1278.519) (-1278.836) (-1281.166) [-1279.428] * (-1280.145) (-1282.468) (-1277.534) [-1277.810] -- 0:00:46
394500 -- [-1279.493] (-1279.064) (-1281.233) (-1279.232) * (-1278.857) (-1278.191) (-1283.302) [-1277.646] -- 0:00:46
395000 -- (-1280.969) [-1280.577] (-1281.049) (-1278.593) * [-1278.622] (-1279.704) (-1282.625) (-1279.661) -- 0:00:45
Average standard deviation of split frequencies: 0.012593
395500 -- (-1283.602) [-1278.570] (-1278.198) (-1278.193) * [-1277.102] (-1277.779) (-1283.174) (-1280.634) -- 0:00:45
396000 -- (-1279.427) (-1284.561) (-1283.598) [-1277.941] * (-1279.525) (-1277.881) [-1277.968] (-1276.123) -- 0:00:45
396500 -- (-1280.594) [-1279.919] (-1283.521) (-1280.765) * (-1280.273) [-1278.975] (-1278.141) (-1279.316) -- 0:00:45
397000 -- [-1279.255] (-1281.245) (-1276.470) (-1280.264) * (-1279.431) (-1281.517) [-1279.069] (-1281.281) -- 0:00:45
397500 -- (-1282.548) (-1278.133) (-1278.687) [-1280.866] * [-1277.786] (-1279.200) (-1277.914) (-1278.203) -- 0:00:45
398000 -- (-1278.624) [-1280.986] (-1275.349) (-1277.617) * (-1279.111) [-1278.172] (-1280.343) (-1278.552) -- 0:00:45
398500 -- (-1277.493) (-1280.010) [-1278.496] (-1278.841) * (-1279.174) [-1279.300] (-1277.070) (-1278.363) -- 0:00:45
399000 -- (-1285.272) (-1281.399) [-1279.277] (-1278.642) * (-1281.999) (-1279.171) (-1278.767) [-1277.420] -- 0:00:45
399500 -- (-1279.688) [-1280.964] (-1284.449) (-1278.057) * (-1281.764) [-1279.374] (-1278.922) (-1277.941) -- 0:00:46
400000 -- (-1278.446) (-1283.869) (-1279.558) [-1279.711] * (-1284.097) (-1280.551) (-1280.769) [-1277.893] -- 0:00:46
Average standard deviation of split frequencies: 0.012632
400500 -- [-1277.535] (-1278.613) (-1277.906) (-1278.823) * (-1281.675) [-1278.700] (-1276.218) (-1279.938) -- 0:00:46
401000 -- (-1278.680) (-1278.270) (-1277.823) [-1279.570] * (-1283.417) [-1278.931] (-1277.944) (-1280.409) -- 0:00:46
401500 -- (-1279.935) [-1283.385] (-1277.663) (-1279.889) * (-1279.351) (-1278.903) [-1279.814] (-1279.417) -- 0:00:46
402000 -- (-1280.866) [-1278.173] (-1278.154) (-1280.193) * (-1277.417) (-1279.435) (-1286.748) [-1278.689] -- 0:00:46
402500 -- (-1278.526) (-1282.653) (-1282.836) [-1278.964] * (-1279.869) (-1279.110) (-1276.126) [-1277.277] -- 0:00:46
403000 -- (-1278.706) (-1277.851) (-1277.020) [-1279.271] * (-1278.635) (-1278.415) [-1275.248] (-1279.317) -- 0:00:45
403500 -- (-1279.919) [-1278.181] (-1277.811) (-1281.198) * (-1278.196) [-1278.518] (-1276.442) (-1275.910) -- 0:00:45
404000 -- (-1277.519) [-1279.556] (-1277.740) (-1280.433) * (-1278.751) (-1283.197) (-1286.246) [-1277.561] -- 0:00:45
404500 -- [-1279.411] (-1281.169) (-1277.981) (-1278.803) * (-1279.333) (-1278.750) (-1286.284) [-1277.200] -- 0:00:45
405000 -- [-1277.500] (-1276.824) (-1280.547) (-1278.679) * (-1277.737) [-1281.551] (-1278.103) (-1280.474) -- 0:00:45
Average standard deviation of split frequencies: 0.012833
405500 -- (-1277.950) (-1278.378) (-1280.265) [-1278.400] * (-1278.251) [-1279.160] (-1280.607) (-1278.755) -- 0:00:45
406000 -- (-1276.782) [-1276.866] (-1278.372) (-1277.639) * (-1278.350) (-1278.013) [-1276.581] (-1281.398) -- 0:00:45
406500 -- [-1279.499] (-1280.219) (-1279.801) (-1278.835) * (-1281.438) (-1277.742) [-1278.584] (-1283.718) -- 0:00:45
407000 -- [-1278.434] (-1280.262) (-1279.709) (-1281.764) * (-1279.395) (-1278.264) (-1278.686) [-1278.766] -- 0:00:45
407500 -- (-1277.927) (-1277.620) (-1281.487) [-1279.829] * [-1277.599] (-1277.627) (-1277.994) (-1278.035) -- 0:00:45
408000 -- [-1280.082] (-1281.820) (-1277.225) (-1278.864) * (-1279.203) (-1281.993) (-1279.215) [-1279.521] -- 0:00:44
408500 -- (-1278.900) (-1279.523) (-1279.808) [-1279.937] * (-1279.518) (-1281.804) [-1275.897] (-1279.609) -- 0:00:44
409000 -- (-1278.339) (-1278.409) (-1277.990) [-1280.440] * (-1279.029) (-1281.541) [-1277.841] (-1280.393) -- 0:00:44
409500 -- (-1279.383) (-1279.400) (-1279.550) [-1278.673] * (-1278.634) (-1279.303) (-1278.706) [-1280.459] -- 0:00:44
410000 -- (-1278.915) [-1280.376] (-1280.150) (-1281.341) * (-1277.608) (-1280.096) (-1278.391) [-1280.294] -- 0:00:44
Average standard deviation of split frequencies: 0.012083
410500 -- (-1278.101) (-1279.406) (-1278.450) [-1280.141] * (-1279.444) [-1275.702] (-1283.132) (-1282.706) -- 0:00:44
411000 -- (-1281.725) (-1280.670) (-1280.258) [-1280.500] * [-1282.189] (-1278.619) (-1282.192) (-1282.011) -- 0:00:44
411500 -- [-1280.562] (-1278.102) (-1281.084) (-1280.287) * (-1279.557) (-1278.354) [-1280.627] (-1284.537) -- 0:00:44
412000 -- (-1279.590) [-1278.422] (-1279.684) (-1282.810) * [-1278.254] (-1277.564) (-1279.498) (-1282.262) -- 0:00:44
412500 -- (-1280.681) [-1276.674] (-1279.317) (-1278.043) * (-1279.469) [-1278.390] (-1279.571) (-1278.389) -- 0:00:45
413000 -- (-1278.096) (-1277.534) (-1281.769) [-1278.074] * (-1278.505) (-1281.251) [-1278.972] (-1277.975) -- 0:00:45
413500 -- [-1278.594] (-1277.550) (-1276.414) (-1275.402) * [-1278.362] (-1284.585) (-1280.185) (-1278.416) -- 0:00:45
414000 -- [-1277.194] (-1279.550) (-1280.988) (-1278.998) * (-1278.120) [-1278.748] (-1282.391) (-1282.336) -- 0:00:45
414500 -- (-1279.074) [-1278.404] (-1276.584) (-1283.654) * (-1277.066) (-1280.559) [-1282.341] (-1278.069) -- 0:00:45
415000 -- [-1279.409] (-1276.926) (-1283.378) (-1276.774) * (-1278.085) (-1279.447) [-1281.107] (-1278.166) -- 0:00:45
Average standard deviation of split frequencies: 0.012525
415500 -- (-1281.582) [-1277.432] (-1278.516) (-1278.083) * [-1278.064] (-1280.285) (-1277.720) (-1279.153) -- 0:00:45
416000 -- [-1280.013] (-1279.141) (-1280.721) (-1277.179) * [-1278.976] (-1278.513) (-1282.944) (-1279.098) -- 0:00:44
416500 -- (-1279.698) (-1277.923) [-1277.122] (-1277.155) * (-1281.203) [-1280.728] (-1278.032) (-1278.776) -- 0:00:44
417000 -- (-1281.567) (-1278.491) (-1282.430) [-1277.313] * [-1281.766] (-1280.926) (-1276.368) (-1280.245) -- 0:00:44
417500 -- [-1280.961] (-1285.662) (-1282.168) (-1280.696) * (-1282.017) [-1277.008] (-1280.293) (-1279.338) -- 0:00:44
418000 -- [-1280.153] (-1282.222) (-1277.183) (-1279.618) * (-1280.541) (-1278.347) [-1281.317] (-1279.298) -- 0:00:44
418500 -- (-1279.924) (-1278.387) (-1277.694) [-1275.801] * (-1279.001) (-1277.992) [-1278.625] (-1277.141) -- 0:00:44
419000 -- (-1282.768) (-1279.172) [-1277.348] (-1277.691) * (-1278.244) (-1279.288) [-1279.375] (-1278.339) -- 0:00:44
419500 -- [-1278.271] (-1279.481) (-1277.922) (-1280.000) * (-1277.421) (-1277.509) [-1280.258] (-1281.785) -- 0:00:44
420000 -- (-1278.105) (-1278.434) [-1277.796] (-1281.183) * (-1277.365) (-1277.580) (-1283.721) [-1279.148] -- 0:00:44
Average standard deviation of split frequencies: 0.012445
420500 -- (-1277.037) [-1278.110] (-1279.064) (-1279.271) * [-1278.970] (-1278.328) (-1279.603) (-1278.807) -- 0:00:44
421000 -- (-1278.932) (-1280.192) [-1278.291] (-1279.888) * [-1278.358] (-1278.627) (-1278.623) (-1281.090) -- 0:00:44
421500 -- (-1279.197) [-1279.849] (-1278.356) (-1279.253) * [-1281.556] (-1281.119) (-1280.906) (-1279.022) -- 0:00:43
422000 -- [-1275.706] (-1278.686) (-1280.532) (-1283.507) * (-1278.848) [-1279.578] (-1281.832) (-1278.875) -- 0:00:43
422500 -- [-1279.304] (-1279.791) (-1281.176) (-1279.673) * (-1277.817) [-1280.030] (-1282.673) (-1277.355) -- 0:00:43
423000 -- [-1282.942] (-1279.153) (-1280.599) (-1279.280) * (-1278.615) [-1279.804] (-1279.278) (-1279.130) -- 0:00:43
423500 -- (-1280.214) (-1278.210) (-1279.913) [-1279.809] * (-1281.506) (-1279.783) [-1279.335] (-1281.651) -- 0:00:43
424000 -- [-1281.525] (-1278.955) (-1278.562) (-1278.555) * (-1278.073) [-1279.151] (-1277.033) (-1280.383) -- 0:00:43
424500 -- (-1279.378) (-1283.514) [-1279.744] (-1278.463) * [-1280.799] (-1278.968) (-1278.092) (-1278.957) -- 0:00:43
425000 -- (-1278.379) [-1280.458] (-1281.546) (-1280.382) * (-1276.855) (-1281.209) (-1278.424) [-1276.215] -- 0:00:43
Average standard deviation of split frequencies: 0.012114
425500 -- (-1278.204) [-1278.598] (-1279.806) (-1278.331) * (-1276.784) [-1277.719] (-1285.131) (-1281.068) -- 0:00:43
426000 -- (-1278.768) (-1279.791) (-1278.836) [-1278.743] * [-1276.973] (-1278.554) (-1285.525) (-1281.527) -- 0:00:43
426500 -- (-1281.142) (-1279.588) [-1278.395] (-1279.658) * (-1279.248) (-1280.146) [-1276.665] (-1282.307) -- 0:00:44
427000 -- (-1279.158) [-1278.479] (-1278.851) (-1278.180) * (-1278.271) (-1281.141) (-1281.960) [-1278.847] -- 0:00:44
427500 -- (-1277.798) (-1278.791) (-1279.495) [-1278.166] * [-1276.664] (-1279.617) (-1287.871) (-1281.703) -- 0:00:44
428000 -- [-1277.355] (-1275.109) (-1280.874) (-1279.049) * [-1279.332] (-1278.095) (-1278.552) (-1277.386) -- 0:00:44
428500 -- (-1279.934) (-1279.426) (-1279.017) [-1278.960] * [-1278.495] (-1278.264) (-1279.761) (-1280.761) -- 0:00:44
429000 -- [-1278.687] (-1279.105) (-1283.307) (-1278.995) * [-1278.291] (-1276.947) (-1280.067) (-1285.438) -- 0:00:43
429500 -- [-1275.644] (-1284.653) (-1279.180) (-1278.118) * (-1280.736) (-1278.146) [-1278.089] (-1286.716) -- 0:00:43
430000 -- (-1276.702) (-1284.371) (-1279.678) [-1277.293] * (-1278.387) (-1279.483) [-1278.275] (-1279.546) -- 0:00:43
Average standard deviation of split frequencies: 0.011810
430500 -- (-1283.031) (-1277.630) (-1281.954) [-1278.942] * [-1280.420] (-1282.160) (-1278.787) (-1279.906) -- 0:00:43
431000 -- (-1279.620) [-1278.888] (-1279.777) (-1279.867) * [-1278.424] (-1277.448) (-1281.080) (-1279.956) -- 0:00:43
431500 -- (-1281.448) (-1279.166) (-1279.553) [-1280.053] * [-1278.469] (-1277.870) (-1280.533) (-1277.048) -- 0:00:43
432000 -- (-1277.471) (-1279.106) [-1279.310] (-1278.090) * (-1281.847) (-1277.518) [-1281.005] (-1278.452) -- 0:00:43
432500 -- (-1278.655) (-1277.993) [-1279.550] (-1280.131) * (-1279.280) [-1278.103] (-1279.141) (-1279.018) -- 0:00:43
433000 -- (-1279.405) (-1279.481) [-1278.028] (-1277.661) * (-1279.773) [-1277.912] (-1279.506) (-1279.391) -- 0:00:43
433500 -- (-1279.262) [-1278.431] (-1280.024) (-1280.697) * (-1278.654) [-1279.056] (-1281.546) (-1278.778) -- 0:00:43
434000 -- (-1277.080) (-1279.538) [-1281.118] (-1278.170) * (-1279.625) (-1279.405) (-1280.238) [-1280.511] -- 0:00:43
434500 -- (-1278.319) [-1280.642] (-1279.025) (-1278.341) * (-1278.269) (-1280.036) [-1278.726] (-1277.118) -- 0:00:42
435000 -- (-1279.303) (-1278.480) [-1277.736] (-1277.779) * (-1281.496) (-1279.019) [-1278.571] (-1286.095) -- 0:00:42
Average standard deviation of split frequencies: 0.011666
435500 -- (-1279.488) [-1282.849] (-1277.405) (-1278.892) * (-1277.876) [-1277.438] (-1278.148) (-1280.555) -- 0:00:42
436000 -- (-1277.042) (-1277.450) [-1279.223] (-1280.992) * (-1279.357) (-1277.782) [-1276.923] (-1281.393) -- 0:00:42
436500 -- (-1277.609) (-1281.096) [-1279.074] (-1279.382) * (-1278.449) (-1278.595) [-1280.309] (-1276.705) -- 0:00:42
437000 -- [-1279.805] (-1279.654) (-1277.520) (-1277.537) * (-1277.651) (-1277.043) (-1279.477) [-1277.365] -- 0:00:42
437500 -- [-1277.668] (-1278.507) (-1278.515) (-1282.587) * (-1281.108) [-1280.119] (-1280.159) (-1281.541) -- 0:00:42
438000 -- (-1279.186) (-1277.825) [-1278.420] (-1277.075) * (-1280.143) (-1280.070) (-1283.581) [-1279.313] -- 0:00:42
438500 -- (-1280.584) (-1277.878) (-1282.651) [-1278.099] * (-1279.708) (-1282.414) (-1277.412) [-1277.207] -- 0:00:42
439000 -- (-1280.139) [-1278.937] (-1278.466) (-1277.261) * (-1279.590) [-1280.632] (-1281.836) (-1278.276) -- 0:00:42
439500 -- (-1279.867) (-1282.022) [-1278.743] (-1282.597) * (-1278.795) (-1280.068) [-1279.456] (-1275.641) -- 0:00:42
440000 -- (-1278.968) (-1279.873) (-1282.874) [-1280.373] * [-1280.083] (-1280.211) (-1285.249) (-1277.326) -- 0:00:41
Average standard deviation of split frequencies: 0.012161
440500 -- (-1277.621) (-1278.450) (-1279.804) [-1279.349] * [-1279.908] (-1279.554) (-1279.978) (-1277.916) -- 0:00:41
441000 -- (-1279.449) (-1279.653) (-1281.310) [-1277.847] * (-1278.599) [-1279.012] (-1280.671) (-1279.593) -- 0:00:43
441500 -- (-1277.868) (-1279.460) [-1277.467] (-1280.934) * (-1280.275) (-1276.357) [-1278.752] (-1277.917) -- 0:00:43
442000 -- (-1279.801) (-1279.350) (-1277.560) [-1277.152] * (-1278.777) (-1278.439) (-1277.687) [-1276.756] -- 0:00:42
442500 -- [-1281.087] (-1277.895) (-1276.804) (-1277.999) * (-1279.964) (-1278.680) [-1279.369] (-1284.112) -- 0:00:42
443000 -- (-1280.658) (-1278.484) (-1281.636) [-1278.907] * (-1277.333) [-1277.745] (-1279.323) (-1279.601) -- 0:00:42
443500 -- [-1276.286] (-1282.717) (-1279.390) (-1279.266) * (-1277.998) (-1279.303) (-1278.777) [-1278.485] -- 0:00:42
444000 -- (-1279.001) [-1279.835] (-1277.984) (-1279.026) * [-1276.138] (-1280.962) (-1277.022) (-1282.746) -- 0:00:42
444500 -- (-1276.179) (-1278.117) (-1280.940) [-1279.720] * [-1281.667] (-1277.992) (-1279.769) (-1280.362) -- 0:00:42
445000 -- (-1279.458) (-1283.428) [-1281.124] (-1278.053) * (-1280.769) (-1278.007) (-1278.684) [-1278.972] -- 0:00:42
Average standard deviation of split frequencies: 0.011682
445500 -- (-1278.065) (-1282.518) [-1278.178] (-1279.259) * (-1281.013) [-1277.739] (-1279.488) (-1279.836) -- 0:00:42
446000 -- (-1278.683) (-1278.769) (-1279.556) [-1277.573] * [-1280.756] (-1278.797) (-1278.121) (-1279.676) -- 0:00:42
446500 -- (-1278.817) (-1279.631) (-1280.146) [-1277.376] * (-1278.970) [-1278.253] (-1281.317) (-1278.122) -- 0:00:42
447000 -- (-1280.327) (-1277.582) (-1278.554) [-1281.817] * (-1277.372) (-1280.441) (-1280.220) [-1281.611] -- 0:00:42
447500 -- (-1282.097) (-1279.731) [-1279.046] (-1284.298) * (-1279.818) [-1280.913] (-1280.152) (-1277.465) -- 0:00:41
448000 -- (-1281.904) (-1275.772) (-1279.561) [-1277.853] * (-1279.196) [-1278.170] (-1285.481) (-1278.325) -- 0:00:41
448500 -- (-1285.982) (-1278.383) [-1278.526] (-1278.213) * (-1277.545) (-1279.394) (-1277.422) [-1278.667] -- 0:00:41
449000 -- (-1279.495) [-1277.283] (-1279.485) (-1276.234) * (-1283.864) (-1279.085) [-1277.464] (-1278.726) -- 0:00:41
449500 -- [-1280.219] (-1278.094) (-1278.838) (-1277.405) * (-1279.129) (-1280.006) (-1283.839) [-1280.909] -- 0:00:41
450000 -- (-1279.967) (-1279.037) [-1283.642] (-1276.837) * (-1280.234) (-1280.024) (-1278.574) [-1280.220] -- 0:00:41
Average standard deviation of split frequencies: 0.011671
450500 -- [-1279.089] (-1278.613) (-1282.275) (-1279.031) * (-1279.736) [-1278.164] (-1277.831) (-1278.527) -- 0:00:41
451000 -- (-1281.807) (-1282.252) [-1278.770] (-1281.507) * [-1278.802] (-1283.311) (-1276.280) (-1278.767) -- 0:00:41
451500 -- (-1278.670) (-1279.245) (-1280.305) [-1278.719] * (-1281.489) (-1280.841) (-1277.529) [-1278.059] -- 0:00:41
452000 -- (-1278.698) [-1278.396] (-1278.744) (-1277.984) * (-1278.372) [-1278.508] (-1277.415) (-1281.058) -- 0:00:41
452500 -- (-1277.757) (-1278.824) [-1276.722] (-1279.410) * [-1280.463] (-1280.455) (-1277.685) (-1278.562) -- 0:00:41
453000 -- (-1279.106) (-1279.648) (-1280.612) [-1279.205] * (-1281.470) [-1279.838] (-1277.447) (-1279.546) -- 0:00:41
453500 -- (-1277.671) (-1281.123) (-1277.772) [-1277.752] * (-1278.730) (-1280.659) (-1281.722) [-1278.672] -- 0:00:40
454000 -- (-1281.921) (-1281.545) (-1278.049) [-1278.907] * (-1279.016) (-1278.682) [-1280.646] (-1277.558) -- 0:00:42
454500 -- (-1278.277) (-1280.841) (-1279.997) [-1278.672] * (-1281.259) (-1278.352) (-1278.591) [-1277.187] -- 0:00:42
455000 -- (-1278.272) [-1277.996] (-1279.098) (-1277.573) * (-1278.075) (-1278.623) [-1283.484] (-1278.172) -- 0:00:41
Average standard deviation of split frequencies: 0.011807
455500 -- (-1278.126) (-1279.454) [-1278.691] (-1279.534) * [-1278.077] (-1277.462) (-1277.571) (-1279.490) -- 0:00:41
456000 -- (-1277.448) [-1279.489] (-1278.689) (-1282.034) * (-1278.027) (-1277.837) (-1278.908) [-1281.360] -- 0:00:41
456500 -- (-1279.313) (-1278.357) (-1277.646) [-1282.102] * [-1277.907] (-1279.165) (-1279.210) (-1278.337) -- 0:00:41
457000 -- [-1280.783] (-1277.994) (-1281.906) (-1280.698) * (-1277.626) [-1278.701] (-1278.019) (-1280.716) -- 0:00:41
457500 -- [-1281.421] (-1278.823) (-1280.731) (-1279.566) * [-1278.153] (-1281.859) (-1279.326) (-1280.232) -- 0:00:41
458000 -- (-1282.581) [-1277.610] (-1279.007) (-1278.751) * (-1280.052) (-1280.567) (-1281.761) [-1278.440] -- 0:00:41
458500 -- (-1281.245) (-1277.890) (-1279.694) [-1277.753] * (-1280.287) [-1278.713] (-1277.839) (-1280.828) -- 0:00:41
459000 -- (-1281.353) (-1277.655) [-1280.506] (-1277.753) * (-1279.798) [-1277.984] (-1277.694) (-1277.458) -- 0:00:41
459500 -- [-1278.494] (-1278.212) (-1282.480) (-1279.191) * (-1278.034) (-1280.568) [-1277.568] (-1278.735) -- 0:00:41
460000 -- [-1279.864] (-1280.666) (-1276.316) (-1278.794) * [-1278.307] (-1278.244) (-1278.846) (-1277.923) -- 0:00:41
Average standard deviation of split frequencies: 0.011364
460500 -- (-1277.998) (-1283.291) [-1278.142] (-1278.986) * (-1282.163) (-1282.542) (-1278.495) [-1278.922] -- 0:00:41
461000 -- [-1280.912] (-1286.007) (-1277.366) (-1280.847) * [-1278.936] (-1282.344) (-1280.295) (-1278.342) -- 0:00:40
461500 -- (-1279.650) (-1280.741) (-1282.492) [-1279.634] * (-1284.268) (-1279.772) [-1279.512] (-1277.968) -- 0:00:40
462000 -- [-1277.945] (-1281.765) (-1285.872) (-1280.772) * (-1278.341) [-1279.015] (-1278.962) (-1277.762) -- 0:00:40
462500 -- [-1278.552] (-1283.696) (-1282.463) (-1280.587) * (-1277.344) [-1279.055] (-1278.331) (-1277.918) -- 0:00:40
463000 -- (-1279.426) (-1281.186) (-1280.038) [-1281.421] * (-1279.873) (-1279.369) (-1279.093) [-1282.194] -- 0:00:40
463500 -- [-1279.873] (-1281.190) (-1279.896) (-1279.285) * (-1284.722) [-1278.351] (-1284.653) (-1281.356) -- 0:00:40
464000 -- (-1280.614) [-1278.513] (-1276.059) (-1280.699) * (-1282.364) [-1277.566] (-1279.005) (-1280.700) -- 0:00:40
464500 -- (-1277.776) (-1278.542) (-1282.784) [-1280.877] * (-1284.665) (-1280.663) [-1277.593] (-1277.765) -- 0:00:40
465000 -- (-1277.688) [-1279.606] (-1279.182) (-1280.768) * [-1281.035] (-1278.820) (-1280.378) (-1277.118) -- 0:00:40
Average standard deviation of split frequencies: 0.011713
465500 -- [-1277.868] (-1278.062) (-1279.556) (-1280.430) * (-1286.454) (-1279.615) (-1285.293) [-1276.060] -- 0:00:40
466000 -- (-1278.836) [-1277.457] (-1277.860) (-1281.195) * [-1281.077] (-1277.988) (-1287.513) (-1278.095) -- 0:00:40
466500 -- (-1277.907) [-1277.725] (-1277.905) (-1278.628) * [-1280.186] (-1279.189) (-1278.032) (-1277.995) -- 0:00:40
467000 -- (-1277.591) (-1280.266) [-1278.383] (-1279.398) * (-1277.818) (-1279.732) (-1279.451) [-1279.801] -- 0:00:41
467500 -- (-1280.076) (-1282.337) [-1278.885] (-1277.820) * (-1278.339) [-1277.831] (-1278.194) (-1281.448) -- 0:00:41
468000 -- (-1278.554) (-1280.274) [-1278.490] (-1277.506) * [-1278.457] (-1278.043) (-1278.585) (-1281.682) -- 0:00:40
468500 -- (-1279.658) (-1279.811) (-1278.557) [-1277.532] * [-1278.981] (-1278.878) (-1281.088) (-1280.029) -- 0:00:40
469000 -- (-1282.041) (-1281.984) (-1279.215) [-1277.817] * (-1277.579) (-1281.485) [-1277.806] (-1282.272) -- 0:00:40
469500 -- (-1277.934) [-1278.689] (-1279.399) (-1278.372) * [-1279.756] (-1278.013) (-1278.261) (-1284.717) -- 0:00:40
470000 -- (-1280.306) [-1278.897] (-1279.179) (-1278.335) * (-1279.957) (-1279.431) [-1277.885] (-1278.322) -- 0:00:40
Average standard deviation of split frequencies: 0.011492
470500 -- [-1278.166] (-1276.180) (-1279.478) (-1278.839) * [-1280.750] (-1279.242) (-1278.258) (-1277.251) -- 0:00:40
471000 -- [-1277.588] (-1278.764) (-1281.121) (-1280.405) * (-1279.587) [-1279.505] (-1279.377) (-1278.401) -- 0:00:40
471500 -- (-1277.414) (-1279.001) (-1278.041) [-1279.769] * [-1279.581] (-1282.295) (-1280.401) (-1280.874) -- 0:00:40
472000 -- (-1277.714) [-1282.513] (-1277.957) (-1279.016) * (-1281.652) (-1278.927) [-1279.179] (-1279.855) -- 0:00:40
472500 -- (-1279.041) (-1278.833) [-1277.816] (-1280.416) * (-1279.094) (-1278.216) (-1277.752) [-1281.765] -- 0:00:40
473000 -- (-1280.009) (-1278.721) (-1277.580) [-1278.858] * (-1280.355) (-1284.747) [-1279.034] (-1278.096) -- 0:00:40
473500 -- (-1280.501) (-1281.375) [-1280.090] (-1279.774) * (-1281.612) (-1277.499) (-1280.852) [-1278.442] -- 0:00:40
474000 -- (-1279.083) (-1277.808) (-1278.483) [-1279.684] * [-1276.057] (-1277.949) (-1277.996) (-1280.023) -- 0:00:39
474500 -- (-1279.007) (-1281.298) [-1279.432] (-1278.874) * [-1282.025] (-1275.219) (-1279.647) (-1280.640) -- 0:00:39
475000 -- (-1278.816) (-1279.529) (-1278.384) [-1277.115] * [-1281.836] (-1278.836) (-1281.299) (-1279.093) -- 0:00:39
Average standard deviation of split frequencies: 0.011207
475500 -- [-1279.795] (-1277.618) (-1279.108) (-1278.630) * [-1278.785] (-1277.774) (-1278.986) (-1282.480) -- 0:00:39
476000 -- (-1282.634) (-1277.402) (-1279.877) [-1278.133] * [-1277.621] (-1279.315) (-1278.940) (-1279.745) -- 0:00:39
476500 -- (-1278.209) (-1279.147) [-1279.253] (-1279.600) * (-1277.927) [-1278.278] (-1277.626) (-1278.981) -- 0:00:39
477000 -- (-1277.763) [-1277.890] (-1278.036) (-1277.851) * (-1278.698) [-1279.239] (-1277.372) (-1278.267) -- 0:00:39
477500 -- (-1278.337) [-1283.668] (-1279.675) (-1280.913) * [-1278.208] (-1279.782) (-1278.071) (-1283.456) -- 0:00:39
478000 -- (-1278.457) (-1280.737) (-1276.621) [-1281.634] * [-1277.529] (-1278.399) (-1279.471) (-1281.201) -- 0:00:39
478500 -- (-1277.537) (-1277.999) [-1280.972] (-1278.882) * [-1277.333] (-1276.421) (-1277.841) (-1281.760) -- 0:00:39
479000 -- [-1278.888] (-1277.675) (-1279.091) (-1279.871) * (-1279.814) [-1277.168] (-1281.423) (-1281.100) -- 0:00:39
479500 -- (-1278.365) (-1279.255) (-1280.076) [-1279.447] * [-1278.060] (-1278.147) (-1279.658) (-1278.868) -- 0:00:39
480000 -- (-1278.628) (-1280.068) [-1279.404] (-1278.188) * (-1279.983) (-1282.946) (-1279.433) [-1279.288] -- 0:00:39
Average standard deviation of split frequencies: 0.011459
480500 -- [-1277.562] (-1278.376) (-1277.705) (-1281.299) * (-1280.856) (-1280.687) (-1282.024) [-1279.744] -- 0:00:38
481000 -- (-1278.223) (-1279.802) (-1276.433) [-1280.121] * (-1280.074) (-1278.919) [-1280.240] (-1284.296) -- 0:00:39
481500 -- (-1280.634) (-1278.570) [-1279.160] (-1278.381) * (-1279.860) (-1279.350) (-1278.671) [-1277.966] -- 0:00:39
482000 -- (-1278.739) (-1280.909) [-1278.250] (-1279.326) * (-1280.224) (-1279.098) (-1281.287) [-1280.547] -- 0:00:39
482500 -- [-1279.581] (-1277.822) (-1276.390) (-1282.970) * (-1280.413) (-1282.045) [-1277.459] (-1280.307) -- 0:00:39
483000 -- (-1279.403) [-1278.511] (-1278.312) (-1277.754) * (-1277.128) [-1279.206] (-1277.861) (-1279.646) -- 0:00:39
483500 -- (-1277.999) (-1280.158) [-1280.117] (-1280.784) * (-1278.441) [-1278.270] (-1276.387) (-1279.862) -- 0:00:39
484000 -- (-1282.200) (-1278.300) [-1277.477] (-1278.308) * (-1277.778) (-1279.184) (-1278.517) [-1279.269] -- 0:00:39
484500 -- (-1278.723) (-1279.224) (-1277.991) [-1278.796] * (-1278.487) (-1279.507) [-1283.742] (-1282.912) -- 0:00:39
485000 -- (-1278.169) (-1280.775) [-1279.473] (-1278.111) * [-1277.577] (-1277.825) (-1277.580) (-1280.541) -- 0:00:39
Average standard deviation of split frequencies: 0.011180
485500 -- (-1278.722) (-1280.957) [-1280.833] (-1277.855) * (-1279.991) (-1281.230) [-1279.229] (-1279.332) -- 0:00:39
486000 -- [-1278.969] (-1282.814) (-1280.551) (-1277.584) * (-1279.094) (-1278.893) [-1279.235] (-1276.932) -- 0:00:39
486500 -- [-1278.768] (-1279.209) (-1279.481) (-1275.092) * (-1279.561) (-1278.803) (-1281.541) [-1277.772] -- 0:00:39
487000 -- [-1279.887] (-1277.896) (-1279.140) (-1277.831) * [-1280.472] (-1279.580) (-1280.749) (-1282.074) -- 0:00:38
487500 -- [-1280.434] (-1280.817) (-1277.706) (-1278.206) * (-1282.551) (-1287.908) (-1277.605) [-1276.722] -- 0:00:38
488000 -- (-1281.709) (-1278.319) (-1277.562) [-1277.466] * [-1280.762] (-1288.394) (-1277.576) (-1277.930) -- 0:00:38
488500 -- [-1277.403] (-1277.250) (-1280.535) (-1278.170) * [-1277.889] (-1290.572) (-1277.853) (-1282.997) -- 0:00:38
489000 -- (-1278.157) [-1278.580] (-1280.176) (-1279.844) * (-1280.364) [-1280.174] (-1279.622) (-1279.715) -- 0:00:38
489500 -- (-1278.012) (-1278.970) [-1280.238] (-1279.206) * (-1283.591) [-1279.824] (-1280.300) (-1283.216) -- 0:00:38
490000 -- (-1278.942) [-1277.628] (-1277.843) (-1278.004) * (-1279.767) [-1278.580] (-1279.241) (-1283.770) -- 0:00:38
Average standard deviation of split frequencies: 0.010619
490500 -- (-1277.714) [-1277.618] (-1278.422) (-1279.451) * (-1278.959) (-1277.931) (-1279.617) [-1277.107] -- 0:00:38
491000 -- [-1276.232] (-1279.013) (-1277.535) (-1277.588) * (-1278.388) [-1277.786] (-1278.540) (-1276.318) -- 0:00:38
491500 -- [-1277.870] (-1279.363) (-1278.415) (-1277.204) * (-1277.928) [-1277.719] (-1279.141) (-1278.266) -- 0:00:38
492000 -- (-1278.173) [-1278.999] (-1279.208) (-1279.753) * [-1280.897] (-1279.540) (-1280.559) (-1283.388) -- 0:00:38
492500 -- (-1277.990) (-1278.285) [-1277.802] (-1278.327) * (-1276.886) [-1278.864] (-1276.282) (-1283.210) -- 0:00:38
493000 -- (-1278.454) (-1277.956) (-1276.927) [-1277.583] * (-1279.744) (-1278.830) (-1281.608) [-1277.789] -- 0:00:38
493500 -- (-1277.618) [-1280.180] (-1280.361) (-1279.610) * (-1281.998) (-1278.834) [-1280.107] (-1278.006) -- 0:00:37
494000 -- (-1277.548) (-1281.540) [-1278.176] (-1278.985) * (-1281.564) [-1278.989] (-1280.674) (-1278.997) -- 0:00:37
494500 -- [-1279.280] (-1280.297) (-1277.711) (-1279.897) * (-1278.812) (-1279.192) (-1281.988) [-1276.113] -- 0:00:37
495000 -- (-1281.329) (-1277.529) (-1283.710) [-1280.328] * [-1277.181] (-1278.473) (-1279.871) (-1277.585) -- 0:00:37
Average standard deviation of split frequencies: 0.010455
495500 -- [-1282.158] (-1277.533) (-1280.775) (-1278.760) * [-1277.326] (-1277.902) (-1277.744) (-1279.807) -- 0:00:38
496000 -- (-1280.571) (-1277.528) (-1280.825) [-1277.321] * [-1275.968] (-1277.162) (-1278.361) (-1280.629) -- 0:00:38
496500 -- [-1276.783] (-1282.324) (-1278.708) (-1278.978) * (-1280.389) (-1278.703) [-1277.186] (-1285.114) -- 0:00:38
497000 -- (-1278.873) (-1278.656) (-1278.087) [-1280.122] * (-1282.400) (-1277.833) (-1278.162) [-1277.949] -- 0:00:38
497500 -- (-1278.788) (-1280.910) (-1279.348) [-1282.076] * (-1279.293) (-1277.545) [-1277.591] (-1281.312) -- 0:00:38
498000 -- [-1278.686] (-1279.377) (-1281.626) (-1277.387) * (-1279.544) (-1283.127) [-1279.709] (-1280.052) -- 0:00:38
498500 -- (-1278.308) [-1279.983] (-1282.639) (-1277.539) * (-1280.827) (-1278.491) (-1278.911) [-1281.537] -- 0:00:38
499000 -- (-1279.704) [-1279.421] (-1278.591) (-1282.782) * (-1278.467) [-1280.325] (-1281.863) (-1279.274) -- 0:00:38
499500 -- (-1279.168) (-1281.211) (-1278.427) [-1284.878] * (-1278.807) (-1278.961) [-1276.554] (-1278.596) -- 0:00:38
500000 -- [-1276.304] (-1280.840) (-1278.501) (-1278.345) * (-1277.643) (-1285.691) [-1277.392] (-1277.795) -- 0:00:38
Average standard deviation of split frequencies: 0.009961
500500 -- [-1279.592] (-1280.046) (-1278.710) (-1280.479) * (-1278.612) (-1279.261) [-1277.526] (-1279.366) -- 0:00:37
501000 -- (-1277.586) (-1282.291) (-1278.530) [-1279.743] * (-1277.311) [-1276.892] (-1276.822) (-1280.759) -- 0:00:37
501500 -- (-1279.016) [-1286.400] (-1279.051) (-1279.803) * (-1278.879) [-1276.483] (-1277.863) (-1278.709) -- 0:00:37
502000 -- (-1279.321) (-1283.841) [-1277.366] (-1278.493) * [-1277.256] (-1278.940) (-1278.439) (-1278.185) -- 0:00:37
502500 -- (-1277.699) (-1284.839) [-1278.727] (-1279.478) * [-1277.779] (-1278.554) (-1279.453) (-1279.204) -- 0:00:37
503000 -- (-1278.120) (-1281.195) [-1279.269] (-1277.950) * [-1276.662] (-1281.151) (-1278.650) (-1279.317) -- 0:00:37
503500 -- (-1278.068) (-1280.205) (-1279.746) [-1278.144] * (-1278.273) (-1279.176) (-1279.280) [-1281.171] -- 0:00:37
504000 -- (-1281.820) (-1277.625) [-1277.550] (-1278.758) * [-1278.384] (-1277.897) (-1278.120) (-1277.927) -- 0:00:37
504500 -- [-1278.630] (-1279.341) (-1279.214) (-1280.008) * [-1279.960] (-1277.583) (-1282.217) (-1278.948) -- 0:00:37
505000 -- (-1282.634) (-1278.323) [-1280.132] (-1277.343) * [-1277.344] (-1278.723) (-1282.865) (-1283.166) -- 0:00:37
Average standard deviation of split frequencies: 0.010003
505500 -- (-1281.307) (-1278.965) (-1278.693) [-1278.192] * (-1281.655) [-1275.985] (-1279.089) (-1278.214) -- 0:00:37
506000 -- [-1279.683] (-1279.519) (-1278.101) (-1277.376) * [-1277.501] (-1278.136) (-1277.927) (-1280.020) -- 0:00:37
506500 -- [-1278.110] (-1277.474) (-1280.231) (-1276.364) * (-1278.594) [-1278.348] (-1280.931) (-1279.905) -- 0:00:37
507000 -- (-1278.640) (-1278.218) [-1278.398] (-1281.573) * (-1277.977) (-1281.782) (-1278.698) [-1278.511] -- 0:00:36
507500 -- (-1277.707) [-1278.865] (-1278.797) (-1277.877) * (-1279.920) [-1277.361] (-1284.281) (-1278.224) -- 0:00:36
508000 -- (-1282.160) [-1278.883] (-1277.769) (-1282.789) * (-1277.092) [-1278.466] (-1279.645) (-1278.638) -- 0:00:36
508500 -- (-1280.048) [-1276.449] (-1278.854) (-1280.781) * (-1281.348) (-1282.999) [-1280.174] (-1279.322) -- 0:00:36
509000 -- (-1281.009) (-1278.186) (-1278.765) [-1282.685] * [-1280.164] (-1281.284) (-1277.332) (-1279.898) -- 0:00:36
509500 -- (-1279.399) (-1279.002) (-1280.257) [-1282.137] * (-1277.974) (-1277.733) [-1279.280] (-1278.312) -- 0:00:37
510000 -- (-1279.836) [-1276.521] (-1281.773) (-1279.736) * [-1279.322] (-1278.978) (-1278.183) (-1279.634) -- 0:00:37
Average standard deviation of split frequencies: 0.010154
510500 -- [-1278.491] (-1279.782) (-1279.570) (-1276.238) * (-1278.596) (-1282.030) [-1277.911] (-1279.492) -- 0:00:37
511000 -- (-1278.688) (-1279.066) (-1277.901) [-1278.243] * (-1277.211) [-1279.823] (-1276.737) (-1279.815) -- 0:00:37
511500 -- (-1279.342) (-1278.305) (-1277.933) [-1279.245] * (-1276.990) (-1279.292) (-1278.373) [-1278.041] -- 0:00:37
512000 -- [-1276.328] (-1279.159) (-1278.694) (-1277.819) * [-1278.852] (-1278.311) (-1278.863) (-1280.526) -- 0:00:37
512500 -- (-1279.496) (-1277.902) (-1279.704) [-1276.786] * (-1280.977) [-1282.309] (-1277.872) (-1279.075) -- 0:00:37
513000 -- [-1279.688] (-1279.737) (-1280.573) (-1278.361) * (-1280.773) (-1280.461) (-1277.874) [-1280.451] -- 0:00:37
513500 -- (-1277.208) [-1278.583] (-1280.208) (-1280.568) * (-1277.547) (-1280.156) (-1279.279) [-1280.669] -- 0:00:36
514000 -- (-1280.748) (-1281.405) [-1279.309] (-1280.061) * (-1280.955) (-1280.510) (-1281.028) [-1279.053] -- 0:00:36
514500 -- [-1277.917] (-1280.666) (-1277.204) (-1277.320) * (-1276.566) (-1281.874) [-1281.103] (-1281.525) -- 0:00:36
515000 -- (-1277.889) (-1280.658) [-1278.154] (-1280.689) * (-1276.664) (-1281.218) [-1281.355] (-1278.452) -- 0:00:36
Average standard deviation of split frequencies: 0.010145
515500 -- (-1278.889) [-1277.845] (-1278.559) (-1282.478) * (-1281.067) (-1278.928) [-1279.473] (-1279.396) -- 0:00:36
516000 -- (-1278.369) (-1279.937) [-1279.504] (-1278.702) * (-1279.566) (-1283.303) (-1278.574) [-1277.554] -- 0:00:36
516500 -- (-1278.339) [-1277.755] (-1277.769) (-1277.206) * [-1277.694] (-1279.617) (-1279.703) (-1279.133) -- 0:00:36
517000 -- [-1277.757] (-1280.429) (-1283.044) (-1279.612) * (-1278.390) [-1278.350] (-1277.530) (-1280.407) -- 0:00:36
517500 -- (-1277.761) [-1281.106] (-1278.327) (-1284.268) * (-1277.537) (-1278.531) [-1280.712] (-1279.442) -- 0:00:36
518000 -- [-1277.953] (-1278.646) (-1278.356) (-1280.284) * (-1277.714) [-1278.979] (-1281.426) (-1281.893) -- 0:00:36
518500 -- (-1277.933) (-1280.341) [-1279.090] (-1283.806) * [-1278.652] (-1282.331) (-1280.277) (-1278.715) -- 0:00:36
519000 -- (-1280.142) (-1278.671) (-1278.426) [-1283.245] * (-1278.279) (-1279.023) (-1280.381) [-1275.188] -- 0:00:36
519500 -- [-1279.780] (-1278.683) (-1278.265) (-1280.227) * [-1279.512] (-1281.318) (-1277.873) (-1277.862) -- 0:00:36
520000 -- [-1280.088] (-1278.767) (-1281.302) (-1278.883) * (-1280.952) (-1279.338) (-1278.565) [-1280.037] -- 0:00:36
Average standard deviation of split frequencies: 0.010293
520500 -- (-1278.174) [-1279.997] (-1278.761) (-1279.253) * [-1280.766] (-1277.884) (-1279.113) (-1278.041) -- 0:00:35
521000 -- (-1277.330) [-1278.839] (-1279.811) (-1277.449) * (-1281.588) (-1278.643) [-1279.438] (-1278.472) -- 0:00:35
521500 -- (-1278.957) (-1279.397) [-1278.498] (-1277.837) * [-1279.756] (-1279.774) (-1280.141) (-1278.024) -- 0:00:35
522000 -- (-1285.651) [-1278.559] (-1278.311) (-1279.728) * (-1282.330) (-1280.283) [-1279.699] (-1279.234) -- 0:00:35
522500 -- (-1278.755) [-1277.429] (-1280.058) (-1281.081) * [-1278.199] (-1278.552) (-1279.845) (-1279.240) -- 0:00:35
523000 -- (-1279.605) [-1279.529] (-1280.266) (-1285.506) * (-1281.903) (-1281.435) [-1280.161] (-1282.632) -- 0:00:35
523500 -- (-1279.115) (-1279.520) [-1279.527] (-1286.181) * (-1283.759) (-1282.500) [-1278.694] (-1278.016) -- 0:00:36
524000 -- [-1280.612] (-1279.039) (-1279.352) (-1286.442) * (-1279.088) [-1277.983] (-1279.360) (-1278.444) -- 0:00:36
524500 -- [-1279.145] (-1280.283) (-1277.991) (-1299.771) * (-1280.627) [-1277.731] (-1279.060) (-1277.904) -- 0:00:36
525000 -- (-1276.231) (-1279.508) (-1279.497) [-1278.749] * (-1284.572) [-1280.518] (-1279.784) (-1277.182) -- 0:00:36
Average standard deviation of split frequencies: 0.010236
525500 -- (-1277.861) [-1277.827] (-1280.681) (-1280.821) * (-1281.941) (-1281.887) [-1278.384] (-1277.666) -- 0:00:36
526000 -- (-1277.455) (-1277.331) [-1281.040] (-1282.776) * [-1280.644] (-1283.199) (-1278.738) (-1278.044) -- 0:00:36
526500 -- [-1277.378] (-1278.063) (-1279.602) (-1277.775) * (-1278.928) [-1278.155] (-1277.286) (-1278.462) -- 0:00:35
527000 -- [-1280.348] (-1278.160) (-1277.046) (-1279.528) * (-1278.485) [-1281.516] (-1280.282) (-1278.279) -- 0:00:35
527500 -- (-1282.646) [-1283.649] (-1278.179) (-1283.766) * (-1279.808) (-1279.832) (-1280.142) [-1276.341] -- 0:00:35
528000 -- [-1279.649] (-1283.853) (-1279.965) (-1281.020) * [-1278.882] (-1281.166) (-1281.517) (-1280.417) -- 0:00:35
528500 -- (-1282.953) [-1276.333] (-1280.924) (-1281.385) * (-1279.701) [-1277.796] (-1283.485) (-1282.067) -- 0:00:35
529000 -- (-1280.901) (-1279.981) [-1278.374] (-1283.998) * (-1278.296) [-1278.437] (-1281.285) (-1281.279) -- 0:00:35
529500 -- [-1279.091] (-1279.231) (-1280.146) (-1280.743) * (-1278.864) [-1279.471] (-1280.222) (-1282.331) -- 0:00:35
530000 -- (-1278.576) (-1278.357) [-1281.340] (-1278.308) * [-1280.983] (-1278.653) (-1279.031) (-1282.525) -- 0:00:35
Average standard deviation of split frequencies: 0.010707
530500 -- (-1279.942) (-1279.340) (-1282.759) [-1280.175] * (-1278.503) [-1277.682] (-1279.390) (-1280.960) -- 0:00:35
531000 -- (-1279.352) [-1277.575] (-1278.583) (-1278.550) * (-1279.467) (-1277.376) [-1279.898] (-1279.611) -- 0:00:35
531500 -- (-1278.054) [-1279.715] (-1279.067) (-1278.023) * (-1280.661) (-1278.923) [-1281.324] (-1278.875) -- 0:00:35
532000 -- (-1276.908) [-1280.096] (-1277.554) (-1277.846) * (-1279.287) (-1278.335) (-1280.394) [-1277.513] -- 0:00:35
532500 -- (-1277.589) [-1275.667] (-1277.193) (-1279.867) * [-1281.000] (-1278.547) (-1278.966) (-1278.110) -- 0:00:35
533000 -- (-1279.480) (-1277.958) (-1282.357) [-1278.181] * (-1281.469) [-1278.301] (-1279.990) (-1280.208) -- 0:00:35
533500 -- (-1278.481) (-1281.506) [-1279.657] (-1278.295) * (-1278.889) (-1278.125) (-1278.934) [-1283.429] -- 0:00:34
534000 -- (-1278.060) [-1279.191] (-1278.487) (-1277.950) * (-1283.453) (-1278.124) [-1279.279] (-1279.031) -- 0:00:34
534500 -- (-1279.566) (-1278.055) [-1282.769] (-1278.971) * (-1278.593) (-1277.245) (-1279.961) [-1280.350] -- 0:00:34
535000 -- (-1277.841) (-1280.249) [-1278.447] (-1275.904) * (-1280.071) (-1275.736) (-1278.786) [-1279.261] -- 0:00:34
Average standard deviation of split frequencies: 0.010508
535500 -- (-1276.479) [-1279.152] (-1277.499) (-1278.170) * (-1278.176) [-1277.417] (-1279.532) (-1282.212) -- 0:00:34
536000 -- (-1277.528) [-1278.677] (-1278.562) (-1278.781) * (-1279.529) (-1278.594) (-1278.258) [-1279.387] -- 0:00:34
536500 -- (-1281.294) (-1278.363) [-1278.024] (-1283.235) * (-1280.570) (-1281.670) [-1279.125] (-1280.329) -- 0:00:34
537000 -- (-1279.004) (-1278.595) [-1277.341] (-1278.604) * (-1282.892) [-1280.608] (-1281.717) (-1279.010) -- 0:00:34
537500 -- (-1277.251) [-1279.445] (-1278.720) (-1279.223) * (-1277.960) (-1279.896) [-1282.457] (-1276.497) -- 0:00:34
538000 -- (-1278.338) (-1283.457) (-1279.599) [-1276.759] * (-1277.689) (-1278.948) (-1279.541) [-1277.229] -- 0:00:35
538500 -- (-1278.528) (-1281.244) [-1277.842] (-1278.198) * [-1279.077] (-1278.515) (-1276.132) (-1277.936) -- 0:00:35
539000 -- (-1278.089) (-1280.975) [-1279.692] (-1278.630) * (-1276.799) [-1278.987] (-1279.064) (-1278.749) -- 0:00:35
539500 -- (-1280.077) [-1278.786] (-1278.912) (-1280.014) * (-1278.038) (-1277.749) [-1279.476] (-1278.227) -- 0:00:34
540000 -- (-1284.392) [-1278.649] (-1278.936) (-1280.002) * [-1281.386] (-1279.674) (-1283.261) (-1279.478) -- 0:00:34
Average standard deviation of split frequencies: 0.010279
540500 -- [-1279.488] (-1277.519) (-1278.744) (-1279.309) * (-1281.413) (-1277.956) [-1282.693] (-1280.416) -- 0:00:34
541000 -- [-1280.360] (-1277.215) (-1280.291) (-1279.383) * [-1278.981] (-1277.929) (-1280.576) (-1281.750) -- 0:00:34
541500 -- (-1282.283) [-1278.856] (-1283.179) (-1275.784) * (-1279.808) [-1277.618] (-1280.819) (-1278.039) -- 0:00:34
542000 -- (-1279.100) (-1278.506) (-1280.972) [-1278.494] * (-1280.852) (-1278.040) (-1280.409) [-1280.474] -- 0:00:34
542500 -- [-1281.168] (-1279.248) (-1281.092) (-1278.316) * (-1283.090) [-1276.399] (-1282.008) (-1279.370) -- 0:00:34
543000 -- (-1288.158) [-1276.469] (-1282.134) (-1284.930) * (-1278.335) (-1279.089) [-1281.499] (-1281.540) -- 0:00:34
543500 -- (-1279.732) [-1277.673] (-1282.662) (-1277.659) * (-1278.363) (-1277.300) (-1280.413) [-1279.763] -- 0:00:34
544000 -- (-1277.885) [-1278.830] (-1278.563) (-1278.085) * (-1277.955) (-1279.780) (-1282.443) [-1282.365] -- 0:00:34
544500 -- (-1277.013) (-1285.483) [-1278.401] (-1278.804) * (-1279.250) [-1278.259] (-1280.080) (-1280.470) -- 0:00:34
545000 -- [-1277.325] (-1277.805) (-1278.252) (-1277.877) * (-1279.338) (-1281.438) (-1279.086) [-1279.189] -- 0:00:34
Average standard deviation of split frequencies: 0.010179
545500 -- (-1278.674) (-1277.642) [-1277.680] (-1277.655) * (-1280.281) (-1278.864) (-1279.614) [-1278.900] -- 0:00:34
546000 -- (-1280.273) [-1280.596] (-1278.316) (-1278.078) * (-1278.435) (-1279.368) [-1278.980] (-1281.834) -- 0:00:34
546500 -- [-1279.797] (-1280.357) (-1278.338) (-1282.890) * [-1278.232] (-1280.092) (-1277.630) (-1279.798) -- 0:00:34
547000 -- [-1276.274] (-1278.691) (-1278.177) (-1281.237) * (-1277.644) [-1278.348] (-1277.597) (-1277.987) -- 0:00:33
547500 -- (-1279.280) [-1282.074] (-1278.803) (-1277.182) * (-1279.869) [-1280.203] (-1279.685) (-1280.928) -- 0:00:33
548000 -- (-1278.656) [-1282.251] (-1278.523) (-1281.536) * [-1278.973] (-1281.590) (-1277.891) (-1281.454) -- 0:00:33
548500 -- (-1277.211) (-1279.180) (-1278.998) [-1279.829] * (-1277.858) (-1281.027) (-1276.835) [-1279.636] -- 0:00:33
549000 -- (-1277.476) (-1281.110) (-1279.494) [-1278.285] * (-1277.589) (-1280.553) (-1278.912) [-1278.053] -- 0:00:33
549500 -- [-1277.114] (-1278.479) (-1281.942) (-1277.781) * (-1279.474) (-1277.750) (-1279.475) [-1278.522] -- 0:00:33
550000 -- [-1279.042] (-1278.110) (-1278.224) (-1277.939) * (-1280.055) (-1278.405) (-1280.139) [-1282.517] -- 0:00:33
Average standard deviation of split frequencies: 0.009642
550500 -- (-1280.042) (-1279.779) (-1277.526) [-1277.215] * (-1281.447) (-1280.841) [-1279.255] (-1278.446) -- 0:00:33
551000 -- (-1282.089) [-1279.614] (-1280.981) (-1275.127) * (-1278.300) (-1280.281) (-1278.185) [-1280.523] -- 0:00:33
551500 -- [-1278.349] (-1278.329) (-1280.270) (-1280.003) * (-1280.791) [-1277.611] (-1279.976) (-1277.714) -- 0:00:33
552000 -- (-1277.490) [-1282.309] (-1276.762) (-1281.689) * (-1279.172) [-1277.727] (-1278.638) (-1277.723) -- 0:00:34
552500 -- [-1277.623] (-1277.997) (-1279.276) (-1277.972) * (-1277.393) (-1280.530) (-1278.657) [-1278.280] -- 0:00:34
553000 -- (-1279.059) [-1280.190] (-1282.301) (-1278.686) * (-1277.269) [-1278.562] (-1278.308) (-1281.530) -- 0:00:33
553500 -- (-1281.376) (-1277.430) [-1278.545] (-1278.845) * (-1276.624) [-1277.716] (-1280.333) (-1278.311) -- 0:00:33
554000 -- [-1278.698] (-1277.940) (-1281.099) (-1280.228) * (-1278.459) [-1276.362] (-1284.258) (-1279.885) -- 0:00:33
554500 -- [-1279.980] (-1278.097) (-1283.482) (-1278.426) * (-1277.373) (-1277.445) (-1282.068) [-1278.636] -- 0:00:33
555000 -- (-1280.518) (-1280.065) [-1281.455] (-1279.209) * (-1277.786) (-1281.277) [-1283.460] (-1281.614) -- 0:00:33
Average standard deviation of split frequencies: 0.008791
555500 -- (-1279.665) [-1278.044] (-1277.516) (-1277.906) * (-1278.725) (-1280.015) (-1279.687) [-1281.770] -- 0:00:33
556000 -- (-1277.680) (-1278.332) [-1278.767] (-1278.315) * (-1281.379) (-1278.177) (-1278.716) [-1278.349] -- 0:00:33
556500 -- [-1279.902] (-1279.846) (-1278.345) (-1281.005) * [-1276.636] (-1281.930) (-1278.288) (-1278.150) -- 0:00:33
557000 -- (-1279.073) (-1278.716) [-1279.634] (-1279.348) * (-1280.665) [-1278.621] (-1279.633) (-1278.721) -- 0:00:33
557500 -- (-1282.195) [-1278.229] (-1279.265) (-1277.405) * (-1279.158) [-1278.645] (-1281.191) (-1278.899) -- 0:00:33
558000 -- (-1279.577) (-1278.513) (-1277.456) [-1276.733] * (-1277.495) [-1280.639] (-1281.420) (-1279.388) -- 0:00:33
558500 -- [-1277.440] (-1278.760) (-1276.217) (-1283.055) * [-1277.371] (-1278.701) (-1283.335) (-1281.797) -- 0:00:33
559000 -- (-1280.581) (-1281.288) [-1279.298] (-1279.898) * (-1280.701) (-1278.332) [-1277.548] (-1278.516) -- 0:00:33
559500 -- (-1278.568) [-1278.565] (-1279.569) (-1280.577) * (-1278.654) [-1279.200] (-1281.337) (-1278.688) -- 0:00:33
560000 -- (-1280.142) [-1277.738] (-1278.546) (-1280.690) * (-1277.994) [-1277.939] (-1279.569) (-1281.236) -- 0:00:33
Average standard deviation of split frequencies: 0.009342
560500 -- (-1279.378) (-1278.573) (-1278.715) [-1280.986] * [-1280.210] (-1276.027) (-1277.871) (-1279.164) -- 0:00:32
561000 -- (-1280.219) [-1279.123] (-1279.306) (-1280.245) * (-1279.654) [-1280.124] (-1277.651) (-1277.424) -- 0:00:32
561500 -- (-1279.999) (-1279.145) [-1278.034] (-1282.624) * (-1281.057) (-1280.523) [-1278.856] (-1277.514) -- 0:00:32
562000 -- [-1284.057] (-1278.241) (-1277.920) (-1280.700) * [-1283.573] (-1278.813) (-1278.761) (-1277.559) -- 0:00:32
562500 -- (-1281.279) (-1279.850) (-1277.942) [-1279.347] * (-1280.373) [-1279.867] (-1281.384) (-1281.785) -- 0:00:32
563000 -- (-1279.606) (-1278.711) [-1278.511] (-1276.452) * (-1280.400) [-1279.098] (-1277.498) (-1284.392) -- 0:00:32
563500 -- (-1281.101) [-1277.698] (-1279.170) (-1278.488) * [-1281.676] (-1277.896) (-1277.468) (-1282.594) -- 0:00:32
564000 -- (-1280.703) (-1279.250) [-1277.249] (-1281.764) * (-1278.074) [-1279.806] (-1278.233) (-1279.105) -- 0:00:32
564500 -- (-1278.824) [-1278.377] (-1278.595) (-1280.339) * (-1279.447) [-1279.511] (-1279.002) (-1282.657) -- 0:00:32
565000 -- (-1283.367) (-1284.639) (-1278.649) [-1280.404] * (-1280.960) (-1279.520) [-1278.346] (-1277.566) -- 0:00:32
Average standard deviation of split frequencies: 0.008884
565500 -- (-1278.257) [-1281.628] (-1277.740) (-1279.813) * (-1281.043) [-1286.397] (-1278.324) (-1277.678) -- 0:00:32
566000 -- (-1277.418) [-1281.559] (-1278.133) (-1278.275) * (-1279.570) [-1279.123] (-1279.326) (-1277.550) -- 0:00:32
566500 -- (-1278.194) (-1282.848) [-1278.529] (-1277.983) * (-1277.691) (-1283.051) (-1277.291) [-1278.030] -- 0:00:32
567000 -- (-1279.733) (-1283.678) (-1277.624) [-1278.304] * [-1278.228] (-1279.897) (-1284.028) (-1280.070) -- 0:00:32
567500 -- (-1278.668) [-1278.315] (-1277.878) (-1282.546) * (-1283.823) (-1278.885) (-1278.587) [-1278.426] -- 0:00:32
568000 -- (-1279.849) (-1277.882) [-1277.893] (-1278.202) * (-1282.797) (-1280.112) (-1279.664) [-1278.470] -- 0:00:32
568500 -- (-1280.712) [-1281.085] (-1277.442) (-1278.501) * (-1278.049) [-1277.363] (-1279.095) (-1280.644) -- 0:00:32
569000 -- (-1277.975) (-1277.734) [-1276.444] (-1278.273) * (-1277.721) (-1278.072) [-1278.865] (-1277.336) -- 0:00:32
569500 -- (-1279.429) (-1280.593) (-1279.759) [-1277.780] * (-1280.619) [-1279.555] (-1280.129) (-1282.518) -- 0:00:32
570000 -- (-1280.459) (-1276.054) (-1282.871) [-1279.005] * (-1279.692) [-1276.389] (-1284.533) (-1277.991) -- 0:00:32
Average standard deviation of split frequencies: 0.008565
570500 -- (-1278.942) (-1275.496) (-1277.828) [-1279.682] * [-1279.479] (-1276.783) (-1281.418) (-1277.612) -- 0:00:32
571000 -- (-1277.033) [-1276.587] (-1275.721) (-1281.489) * (-1278.496) (-1278.354) [-1279.331] (-1280.624) -- 0:00:32
571500 -- (-1278.476) (-1276.894) [-1278.641] (-1286.939) * (-1278.725) (-1278.133) [-1278.803] (-1279.293) -- 0:00:32
572000 -- [-1277.743] (-1282.970) (-1278.374) (-1280.125) * (-1277.844) (-1282.196) [-1277.459] (-1280.397) -- 0:00:32
572500 -- (-1278.915) (-1279.025) [-1279.691] (-1279.032) * (-1279.321) [-1281.425] (-1277.870) (-1278.652) -- 0:00:32
573000 -- (-1279.405) (-1281.381) (-1279.727) [-1279.003] * (-1280.898) [-1281.593] (-1278.118) (-1278.993) -- 0:00:32
573500 -- [-1280.228] (-1279.506) (-1281.285) (-1278.243) * [-1276.664] (-1278.660) (-1278.201) (-1279.867) -- 0:00:31
574000 -- (-1279.753) (-1282.689) [-1279.184] (-1277.900) * [-1281.345] (-1279.652) (-1277.856) (-1278.479) -- 0:00:31
574500 -- [-1278.311] (-1279.579) (-1277.892) (-1279.075) * (-1276.910) (-1279.317) [-1279.116] (-1281.933) -- 0:00:31
575000 -- [-1278.850] (-1278.706) (-1279.616) (-1279.062) * (-1281.257) (-1282.717) [-1278.414] (-1280.036) -- 0:00:31
Average standard deviation of split frequencies: 0.008593
575500 -- (-1279.917) (-1279.616) (-1280.202) [-1279.186] * (-1278.671) (-1284.096) [-1277.282] (-1280.407) -- 0:00:31
576000 -- (-1279.456) (-1278.863) [-1280.172] (-1280.725) * (-1279.242) [-1278.272] (-1278.689) (-1279.610) -- 0:00:31
576500 -- (-1278.023) [-1277.302] (-1280.089) (-1278.185) * (-1277.259) [-1284.014] (-1278.720) (-1278.407) -- 0:00:31
577000 -- [-1278.372] (-1278.473) (-1285.021) (-1277.528) * (-1282.069) (-1280.588) (-1279.169) [-1277.944] -- 0:00:31
577500 -- (-1279.579) (-1281.570) [-1281.491] (-1283.786) * [-1277.770] (-1277.272) (-1278.678) (-1279.631) -- 0:00:31
578000 -- (-1278.816) [-1277.876] (-1279.302) (-1277.322) * (-1277.593) (-1279.778) [-1283.127] (-1279.062) -- 0:00:31
578500 -- (-1279.454) (-1276.222) (-1282.509) [-1277.553] * (-1278.525) (-1277.284) [-1280.450] (-1277.757) -- 0:00:31
579000 -- (-1278.151) (-1280.053) [-1282.116] (-1282.043) * (-1278.653) (-1280.581) (-1279.094) [-1277.785] -- 0:00:31
579500 -- (-1278.723) (-1278.666) (-1278.386) [-1278.464] * (-1278.466) (-1278.351) [-1278.155] (-1280.793) -- 0:00:31
580000 -- (-1276.897) (-1281.957) (-1279.021) [-1276.760] * (-1277.924) [-1278.434] (-1277.775) (-1278.053) -- 0:00:31
Average standard deviation of split frequencies: 0.009065
580500 -- (-1277.363) (-1278.380) [-1278.681] (-1277.605) * [-1276.456] (-1277.471) (-1282.268) (-1279.981) -- 0:00:31
581000 -- (-1279.213) (-1279.596) [-1278.968] (-1275.807) * (-1281.589) (-1278.688) (-1281.567) [-1281.335] -- 0:00:31
581500 -- (-1277.460) (-1278.985) [-1278.639] (-1278.293) * (-1278.355) (-1279.588) (-1280.035) [-1280.078] -- 0:00:31
582000 -- [-1282.335] (-1278.983) (-1280.534) (-1279.444) * (-1277.500) [-1279.593] (-1280.345) (-1280.034) -- 0:00:31
582500 -- [-1277.338] (-1280.275) (-1282.017) (-1279.925) * (-1276.910) (-1278.176) [-1277.920] (-1281.451) -- 0:00:31
583000 -- [-1279.503] (-1278.391) (-1281.284) (-1279.541) * (-1278.563) (-1279.536) (-1277.792) [-1277.778] -- 0:00:31
583500 -- [-1278.997] (-1277.765) (-1280.536) (-1275.821) * [-1278.573] (-1276.840) (-1278.209) (-1279.775) -- 0:00:31
584000 -- (-1280.521) (-1279.251) [-1279.596] (-1279.733) * (-1281.177) (-1277.170) (-1277.995) [-1278.408] -- 0:00:31
584500 -- [-1276.204] (-1277.612) (-1278.837) (-1281.424) * (-1279.262) [-1278.443] (-1283.511) (-1280.556) -- 0:00:31
585000 -- [-1277.439] (-1280.454) (-1281.039) (-1280.488) * (-1279.330) (-1280.226) [-1274.832] (-1278.806) -- 0:00:31
Average standard deviation of split frequencies: 0.008581
585500 -- (-1278.286) (-1278.415) (-1280.906) [-1279.324] * (-1279.059) [-1278.637] (-1282.537) (-1277.887) -- 0:00:31
586000 -- (-1277.423) (-1280.076) [-1277.918] (-1278.162) * (-1278.117) [-1277.523] (-1281.506) (-1277.859) -- 0:00:31
586500 -- (-1279.326) (-1279.182) [-1280.942] (-1277.853) * (-1279.221) (-1281.367) [-1280.724] (-1278.997) -- 0:00:31
587000 -- (-1279.216) (-1279.173) [-1283.311] (-1278.081) * (-1279.379) (-1279.033) (-1278.810) [-1280.663] -- 0:00:30
587500 -- (-1280.401) (-1281.700) (-1278.711) [-1277.943] * (-1279.428) [-1280.863] (-1279.384) (-1279.238) -- 0:00:30
588000 -- [-1279.940] (-1279.018) (-1279.453) (-1279.056) * (-1280.161) [-1283.192] (-1277.719) (-1279.202) -- 0:00:30
588500 -- [-1278.792] (-1279.397) (-1278.538) (-1277.471) * [-1279.634] (-1281.459) (-1278.121) (-1278.456) -- 0:00:30
589000 -- [-1278.282] (-1278.140) (-1277.464) (-1277.513) * (-1278.327) [-1281.629] (-1279.026) (-1278.366) -- 0:00:30
589500 -- (-1278.968) (-1279.169) [-1280.485] (-1279.487) * (-1285.578) (-1284.141) [-1280.755] (-1282.807) -- 0:00:30
590000 -- (-1278.243) (-1279.607) (-1280.679) [-1279.368] * [-1280.450] (-1278.768) (-1276.329) (-1278.144) -- 0:00:30
Average standard deviation of split frequencies: 0.008149
590500 -- [-1278.197] (-1278.919) (-1279.733) (-1277.388) * (-1281.725) (-1284.352) [-1277.283] (-1279.800) -- 0:00:30
591000 -- (-1281.289) [-1278.300] (-1281.020) (-1284.156) * (-1280.205) (-1280.809) (-1277.265) [-1278.976] -- 0:00:30
591500 -- (-1277.744) [-1279.932] (-1281.317) (-1275.907) * [-1280.053] (-1281.388) (-1278.628) (-1279.844) -- 0:00:30
592000 -- [-1277.252] (-1279.172) (-1277.647) (-1281.100) * (-1278.051) [-1278.916] (-1282.652) (-1279.308) -- 0:00:30
592500 -- (-1280.209) (-1278.920) [-1280.700] (-1280.271) * (-1278.428) (-1274.989) (-1283.237) [-1278.694] -- 0:00:30
593000 -- (-1279.367) (-1281.237) [-1279.675] (-1279.463) * [-1278.612] (-1277.989) (-1281.527) (-1277.866) -- 0:00:30
593500 -- (-1283.780) (-1280.629) (-1279.845) [-1276.872] * (-1280.099) (-1280.073) [-1278.673] (-1278.174) -- 0:00:30
594000 -- [-1278.983] (-1279.430) (-1278.324) (-1277.830) * (-1281.311) (-1278.964) [-1276.551] (-1280.291) -- 0:00:30
594500 -- (-1277.561) (-1283.113) (-1279.823) [-1278.179] * (-1282.089) [-1280.376] (-1277.354) (-1279.040) -- 0:00:30
595000 -- (-1278.926) (-1278.068) [-1278.632] (-1277.298) * (-1280.266) [-1277.683] (-1278.749) (-1280.222) -- 0:00:30
Average standard deviation of split frequencies: 0.008326
595500 -- (-1276.768) (-1278.175) (-1278.087) [-1278.692] * [-1279.722] (-1277.563) (-1276.885) (-1276.372) -- 0:00:30
596000 -- [-1278.196] (-1283.278) (-1280.326) (-1280.681) * (-1282.006) (-1279.935) (-1278.064) [-1278.701] -- 0:00:30
596500 -- (-1282.210) (-1281.461) [-1281.242] (-1275.680) * [-1278.678] (-1279.814) (-1277.642) (-1283.300) -- 0:00:30
597000 -- (-1279.724) (-1278.290) [-1278.734] (-1280.006) * (-1278.513) (-1277.439) [-1277.904] (-1283.197) -- 0:00:30
597500 -- (-1279.218) [-1277.053] (-1281.144) (-1281.510) * (-1279.784) (-1281.942) (-1281.142) [-1282.216] -- 0:00:30
598000 -- (-1279.651) (-1278.736) (-1281.555) [-1277.607] * (-1277.390) (-1277.573) (-1279.076) [-1279.951] -- 0:00:30
598500 -- (-1283.246) (-1278.107) [-1278.988] (-1279.378) * [-1279.558] (-1277.867) (-1282.186) (-1282.205) -- 0:00:30
599000 -- [-1279.324] (-1278.430) (-1280.859) (-1283.165) * (-1280.476) [-1280.065] (-1277.640) (-1279.250) -- 0:00:30
599500 -- (-1277.090) (-1279.171) (-1282.292) [-1278.056] * (-1279.752) (-1279.984) (-1277.271) [-1279.985] -- 0:00:30
600000 -- [-1278.678] (-1279.358) (-1281.592) (-1281.079) * (-1278.371) (-1282.002) [-1280.492] (-1279.347) -- 0:00:29
Average standard deviation of split frequencies: 0.008261
600500 -- (-1284.441) (-1278.689) [-1279.081] (-1278.716) * [-1279.494] (-1279.335) (-1282.553) (-1279.356) -- 0:00:29
601000 -- (-1287.447) [-1280.016] (-1279.102) (-1279.198) * (-1281.664) (-1279.510) [-1279.655] (-1280.913) -- 0:00:29
601500 -- [-1280.222] (-1277.629) (-1278.574) (-1282.922) * (-1279.236) [-1277.661] (-1278.371) (-1280.570) -- 0:00:29
602000 -- (-1279.669) [-1280.471] (-1277.796) (-1282.027) * (-1278.424) (-1277.178) [-1277.946] (-1280.851) -- 0:00:29
602500 -- [-1279.139] (-1278.021) (-1278.231) (-1280.002) * (-1279.065) [-1277.918] (-1278.284) (-1279.240) -- 0:00:29
603000 -- (-1279.908) (-1278.327) [-1279.519] (-1278.869) * (-1277.651) (-1278.079) (-1278.592) [-1278.320] -- 0:00:29
603500 -- (-1277.457) [-1279.998] (-1282.372) (-1285.663) * (-1280.281) [-1278.075] (-1280.518) (-1277.817) -- 0:00:29
604000 -- [-1277.775] (-1279.826) (-1278.587) (-1280.898) * (-1281.167) (-1277.983) (-1282.794) [-1280.844] -- 0:00:29
604500 -- (-1280.044) (-1278.213) [-1278.346] (-1281.354) * (-1281.903) [-1282.498] (-1285.487) (-1279.947) -- 0:00:29
605000 -- (-1284.325) (-1279.286) [-1278.024] (-1281.460) * (-1283.100) (-1279.257) [-1279.882] (-1278.400) -- 0:00:29
Average standard deviation of split frequencies: 0.007656
605500 -- (-1279.133) (-1278.201) (-1278.218) [-1279.440] * (-1281.773) [-1281.237] (-1279.169) (-1285.357) -- 0:00:29
606000 -- (-1281.534) [-1278.979] (-1279.558) (-1277.765) * [-1277.750] (-1278.020) (-1280.206) (-1281.207) -- 0:00:29
606500 -- (-1277.029) (-1280.989) (-1279.100) [-1277.390] * (-1278.106) [-1279.052] (-1278.412) (-1278.854) -- 0:00:29
607000 -- (-1276.977) [-1279.675] (-1279.363) (-1279.958) * [-1278.548] (-1276.834) (-1277.432) (-1279.307) -- 0:00:29
607500 -- (-1278.711) [-1280.973] (-1278.237) (-1277.599) * (-1277.072) (-1282.075) [-1276.989] (-1279.950) -- 0:00:29
608000 -- [-1278.254] (-1279.370) (-1280.536) (-1279.257) * (-1278.767) [-1280.581] (-1280.554) (-1283.579) -- 0:00:29
608500 -- (-1277.830) (-1277.411) (-1277.789) [-1281.932] * (-1277.422) (-1280.013) [-1278.856] (-1280.315) -- 0:00:28
609000 -- (-1278.448) (-1278.978) (-1278.009) [-1283.893] * (-1281.116) (-1277.929) (-1281.679) [-1284.714] -- 0:00:29
609500 -- [-1279.092] (-1278.042) (-1279.143) (-1279.627) * (-1278.926) (-1279.210) (-1278.652) [-1281.419] -- 0:00:29
610000 -- (-1283.822) (-1279.203) [-1280.159] (-1280.908) * (-1278.376) [-1277.961] (-1278.125) (-1279.485) -- 0:00:29
Average standard deviation of split frequencies: 0.007923
610500 -- (-1280.945) [-1279.924] (-1279.607) (-1276.476) * (-1278.400) [-1277.159] (-1276.172) (-1278.600) -- 0:00:29
611000 -- (-1278.600) (-1280.302) [-1279.314] (-1278.052) * (-1277.835) (-1277.988) (-1277.213) [-1279.754] -- 0:00:29
611500 -- (-1278.731) (-1278.478) [-1282.993] (-1276.216) * [-1279.460] (-1280.442) (-1278.400) (-1279.132) -- 0:00:29
612000 -- (-1278.712) (-1278.693) (-1280.706) [-1281.094] * (-1279.484) [-1279.461] (-1282.705) (-1278.993) -- 0:00:29
612500 -- [-1280.582] (-1279.211) (-1282.345) (-1277.608) * (-1277.933) (-1278.972) (-1282.230) [-1276.085] -- 0:00:29
613000 -- [-1278.254] (-1280.585) (-1279.631) (-1281.190) * (-1277.176) (-1278.334) (-1278.739) [-1278.051] -- 0:00:29
613500 -- (-1278.423) (-1282.382) [-1279.772] (-1277.475) * [-1281.521] (-1278.256) (-1278.203) (-1275.924) -- 0:00:28
614000 -- (-1279.136) [-1279.548] (-1280.169) (-1277.273) * (-1284.597) (-1282.672) [-1278.763] (-1278.236) -- 0:00:28
614500 -- (-1280.816) [-1279.152] (-1282.676) (-1277.922) * (-1278.174) (-1279.948) (-1278.174) [-1278.519] -- 0:00:28
615000 -- [-1280.545] (-1280.821) (-1278.098) (-1280.806) * [-1279.268] (-1281.154) (-1276.703) (-1278.732) -- 0:00:28
Average standard deviation of split frequencies: 0.008257
615500 -- (-1282.318) [-1280.789] (-1281.084) (-1279.322) * [-1277.345] (-1286.680) (-1277.888) (-1283.781) -- 0:00:28
616000 -- [-1278.224] (-1280.665) (-1278.949) (-1277.896) * [-1276.916] (-1279.055) (-1280.407) (-1277.694) -- 0:00:28
616500 -- [-1280.324] (-1277.611) (-1279.624) (-1282.579) * [-1277.216] (-1277.789) (-1279.946) (-1279.375) -- 0:00:28
617000 -- (-1280.506) (-1278.442) [-1276.339] (-1285.246) * [-1279.044] (-1281.034) (-1278.096) (-1279.059) -- 0:00:28
617500 -- [-1278.875] (-1279.568) (-1281.140) (-1278.392) * (-1277.807) (-1278.891) (-1278.365) [-1278.602] -- 0:00:28
618000 -- (-1280.754) (-1278.667) [-1278.538] (-1278.263) * (-1280.642) (-1280.804) [-1279.894] (-1279.377) -- 0:00:28
618500 -- (-1278.926) [-1279.703] (-1282.686) (-1278.508) * [-1277.383] (-1281.348) (-1279.190) (-1279.569) -- 0:00:28
619000 -- [-1279.565] (-1279.312) (-1284.104) (-1278.607) * (-1277.606) (-1280.303) (-1279.600) [-1278.891] -- 0:00:28
619500 -- (-1281.721) (-1278.562) (-1281.139) [-1279.496] * (-1279.016) (-1277.482) (-1278.735) [-1278.529] -- 0:00:28
620000 -- [-1279.116] (-1278.408) (-1279.386) (-1278.757) * (-1279.311) [-1279.918] (-1278.194) (-1281.475) -- 0:00:28
Average standard deviation of split frequencies: 0.008594
620500 -- (-1280.594) (-1278.288) (-1280.006) [-1279.218] * (-1279.469) (-1279.344) [-1278.512] (-1279.594) -- 0:00:28
621000 -- [-1279.746] (-1282.433) (-1279.521) (-1278.703) * (-1280.069) [-1280.231] (-1279.180) (-1281.535) -- 0:00:28
621500 -- (-1281.951) (-1280.529) (-1280.543) [-1278.772] * [-1279.077] (-1276.068) (-1278.682) (-1280.845) -- 0:00:28
622000 -- [-1278.524] (-1279.444) (-1280.687) (-1277.818) * (-1278.259) (-1275.987) (-1278.778) [-1277.338] -- 0:00:27
622500 -- (-1280.436) (-1280.626) (-1281.218) [-1277.933] * (-1280.333) (-1279.888) (-1278.605) [-1277.400] -- 0:00:27
623000 -- [-1277.368] (-1277.974) (-1278.051) (-1275.583) * (-1279.340) [-1280.672] (-1277.488) (-1279.044) -- 0:00:27
623500 -- [-1279.628] (-1279.681) (-1278.309) (-1279.823) * (-1279.028) (-1280.086) (-1278.461) [-1278.438] -- 0:00:27
624000 -- [-1278.738] (-1279.690) (-1277.853) (-1278.853) * (-1280.675) [-1280.557] (-1280.367) (-1280.270) -- 0:00:28
624500 -- (-1284.671) (-1279.039) (-1278.279) [-1277.966] * [-1277.867] (-1279.420) (-1284.694) (-1277.095) -- 0:00:28
625000 -- (-1279.195) (-1277.711) [-1278.356] (-1279.774) * [-1276.581] (-1277.702) (-1279.549) (-1281.260) -- 0:00:28
Average standard deviation of split frequencies: 0.007966
625500 -- [-1277.386] (-1280.446) (-1281.944) (-1279.982) * (-1290.738) (-1281.682) (-1279.649) [-1281.319] -- 0:00:28
626000 -- (-1280.636) (-1279.728) (-1280.985) [-1280.574] * (-1280.338) (-1281.997) [-1278.244] (-1278.473) -- 0:00:28
626500 -- (-1279.198) [-1280.581] (-1280.414) (-1281.691) * [-1279.717] (-1279.231) (-1280.756) (-1282.513) -- 0:00:28
627000 -- (-1277.872) (-1279.878) (-1279.761) [-1279.099] * (-1277.779) (-1279.108) (-1280.706) [-1280.138] -- 0:00:27
627500 -- [-1277.106] (-1278.908) (-1283.586) (-1278.887) * (-1277.072) (-1278.590) [-1279.124] (-1280.041) -- 0:00:27
628000 -- (-1279.117) (-1276.716) [-1278.348] (-1277.304) * [-1281.123] (-1279.812) (-1279.979) (-1279.680) -- 0:00:27
628500 -- (-1278.907) (-1278.179) (-1278.921) [-1281.680] * (-1280.638) (-1278.456) (-1279.496) [-1277.992] -- 0:00:27
629000 -- (-1278.427) [-1280.989] (-1279.195) (-1280.319) * [-1278.380] (-1277.760) (-1279.768) (-1279.257) -- 0:00:27
629500 -- (-1279.745) [-1283.747] (-1278.751) (-1280.285) * (-1280.668) (-1278.126) [-1278.656] (-1275.466) -- 0:00:27
630000 -- [-1281.689] (-1280.041) (-1279.065) (-1282.857) * (-1281.872) [-1276.573] (-1278.384) (-1279.698) -- 0:00:27
Average standard deviation of split frequencies: 0.008183
630500 -- (-1277.695) (-1280.284) [-1277.315] (-1282.974) * [-1281.652] (-1279.324) (-1278.199) (-1281.998) -- 0:00:27
631000 -- (-1277.743) [-1279.823] (-1281.169) (-1279.392) * (-1280.633) [-1278.006] (-1278.847) (-1279.548) -- 0:00:27
631500 -- (-1278.076) (-1279.129) (-1277.796) [-1278.613] * [-1277.397] (-1276.155) (-1278.870) (-1281.043) -- 0:00:27
632000 -- (-1276.225) [-1281.712] (-1278.348) (-1278.574) * (-1278.045) (-1279.040) (-1278.434) [-1281.502] -- 0:00:27
632500 -- (-1278.575) [-1280.361] (-1277.906) (-1278.975) * (-1285.349) [-1277.605] (-1279.130) (-1282.605) -- 0:00:27
633000 -- (-1280.468) [-1278.373] (-1277.710) (-1278.860) * [-1278.848] (-1279.270) (-1278.985) (-1282.094) -- 0:00:27
633500 -- (-1277.192) [-1280.210] (-1278.523) (-1279.172) * (-1278.859) (-1278.725) (-1277.598) [-1278.029] -- 0:00:27
634000 -- [-1278.520] (-1279.252) (-1281.777) (-1281.006) * [-1279.797] (-1278.204) (-1279.225) (-1281.507) -- 0:00:27
634500 -- [-1281.004] (-1276.721) (-1278.839) (-1280.602) * (-1279.218) (-1278.540) (-1280.284) [-1278.677] -- 0:00:27
635000 -- (-1285.167) (-1277.433) (-1282.623) [-1282.088] * (-1280.627) [-1278.123] (-1278.136) (-1278.228) -- 0:00:27
Average standard deviation of split frequencies: 0.007997
635500 -- [-1277.549] (-1277.760) (-1283.741) (-1281.866) * (-1280.922) [-1280.293] (-1278.227) (-1280.301) -- 0:00:26
636000 -- (-1277.309) (-1279.321) (-1282.280) [-1280.236] * (-1279.924) [-1278.287] (-1277.483) (-1279.578) -- 0:00:26
636500 -- (-1279.058) (-1278.488) [-1278.691] (-1287.682) * (-1278.946) (-1278.327) (-1278.696) [-1278.383] -- 0:00:26
637000 -- (-1279.275) (-1279.315) (-1279.757) [-1280.006] * [-1277.970] (-1275.972) (-1282.771) (-1278.346) -- 0:00:26
637500 -- [-1283.844] (-1277.779) (-1280.263) (-1278.120) * [-1277.808] (-1277.764) (-1285.129) (-1279.213) -- 0:00:27
638000 -- [-1279.829] (-1279.470) (-1279.516) (-1279.897) * (-1278.297) (-1278.204) [-1279.508] (-1277.835) -- 0:00:27
638500 -- (-1280.114) (-1278.772) (-1279.462) [-1279.882] * [-1279.993] (-1277.682) (-1278.787) (-1280.729) -- 0:00:27
639000 -- (-1280.341) [-1288.084] (-1284.246) (-1279.984) * (-1278.714) (-1278.484) [-1280.118] (-1276.787) -- 0:00:27
639500 -- (-1279.298) (-1284.951) [-1281.611] (-1281.559) * [-1280.260] (-1277.184) (-1278.851) (-1280.326) -- 0:00:27
640000 -- [-1280.479] (-1283.709) (-1280.606) (-1281.890) * (-1277.955) [-1275.778] (-1282.956) (-1278.685) -- 0:00:26
Average standard deviation of split frequencies: 0.007900
640500 -- (-1281.241) (-1279.391) (-1282.123) [-1278.603] * (-1278.105) [-1277.882] (-1280.417) (-1278.290) -- 0:00:26
641000 -- (-1282.634) [-1278.838] (-1281.173) (-1278.459) * (-1278.603) (-1277.240) (-1278.062) [-1278.749] -- 0:00:26
641500 -- (-1282.512) (-1285.933) [-1278.730] (-1277.551) * (-1278.781) (-1278.428) (-1276.329) [-1279.999] -- 0:00:26
642000 -- (-1281.885) (-1280.026) [-1277.736] (-1279.476) * [-1282.588] (-1278.688) (-1277.607) (-1280.713) -- 0:00:26
642500 -- (-1278.326) (-1279.844) [-1280.278] (-1281.160) * [-1279.437] (-1277.917) (-1277.991) (-1285.978) -- 0:00:26
643000 -- (-1278.516) (-1281.050) (-1278.238) [-1281.718] * [-1279.254] (-1278.718) (-1277.719) (-1278.999) -- 0:00:26
643500 -- (-1279.214) [-1279.042] (-1278.580) (-1279.837) * (-1280.631) (-1277.553) [-1283.883] (-1278.190) -- 0:00:26
644000 -- (-1278.423) (-1279.939) [-1278.679] (-1280.659) * [-1278.284] (-1279.229) (-1281.539) (-1281.005) -- 0:00:26
644500 -- (-1279.279) (-1279.466) (-1277.490) [-1278.916] * (-1278.976) (-1280.583) [-1280.492] (-1281.961) -- 0:00:26
645000 -- (-1279.679) [-1278.397] (-1278.634) (-1278.566) * (-1279.194) [-1278.645] (-1281.147) (-1279.898) -- 0:00:26
Average standard deviation of split frequencies: 0.007797
645500 -- (-1278.054) [-1278.591] (-1278.682) (-1278.663) * (-1280.946) (-1278.037) [-1282.160] (-1278.741) -- 0:00:26
646000 -- [-1279.960] (-1280.508) (-1277.444) (-1278.380) * (-1279.119) (-1278.133) (-1281.510) [-1277.813] -- 0:00:26
646500 -- [-1277.646] (-1279.162) (-1277.798) (-1278.798) * [-1279.510] (-1279.908) (-1278.016) (-1277.788) -- 0:00:26
647000 -- (-1278.167) (-1281.808) (-1282.798) [-1278.115] * (-1283.472) (-1276.307) (-1280.385) [-1278.722] -- 0:00:26
647500 -- (-1277.757) [-1278.579] (-1280.975) (-1275.696) * (-1278.769) [-1279.939] (-1277.728) (-1280.984) -- 0:00:26
648000 -- (-1278.851) [-1277.053] (-1283.311) (-1279.356) * (-1282.457) (-1279.085) (-1280.459) [-1278.804] -- 0:00:26
648500 -- (-1279.912) (-1277.052) (-1279.376) [-1278.981] * (-1278.753) [-1277.524] (-1277.358) (-1278.137) -- 0:00:26
649000 -- (-1279.046) (-1277.540) [-1278.095] (-1283.164) * (-1279.913) (-1282.149) (-1279.581) [-1277.616] -- 0:00:25
649500 -- (-1279.332) [-1278.214] (-1277.735) (-1280.084) * (-1279.081) (-1281.311) [-1279.019] (-1284.128) -- 0:00:25
650000 -- (-1279.304) (-1280.024) (-1278.741) [-1280.848] * (-1278.595) (-1281.255) (-1281.002) [-1284.597] -- 0:00:25
Average standard deviation of split frequencies: 0.008084
650500 -- [-1280.708] (-1277.504) (-1278.120) (-1278.006) * (-1278.399) (-1279.692) (-1278.737) [-1281.615] -- 0:00:25
651000 -- [-1282.203] (-1279.052) (-1281.113) (-1277.569) * (-1278.455) (-1277.664) (-1277.040) [-1284.605] -- 0:00:25
651500 -- (-1278.881) (-1279.947) [-1278.768] (-1280.591) * [-1277.664] (-1277.773) (-1277.740) (-1285.364) -- 0:00:25
652000 -- (-1278.962) (-1280.545) [-1279.662] (-1279.647) * [-1281.194] (-1279.507) (-1278.446) (-1286.051) -- 0:00:26
652500 -- [-1278.734] (-1278.180) (-1282.805) (-1279.027) * (-1279.690) (-1280.496) [-1281.040] (-1279.465) -- 0:00:26
653000 -- (-1278.155) [-1277.329] (-1279.364) (-1278.974) * (-1278.059) (-1279.602) (-1280.136) [-1279.599] -- 0:00:26
653500 -- [-1277.229] (-1289.789) (-1278.417) (-1279.331) * (-1276.923) [-1279.484] (-1282.203) (-1277.846) -- 0:00:25
654000 -- (-1278.450) (-1283.014) [-1278.250] (-1278.750) * [-1278.880] (-1278.608) (-1277.921) (-1278.119) -- 0:00:25
654500 -- [-1279.304] (-1278.903) (-1279.950) (-1278.912) * (-1277.900) (-1278.597) (-1278.983) [-1279.041] -- 0:00:25
655000 -- (-1278.265) [-1277.943] (-1281.922) (-1278.732) * (-1281.406) (-1284.800) [-1278.030] (-1283.942) -- 0:00:25
Average standard deviation of split frequencies: 0.008169
655500 -- (-1279.173) [-1277.724] (-1278.784) (-1279.592) * (-1280.351) [-1279.013] (-1277.611) (-1281.767) -- 0:00:25
656000 -- (-1280.393) (-1277.952) (-1282.329) [-1277.789] * (-1283.229) (-1279.127) (-1277.570) [-1280.839] -- 0:00:25
656500 -- (-1280.798) (-1280.366) (-1278.080) [-1277.763] * (-1280.804) (-1280.084) [-1279.314] (-1280.453) -- 0:00:25
657000 -- (-1278.387) (-1279.955) (-1278.942) [-1278.656] * (-1278.702) (-1280.080) [-1279.879] (-1278.083) -- 0:00:25
657500 -- (-1282.917) (-1280.926) [-1280.212] (-1277.403) * (-1278.165) (-1278.405) (-1278.900) [-1280.802] -- 0:00:25
658000 -- (-1280.881) (-1280.331) (-1279.443) [-1278.909] * (-1281.292) (-1278.426) (-1282.577) [-1281.225] -- 0:00:25
658500 -- (-1279.360) [-1277.675] (-1278.500) (-1280.555) * [-1279.908] (-1278.658) (-1277.855) (-1277.494) -- 0:00:25
659000 -- [-1278.017] (-1278.033) (-1278.935) (-1280.759) * [-1278.426] (-1281.498) (-1279.065) (-1277.982) -- 0:00:25
659500 -- (-1282.404) [-1278.973] (-1278.835) (-1279.872) * (-1279.900) (-1279.703) (-1284.375) [-1280.082] -- 0:00:25
660000 -- [-1281.709] (-1279.103) (-1281.811) (-1281.429) * [-1278.221] (-1278.819) (-1280.963) (-1280.419) -- 0:00:25
Average standard deviation of split frequencies: 0.008337
660500 -- (-1278.789) [-1280.325] (-1280.579) (-1284.738) * (-1283.316) (-1278.750) [-1277.682] (-1279.391) -- 0:00:25
661000 -- (-1280.097) [-1279.055] (-1282.060) (-1279.743) * (-1278.237) (-1278.162) [-1281.679] (-1281.610) -- 0:00:25
661500 -- [-1276.627] (-1278.822) (-1280.336) (-1279.714) * (-1279.315) [-1278.186] (-1279.628) (-1281.706) -- 0:00:25
662000 -- (-1277.402) (-1282.574) (-1278.964) [-1280.047] * [-1278.577] (-1277.999) (-1280.686) (-1281.103) -- 0:00:25
662500 -- (-1279.557) [-1282.712] (-1277.581) (-1277.725) * (-1278.516) (-1278.304) (-1280.098) [-1278.418] -- 0:00:24
663000 -- (-1276.241) [-1279.808] (-1278.870) (-1279.215) * (-1277.930) [-1275.726] (-1279.261) (-1281.679) -- 0:00:24
663500 -- [-1278.930] (-1283.299) (-1282.917) (-1278.283) * (-1278.169) [-1278.697] (-1279.844) (-1278.563) -- 0:00:24
664000 -- (-1280.114) [-1278.949] (-1279.165) (-1282.199) * (-1279.390) [-1278.795] (-1278.307) (-1278.728) -- 0:00:24
664500 -- (-1277.346) (-1280.462) [-1278.557] (-1281.419) * (-1282.579) (-1282.451) (-1279.650) [-1280.018] -- 0:00:24
665000 -- (-1278.880) (-1278.110) (-1280.153) [-1278.148] * (-1279.824) (-1277.879) (-1282.791) [-1278.654] -- 0:00:24
Average standard deviation of split frequencies: 0.008158
665500 -- [-1277.623] (-1277.474) (-1278.944) (-1277.769) * (-1282.055) (-1278.222) (-1281.845) [-1279.034] -- 0:00:24
666000 -- (-1280.320) (-1281.403) [-1278.356] (-1279.255) * (-1281.985) (-1279.835) (-1278.532) [-1278.133] -- 0:00:24
666500 -- (-1282.695) (-1279.781) (-1281.610) [-1277.274] * [-1278.194] (-1281.200) (-1280.511) (-1286.627) -- 0:00:24
667000 -- (-1278.044) (-1279.544) (-1283.053) [-1279.236] * (-1279.312) (-1281.038) (-1276.288) [-1279.228] -- 0:00:24
667500 -- (-1281.970) (-1278.425) [-1280.954] (-1278.441) * (-1281.910) [-1279.333] (-1286.021) (-1280.557) -- 0:00:24
668000 -- [-1277.329] (-1277.242) (-1280.161) (-1275.711) * [-1284.762] (-1278.233) (-1280.972) (-1281.279) -- 0:00:24
668500 -- (-1278.809) [-1277.155] (-1282.099) (-1279.910) * (-1281.493) (-1281.861) (-1279.556) [-1278.203] -- 0:00:24
669000 -- (-1278.807) (-1278.710) [-1282.697] (-1275.045) * (-1278.577) (-1281.736) (-1278.694) [-1278.314] -- 0:00:24
669500 -- (-1280.450) (-1281.126) [-1282.146] (-1279.485) * (-1277.679) (-1281.176) (-1280.950) [-1274.981] -- 0:00:24
670000 -- (-1279.864) [-1280.659] (-1281.335) (-1279.401) * [-1278.108] (-1280.663) (-1278.937) (-1277.867) -- 0:00:24
Average standard deviation of split frequencies: 0.008287
670500 -- (-1279.869) (-1283.413) [-1278.250] (-1277.980) * (-1279.683) (-1281.273) [-1277.970] (-1278.875) -- 0:00:24
671000 -- (-1277.594) (-1278.829) (-1278.779) [-1279.650] * [-1277.852] (-1277.583) (-1278.574) (-1278.689) -- 0:00:24
671500 -- (-1279.139) (-1278.653) [-1280.021] (-1282.453) * (-1280.116) (-1280.376) (-1280.163) [-1281.690] -- 0:00:24
672000 -- [-1279.526] (-1280.943) (-1280.689) (-1280.223) * (-1279.195) (-1276.347) [-1281.989] (-1279.986) -- 0:00:24
672500 -- (-1279.046) [-1283.287] (-1279.743) (-1279.976) * (-1278.145) (-1278.254) (-1281.821) [-1279.463] -- 0:00:24
673000 -- (-1278.272) (-1279.121) [-1280.315] (-1280.386) * (-1278.038) (-1277.611) [-1281.974] (-1279.724) -- 0:00:24
673500 -- (-1279.258) (-1279.197) (-1284.306) [-1281.804] * (-1278.008) [-1278.139] (-1280.502) (-1278.437) -- 0:00:24
674000 -- (-1281.246) (-1278.747) (-1282.764) [-1279.107] * (-1278.700) (-1277.452) [-1279.751] (-1279.713) -- 0:00:24
674500 -- [-1281.072] (-1278.710) (-1282.802) (-1280.276) * [-1278.872] (-1277.361) (-1278.140) (-1282.763) -- 0:00:24
675000 -- (-1278.065) (-1277.413) (-1276.765) [-1280.781] * (-1279.433) [-1279.080] (-1277.845) (-1279.294) -- 0:00:24
Average standard deviation of split frequencies: 0.008148
675500 -- (-1278.702) [-1279.436] (-1277.726) (-1278.309) * (-1281.662) (-1281.028) (-1278.367) [-1279.637] -- 0:00:24
676000 -- [-1279.879] (-1281.046) (-1279.399) (-1278.567) * (-1281.322) (-1281.771) (-1280.381) [-1279.185] -- 0:00:23
676500 -- (-1280.795) [-1278.673] (-1279.315) (-1276.596) * (-1280.503) (-1278.374) [-1279.362] (-1279.435) -- 0:00:23
677000 -- [-1281.072] (-1278.404) (-1278.116) (-1282.321) * (-1283.128) [-1280.571] (-1280.449) (-1278.805) -- 0:00:23
677500 -- [-1277.634] (-1280.348) (-1278.519) (-1279.358) * (-1279.766) (-1281.262) (-1282.564) [-1277.709] -- 0:00:23
678000 -- (-1279.369) [-1278.042] (-1277.569) (-1283.133) * (-1281.086) (-1277.752) (-1279.616) [-1280.037] -- 0:00:23
678500 -- (-1278.809) (-1281.988) (-1280.779) [-1278.070] * (-1281.388) (-1279.219) (-1278.750) [-1280.498] -- 0:00:23
679000 -- (-1281.820) (-1279.217) [-1282.820] (-1284.531) * (-1279.189) (-1278.292) [-1279.370] (-1280.093) -- 0:00:23
679500 -- (-1279.005) (-1284.267) (-1280.593) [-1278.206] * (-1279.674) [-1278.274] (-1277.824) (-1278.372) -- 0:00:23
680000 -- (-1279.456) [-1278.517] (-1279.876) (-1277.391) * [-1277.427] (-1279.653) (-1277.501) (-1279.041) -- 0:00:23
Average standard deviation of split frequencies: 0.008274
680500 -- (-1281.853) (-1280.695) [-1278.651] (-1277.880) * (-1280.966) [-1277.887] (-1279.195) (-1281.539) -- 0:00:23
681000 -- (-1278.074) (-1284.727) (-1279.288) [-1277.169] * (-1283.750) (-1278.291) [-1280.430] (-1278.792) -- 0:00:23
681500 -- (-1277.555) (-1282.579) [-1276.666] (-1278.242) * (-1279.974) [-1282.369] (-1280.328) (-1277.599) -- 0:00:23
682000 -- (-1279.827) (-1278.790) (-1278.203) [-1282.170] * (-1279.733) (-1281.862) [-1279.494] (-1278.890) -- 0:00:23
682500 -- (-1278.541) [-1283.078] (-1277.866) (-1278.179) * (-1276.427) (-1287.119) (-1282.831) [-1280.189] -- 0:00:23
683000 -- (-1284.538) (-1277.599) [-1280.849] (-1278.788) * (-1282.752) (-1281.286) [-1278.627] (-1279.962) -- 0:00:23
683500 -- (-1279.200) (-1278.695) [-1277.758] (-1279.715) * (-1280.041) (-1279.097) (-1281.018) [-1277.830] -- 0:00:23
684000 -- [-1277.221] (-1277.655) (-1279.833) (-1279.859) * (-1281.847) (-1279.403) [-1281.590] (-1279.445) -- 0:00:23
684500 -- (-1279.728) [-1280.186] (-1280.663) (-1277.656) * (-1280.379) (-1279.230) [-1281.766] (-1280.362) -- 0:00:23
685000 -- (-1278.962) (-1282.698) (-1278.238) [-1281.656] * (-1279.456) (-1281.693) [-1279.633] (-1278.519) -- 0:00:23
Average standard deviation of split frequencies: 0.008427
685500 -- (-1277.818) (-1281.438) (-1278.918) [-1279.663] * (-1278.653) (-1278.593) (-1279.547) [-1277.867] -- 0:00:23
686000 -- (-1277.421) (-1282.973) (-1280.051) [-1278.238] * (-1279.080) (-1279.467) (-1281.705) [-1278.307] -- 0:00:23
686500 -- (-1279.314) [-1280.249] (-1277.692) (-1282.404) * (-1278.603) [-1278.731] (-1278.373) (-1280.431) -- 0:00:23
687000 -- (-1279.147) (-1277.771) (-1278.210) [-1286.849] * (-1277.957) (-1280.233) [-1278.551] (-1280.973) -- 0:00:23
687500 -- (-1277.975) (-1276.890) (-1280.710) [-1278.242] * (-1277.863) [-1281.937] (-1277.334) (-1278.712) -- 0:00:23
688000 -- (-1278.539) (-1279.467) (-1278.328) [-1277.514] * (-1278.035) [-1278.554] (-1278.437) (-1277.753) -- 0:00:23
688500 -- (-1279.095) [-1278.775] (-1277.225) (-1277.746) * (-1280.313) (-1283.440) (-1277.953) [-1277.870] -- 0:00:23
689000 -- (-1279.761) (-1277.303) (-1281.590) [-1278.115] * (-1278.960) (-1278.376) [-1278.777] (-1277.990) -- 0:00:23
689500 -- (-1277.676) (-1281.396) (-1280.364) [-1278.393] * [-1281.315] (-1278.494) (-1278.180) (-1278.741) -- 0:00:22
690000 -- (-1278.132) [-1277.525] (-1280.863) (-1279.688) * (-1280.550) (-1278.405) (-1277.917) [-1277.561] -- 0:00:22
Average standard deviation of split frequencies: 0.008298
690500 -- (-1281.470) (-1278.787) [-1281.123] (-1284.430) * [-1278.813] (-1280.521) (-1278.712) (-1278.418) -- 0:00:22
691000 -- (-1279.623) [-1277.533] (-1279.265) (-1279.087) * [-1279.870] (-1282.323) (-1280.736) (-1281.543) -- 0:00:22
691500 -- (-1278.585) (-1278.833) [-1280.220] (-1278.238) * (-1282.532) [-1279.758] (-1278.886) (-1279.078) -- 0:00:22
692000 -- (-1280.221) (-1279.489) (-1278.694) [-1277.914] * [-1277.386] (-1276.525) (-1279.517) (-1278.571) -- 0:00:23
692500 -- [-1275.455] (-1277.591) (-1281.120) (-1277.402) * (-1280.016) (-1277.080) [-1279.206] (-1278.290) -- 0:00:23
693000 -- (-1277.341) (-1281.723) [-1278.835] (-1278.397) * [-1278.024] (-1277.990) (-1278.274) (-1279.612) -- 0:00:23
693500 -- (-1278.256) [-1278.885] (-1279.142) (-1279.745) * [-1277.425] (-1279.434) (-1283.261) (-1278.090) -- 0:00:22
694000 -- [-1279.100] (-1278.508) (-1279.676) (-1279.294) * (-1279.891) [-1277.869] (-1278.820) (-1278.218) -- 0:00:22
694500 -- [-1279.467] (-1279.274) (-1278.266) (-1280.108) * (-1282.497) (-1279.118) (-1278.264) [-1279.049] -- 0:00:22
695000 -- (-1280.274) [-1280.046] (-1278.816) (-1277.624) * (-1280.721) (-1279.139) (-1277.871) [-1281.017] -- 0:00:22
Average standard deviation of split frequencies: 0.008306
695500 -- (-1281.664) (-1284.427) (-1278.376) [-1278.706] * [-1278.690] (-1278.110) (-1277.827) (-1279.922) -- 0:00:22
696000 -- [-1278.716] (-1285.404) (-1278.089) (-1279.252) * (-1277.408) [-1280.982] (-1279.888) (-1278.253) -- 0:00:22
696500 -- [-1279.125] (-1281.591) (-1278.014) (-1282.395) * (-1278.434) (-1279.273) [-1278.113] (-1278.434) -- 0:00:22
697000 -- (-1278.761) (-1282.100) [-1277.194] (-1280.559) * (-1279.683) (-1282.127) [-1277.744] (-1276.780) -- 0:00:22
697500 -- (-1277.583) (-1278.238) (-1282.749) [-1277.739] * (-1279.349) [-1278.513] (-1277.573) (-1280.638) -- 0:00:22
698000 -- (-1277.315) (-1279.552) (-1280.597) [-1279.581] * [-1278.009] (-1281.907) (-1277.779) (-1279.544) -- 0:00:22
698500 -- (-1278.054) (-1278.968) [-1277.885] (-1278.340) * (-1278.134) (-1281.493) [-1275.559] (-1280.414) -- 0:00:22
699000 -- (-1277.903) (-1278.409) (-1284.731) [-1277.639] * [-1279.690] (-1281.062) (-1279.247) (-1281.953) -- 0:00:22
699500 -- [-1277.935] (-1278.382) (-1282.461) (-1281.043) * (-1280.055) [-1277.628] (-1279.508) (-1281.449) -- 0:00:22
700000 -- (-1281.957) [-1279.134] (-1281.042) (-1277.901) * [-1278.041] (-1279.012) (-1282.224) (-1278.147) -- 0:00:22
Average standard deviation of split frequencies: 0.007755
700500 -- (-1279.783) (-1278.857) [-1279.129] (-1278.537) * [-1277.494] (-1280.740) (-1279.929) (-1279.564) -- 0:00:22
701000 -- (-1279.985) [-1278.119] (-1277.519) (-1280.167) * (-1277.396) (-1282.001) (-1278.833) [-1279.294] -- 0:00:22
701500 -- (-1280.607) [-1278.280] (-1277.437) (-1278.922) * (-1277.710) [-1279.347] (-1278.409) (-1279.632) -- 0:00:22
702000 -- (-1279.351) (-1277.401) [-1279.526] (-1278.246) * (-1278.670) (-1280.171) [-1277.936] (-1282.242) -- 0:00:22
702500 -- (-1275.618) (-1278.694) [-1279.409] (-1278.291) * (-1281.603) (-1281.190) (-1280.272) [-1280.557] -- 0:00:22
703000 -- (-1277.347) [-1278.915] (-1278.332) (-1280.827) * (-1279.439) (-1282.503) (-1279.039) [-1277.415] -- 0:00:22
703500 -- (-1278.524) (-1279.577) (-1279.827) [-1279.062] * (-1281.637) (-1280.075) [-1279.191] (-1281.452) -- 0:00:22
704000 -- [-1279.495] (-1279.546) (-1279.211) (-1281.532) * (-1279.394) (-1281.954) [-1278.871] (-1278.291) -- 0:00:22
704500 -- (-1278.626) (-1288.461) (-1278.963) [-1278.692] * (-1280.184) (-1279.395) [-1275.322] (-1278.998) -- 0:00:22
705000 -- (-1278.604) (-1283.487) [-1277.290] (-1280.095) * [-1279.835] (-1278.775) (-1278.257) (-1278.890) -- 0:00:22
Average standard deviation of split frequencies: 0.007731
705500 -- (-1278.673) (-1282.371) (-1280.515) [-1278.116] * (-1279.615) (-1277.448) [-1277.876] (-1280.183) -- 0:00:22
706000 -- (-1276.914) [-1278.017] (-1278.005) (-1280.514) * (-1278.188) (-1277.515) [-1278.634] (-1277.905) -- 0:00:22
706500 -- (-1278.497) (-1279.091) (-1277.951) [-1278.794] * (-1277.607) (-1281.146) (-1276.708) [-1278.470] -- 0:00:22
707000 -- (-1277.762) [-1276.936] (-1277.876) (-1282.496) * (-1278.331) [-1279.445] (-1276.443) (-1278.316) -- 0:00:21
707500 -- (-1279.811) [-1277.828] (-1278.382) (-1280.241) * (-1280.927) (-1278.933) (-1277.041) [-1277.935] -- 0:00:21
708000 -- (-1279.837) [-1277.605] (-1278.121) (-1280.251) * [-1281.314] (-1277.949) (-1281.340) (-1281.091) -- 0:00:21
708500 -- (-1279.094) [-1276.818] (-1277.394) (-1279.556) * (-1278.180) (-1277.578) [-1278.633] (-1279.252) -- 0:00:21
709000 -- [-1279.500] (-1279.091) (-1277.766) (-1277.629) * [-1279.105] (-1279.105) (-1280.302) (-1278.197) -- 0:00:21
709500 -- [-1282.019] (-1279.108) (-1279.132) (-1279.581) * (-1277.792) (-1278.246) (-1278.866) [-1279.733] -- 0:00:21
710000 -- (-1278.573) [-1286.199] (-1280.011) (-1280.137) * (-1277.334) [-1278.681] (-1278.553) (-1278.839) -- 0:00:21
Average standard deviation of split frequencies: 0.007506
710500 -- [-1278.121] (-1281.739) (-1277.913) (-1288.338) * (-1282.027) (-1280.572) [-1277.700] (-1280.794) -- 0:00:21
711000 -- (-1278.956) (-1281.390) (-1277.550) [-1279.705] * (-1280.414) [-1277.785] (-1281.646) (-1278.772) -- 0:00:21
711500 -- (-1278.072) (-1278.801) (-1277.142) [-1278.707] * (-1277.703) (-1278.412) (-1277.831) [-1277.576] -- 0:00:21
712000 -- (-1277.390) [-1279.947] (-1277.919) (-1279.182) * [-1277.545] (-1279.731) (-1279.163) (-1280.095) -- 0:00:21
712500 -- (-1277.616) (-1279.389) [-1277.536] (-1278.398) * (-1280.321) (-1279.448) [-1279.861] (-1280.173) -- 0:00:21
713000 -- (-1277.601) (-1277.830) [-1282.602] (-1277.988) * [-1277.689] (-1278.794) (-1278.684) (-1282.346) -- 0:00:21
713500 -- (-1277.586) [-1278.606] (-1278.312) (-1277.756) * (-1277.500) (-1277.449) [-1278.325] (-1280.606) -- 0:00:21
714000 -- [-1277.738] (-1279.687) (-1278.734) (-1284.266) * (-1281.717) [-1280.735] (-1278.439) (-1278.515) -- 0:00:21
714500 -- [-1276.793] (-1279.133) (-1277.837) (-1281.902) * (-1280.252) (-1284.204) (-1277.542) [-1278.395] -- 0:00:21
715000 -- (-1278.249) (-1279.242) (-1278.006) [-1278.790] * (-1278.723) (-1281.406) [-1278.725] (-1280.466) -- 0:00:21
Average standard deviation of split frequencies: 0.007173
715500 -- (-1279.126) [-1279.211] (-1278.466) (-1279.174) * [-1277.515] (-1279.257) (-1283.246) (-1279.133) -- 0:00:21
716000 -- (-1279.481) (-1278.082) [-1278.346] (-1281.208) * (-1280.300) (-1288.158) (-1277.395) [-1279.481] -- 0:00:21
716500 -- (-1278.289) (-1278.312) [-1278.792] (-1282.103) * (-1281.878) [-1278.551] (-1276.616) (-1278.979) -- 0:00:21
717000 -- [-1279.126] (-1277.577) (-1278.730) (-1278.121) * [-1279.730] (-1277.170) (-1279.690) (-1279.693) -- 0:00:21
717500 -- (-1280.221) (-1280.822) (-1278.865) [-1278.116] * (-1278.061) (-1280.246) (-1278.275) [-1278.974] -- 0:00:21
718000 -- (-1277.454) (-1281.904) (-1278.128) [-1276.637] * (-1280.586) (-1277.496) [-1279.711] (-1282.145) -- 0:00:21
718500 -- (-1280.905) (-1279.175) (-1277.316) [-1276.604] * [-1278.699] (-1277.458) (-1279.157) (-1280.937) -- 0:00:21
719000 -- (-1283.822) [-1277.559] (-1279.955) (-1279.169) * (-1278.865) [-1277.628] (-1277.708) (-1281.345) -- 0:00:21
719500 -- (-1280.351) [-1278.816] (-1278.792) (-1277.739) * [-1280.393] (-1278.653) (-1280.886) (-1279.724) -- 0:00:21
720000 -- (-1279.432) (-1278.799) [-1279.001] (-1280.049) * (-1277.624) (-1280.860) [-1280.246] (-1280.626) -- 0:00:20
Average standard deviation of split frequencies: 0.007264
720500 -- (-1278.574) (-1278.681) (-1276.822) [-1283.596] * (-1283.734) (-1281.126) (-1278.526) [-1276.315] -- 0:00:20
721000 -- [-1279.776] (-1281.123) (-1280.612) (-1279.373) * [-1278.664] (-1280.894) (-1279.699) (-1281.241) -- 0:00:20
721500 -- (-1279.842) [-1278.454] (-1279.323) (-1282.142) * (-1277.574) [-1281.315] (-1278.342) (-1281.339) -- 0:00:20
722000 -- (-1284.343) (-1279.856) [-1284.809] (-1277.866) * (-1277.209) [-1279.950] (-1277.346) (-1276.805) -- 0:00:20
722500 -- [-1277.145] (-1277.867) (-1277.950) (-1279.574) * (-1278.467) [-1278.025] (-1278.196) (-1278.895) -- 0:00:20
723000 -- [-1278.141] (-1278.224) (-1281.007) (-1284.073) * (-1278.677) [-1277.217] (-1281.512) (-1279.586) -- 0:00:20
723500 -- [-1278.155] (-1277.400) (-1276.885) (-1279.500) * (-1285.787) (-1276.397) [-1278.401] (-1277.885) -- 0:00:20
724000 -- (-1279.877) (-1279.422) (-1279.586) [-1282.632] * (-1275.720) (-1279.216) (-1278.757) [-1276.009] -- 0:00:20
724500 -- (-1278.234) (-1278.173) [-1277.962] (-1279.178) * (-1277.397) (-1279.033) (-1279.003) [-1277.225] -- 0:00:20
725000 -- (-1282.809) (-1277.612) [-1277.956] (-1283.317) * [-1278.104] (-1277.403) (-1279.335) (-1279.590) -- 0:00:20
Average standard deviation of split frequencies: 0.007518
725500 -- [-1277.337] (-1277.270) (-1283.546) (-1280.210) * (-1281.507) (-1278.497) [-1280.087] (-1276.659) -- 0:00:20
726000 -- [-1278.065] (-1278.921) (-1279.745) (-1278.414) * [-1279.699] (-1279.725) (-1279.375) (-1279.904) -- 0:00:20
726500 -- (-1278.769) (-1276.853) (-1278.722) [-1279.045] * (-1282.248) [-1277.965] (-1277.753) (-1277.134) -- 0:00:20
727000 -- (-1278.003) (-1278.349) (-1279.722) [-1277.272] * (-1278.973) (-1278.427) [-1278.391] (-1277.976) -- 0:00:20
727500 -- (-1276.724) (-1278.661) [-1280.297] (-1279.154) * [-1279.184] (-1280.376) (-1278.735) (-1281.158) -- 0:00:20
728000 -- [-1278.125] (-1278.283) (-1279.597) (-1281.167) * (-1278.481) [-1279.162] (-1280.286) (-1281.445) -- 0:00:20
728500 -- [-1280.465] (-1279.141) (-1280.514) (-1279.178) * (-1278.656) (-1279.250) [-1279.935] (-1281.187) -- 0:00:20
729000 -- (-1277.538) [-1279.988] (-1280.039) (-1285.176) * (-1280.919) (-1278.519) (-1280.543) [-1278.201] -- 0:00:20
729500 -- (-1278.765) (-1284.757) (-1278.781) [-1280.846] * (-1278.071) (-1278.446) (-1277.939) [-1278.061] -- 0:00:20
730000 -- (-1282.093) [-1287.307] (-1278.471) (-1279.649) * (-1278.014) [-1280.713] (-1277.949) (-1277.363) -- 0:00:20
Average standard deviation of split frequencies: 0.007335
730500 -- (-1278.129) (-1278.531) (-1277.961) [-1280.534] * [-1277.781] (-1279.317) (-1278.131) (-1276.607) -- 0:00:20
731000 -- (-1279.131) (-1279.930) (-1278.677) [-1277.531] * (-1279.485) (-1279.265) [-1279.349] (-1279.108) -- 0:00:20
731500 -- (-1277.587) (-1279.898) (-1278.590) [-1278.543] * (-1280.796) (-1279.815) (-1278.292) [-1280.245] -- 0:00:20
732000 -- (-1277.219) [-1280.098] (-1280.150) (-1276.950) * (-1278.342) [-1279.122] (-1278.531) (-1278.389) -- 0:00:20
732500 -- (-1279.714) [-1279.906] (-1282.146) (-1277.497) * [-1277.700] (-1277.916) (-1281.821) (-1280.439) -- 0:00:20
733000 -- [-1279.121] (-1280.593) (-1280.718) (-1280.022) * (-1278.260) (-1278.982) [-1279.520] (-1278.552) -- 0:00:20
733500 -- [-1278.299] (-1277.546) (-1277.418) (-1277.329) * [-1279.276] (-1280.461) (-1279.680) (-1277.638) -- 0:00:19
734000 -- [-1279.397] (-1278.553) (-1276.111) (-1279.144) * (-1282.076) (-1277.500) [-1279.535] (-1280.369) -- 0:00:19
734500 -- (-1280.661) (-1280.717) (-1277.286) [-1279.369] * (-1283.583) (-1281.795) (-1278.708) [-1279.613] -- 0:00:19
735000 -- (-1280.193) (-1279.108) (-1279.288) [-1279.714] * [-1280.907] (-1277.580) (-1281.746) (-1281.430) -- 0:00:19
Average standard deviation of split frequencies: 0.007248
735500 -- [-1278.760] (-1281.190) (-1278.753) (-1280.507) * (-1279.197) (-1284.092) (-1281.809) [-1277.998] -- 0:00:19
736000 -- [-1278.737] (-1281.874) (-1278.196) (-1277.656) * [-1278.071] (-1278.982) (-1279.214) (-1278.400) -- 0:00:19
736500 -- (-1279.103) (-1278.803) [-1277.832] (-1279.588) * (-1279.003) (-1280.919) (-1278.295) [-1278.268] -- 0:00:19
737000 -- [-1279.221] (-1282.602) (-1277.355) (-1279.543) * [-1278.176] (-1281.341) (-1283.589) (-1279.532) -- 0:00:19
737500 -- (-1280.093) (-1279.825) [-1276.998] (-1277.166) * (-1278.436) (-1280.125) [-1277.285] (-1277.503) -- 0:00:19
738000 -- (-1281.992) (-1278.875) (-1276.275) [-1277.480] * [-1278.311] (-1279.300) (-1278.804) (-1279.763) -- 0:00:19
738500 -- [-1276.522] (-1284.886) (-1277.661) (-1277.905) * (-1278.626) (-1283.095) (-1279.284) [-1277.937] -- 0:00:19
739000 -- [-1279.927] (-1279.796) (-1279.037) (-1276.493) * (-1278.390) (-1279.338) [-1279.703] (-1277.908) -- 0:00:19
739500 -- (-1277.123) (-1278.842) (-1279.336) [-1277.730] * [-1279.318] (-1283.244) (-1278.483) (-1278.749) -- 0:00:19
740000 -- [-1280.921] (-1280.028) (-1283.940) (-1278.752) * (-1283.493) (-1282.779) [-1276.452] (-1279.414) -- 0:00:19
Average standard deviation of split frequencies: 0.007001
740500 -- (-1281.216) (-1282.316) (-1278.771) [-1278.977] * [-1281.158] (-1280.517) (-1282.315) (-1277.813) -- 0:00:19
741000 -- (-1278.500) (-1279.647) [-1278.642] (-1284.670) * [-1279.238] (-1281.677) (-1279.417) (-1278.275) -- 0:00:19
741500 -- [-1278.602] (-1279.288) (-1279.250) (-1281.027) * [-1278.091] (-1280.244) (-1278.860) (-1282.935) -- 0:00:19
742000 -- (-1278.744) (-1279.772) (-1281.725) [-1277.937] * (-1279.528) (-1282.306) [-1278.874] (-1283.912) -- 0:00:19
742500 -- [-1277.665] (-1282.417) (-1279.326) (-1279.226) * (-1282.032) (-1280.264) [-1281.309] (-1280.243) -- 0:00:19
743000 -- [-1279.093] (-1282.305) (-1278.330) (-1278.071) * (-1278.242) (-1281.943) [-1279.045] (-1287.262) -- 0:00:19
743500 -- (-1277.679) (-1279.991) [-1279.777] (-1280.117) * [-1281.038] (-1277.818) (-1278.035) (-1277.239) -- 0:00:19
744000 -- (-1278.704) (-1282.676) [-1278.126] (-1278.874) * (-1276.913) (-1281.163) (-1283.909) [-1277.951] -- 0:00:19
744500 -- [-1278.627] (-1283.844) (-1277.811) (-1281.440) * (-1278.441) (-1280.069) (-1280.777) [-1279.434] -- 0:00:19
745000 -- (-1277.912) [-1279.684] (-1278.871) (-1279.771) * (-1280.055) (-1282.043) [-1281.484] (-1281.038) -- 0:00:19
Average standard deviation of split frequencies: 0.006851
745500 -- [-1279.736] (-1278.688) (-1281.099) (-1280.059) * (-1277.858) [-1281.720] (-1282.236) (-1283.240) -- 0:00:19
746000 -- [-1278.773] (-1280.783) (-1277.783) (-1277.782) * (-1280.698) (-1279.158) (-1285.561) [-1277.527] -- 0:00:19
746500 -- [-1279.191] (-1278.171) (-1279.991) (-1280.936) * (-1280.282) (-1278.898) (-1279.390) [-1278.062] -- 0:00:19
747000 -- (-1277.650) (-1279.099) [-1280.253] (-1280.010) * [-1280.087] (-1278.000) (-1280.061) (-1277.577) -- 0:00:18
747500 -- [-1277.725] (-1279.541) (-1281.223) (-1281.075) * (-1279.337) (-1281.156) (-1278.886) [-1279.333] -- 0:00:18
748000 -- (-1276.910) [-1279.834] (-1279.664) (-1278.090) * (-1280.266) (-1280.105) (-1278.984) [-1279.069] -- 0:00:18
748500 -- (-1277.568) [-1279.036] (-1278.847) (-1279.963) * (-1277.950) [-1281.580] (-1279.920) (-1278.145) -- 0:00:18
749000 -- (-1280.710) (-1277.230) [-1277.774] (-1279.949) * (-1278.350) (-1280.653) [-1280.055] (-1277.610) -- 0:00:18
749500 -- (-1281.548) [-1279.649] (-1279.803) (-1278.691) * (-1278.909) (-1280.863) (-1278.140) [-1278.791] -- 0:00:18
750000 -- (-1280.313) (-1283.733) [-1280.197] (-1278.295) * (-1282.286) (-1280.853) (-1280.902) [-1277.842] -- 0:00:18
Average standard deviation of split frequencies: 0.006610
750500 -- (-1278.843) [-1277.728] (-1278.942) (-1278.302) * [-1282.542] (-1281.637) (-1283.826) (-1283.226) -- 0:00:18
751000 -- (-1280.396) (-1279.532) [-1280.178] (-1278.008) * [-1277.765] (-1280.465) (-1281.810) (-1279.496) -- 0:00:18
751500 -- (-1281.768) (-1278.210) [-1279.427] (-1278.107) * (-1277.432) (-1280.711) (-1279.899) [-1276.804] -- 0:00:18
752000 -- (-1281.899) (-1277.953) (-1277.324) [-1278.572] * [-1277.921] (-1279.280) (-1280.124) (-1286.271) -- 0:00:18
752500 -- (-1279.732) [-1276.363] (-1284.750) (-1278.987) * [-1280.856] (-1279.628) (-1282.637) (-1278.385) -- 0:00:18
753000 -- (-1278.522) [-1277.127] (-1280.862) (-1280.466) * (-1279.753) (-1277.341) (-1280.508) [-1281.692] -- 0:00:18
753500 -- (-1278.942) [-1277.769] (-1280.901) (-1279.483) * [-1277.755] (-1278.721) (-1278.905) (-1282.465) -- 0:00:18
754000 -- (-1282.149) [-1282.084] (-1279.616) (-1285.194) * (-1278.461) (-1279.561) (-1278.640) [-1281.099] -- 0:00:18
754500 -- (-1279.468) [-1282.643] (-1279.012) (-1283.736) * (-1277.475) [-1278.757] (-1283.592) (-1277.565) -- 0:00:18
755000 -- [-1278.255] (-1282.966) (-1280.221) (-1278.336) * (-1277.530) (-1278.716) [-1278.441] (-1281.736) -- 0:00:18
Average standard deviation of split frequencies: 0.006104
755500 -- (-1280.936) [-1282.414] (-1281.722) (-1286.934) * [-1277.632] (-1276.638) (-1278.881) (-1279.361) -- 0:00:18
756000 -- (-1282.446) (-1278.411) [-1281.518] (-1284.760) * (-1279.972) (-1279.819) [-1278.605] (-1279.831) -- 0:00:18
756500 -- (-1285.398) (-1279.221) [-1278.711] (-1279.215) * (-1279.756) [-1278.334] (-1283.091) (-1280.849) -- 0:00:18
757000 -- (-1282.561) (-1278.860) (-1276.909) [-1279.787] * (-1282.686) (-1280.003) (-1282.376) [-1280.880] -- 0:00:18
757500 -- [-1280.486] (-1280.177) (-1279.256) (-1281.896) * (-1285.744) (-1279.250) (-1282.627) [-1278.718] -- 0:00:18
758000 -- [-1281.446] (-1280.670) (-1277.857) (-1277.463) * (-1278.759) [-1279.586] (-1283.706) (-1280.744) -- 0:00:18
758500 -- (-1279.728) (-1277.447) [-1277.137] (-1278.982) * (-1276.768) (-1278.810) (-1281.271) [-1279.095] -- 0:00:18
759000 -- (-1279.714) (-1280.701) [-1278.779] (-1279.623) * (-1281.772) [-1279.465] (-1281.382) (-1277.948) -- 0:00:18
759500 -- [-1280.365] (-1278.934) (-1281.541) (-1279.900) * (-1278.103) (-1281.236) (-1279.183) [-1276.683] -- 0:00:18
760000 -- (-1278.596) [-1279.006] (-1278.802) (-1280.987) * [-1278.588] (-1279.581) (-1277.419) (-1282.077) -- 0:00:18
Average standard deviation of split frequencies: 0.006197
760500 -- [-1277.536] (-1280.955) (-1278.816) (-1277.810) * [-1278.819] (-1280.083) (-1281.289) (-1279.785) -- 0:00:17
761000 -- (-1278.499) (-1279.742) (-1278.469) [-1278.159] * (-1277.391) (-1278.893) [-1277.071] (-1279.788) -- 0:00:17
761500 -- [-1279.058] (-1278.978) (-1277.907) (-1278.370) * (-1281.566) (-1277.866) (-1282.550) [-1278.371] -- 0:00:17
762000 -- (-1278.464) (-1278.471) [-1278.132] (-1281.288) * (-1278.696) (-1278.907) (-1280.684) [-1279.088] -- 0:00:17
762500 -- (-1278.120) [-1277.171] (-1277.272) (-1281.397) * (-1278.298) (-1277.897) [-1278.623] (-1277.744) -- 0:00:17
763000 -- [-1278.022] (-1280.056) (-1281.663) (-1285.187) * [-1278.490] (-1277.639) (-1282.381) (-1280.345) -- 0:00:17
763500 -- (-1280.307) [-1281.427] (-1282.193) (-1284.045) * (-1281.904) (-1277.792) [-1281.804] (-1281.283) -- 0:00:17
764000 -- [-1279.846] (-1278.166) (-1277.482) (-1278.906) * [-1278.747] (-1278.684) (-1281.218) (-1278.507) -- 0:00:17
764500 -- [-1277.814] (-1280.084) (-1278.559) (-1277.184) * (-1279.814) (-1279.529) (-1276.727) [-1279.134] -- 0:00:17
765000 -- (-1279.436) [-1278.246] (-1279.841) (-1279.269) * [-1278.470] (-1281.538) (-1277.406) (-1278.450) -- 0:00:17
Average standard deviation of split frequencies: 0.006219
765500 -- (-1279.662) (-1277.473) (-1279.933) [-1278.282] * (-1277.305) (-1281.185) (-1281.510) [-1280.474] -- 0:00:17
766000 -- (-1282.285) (-1277.166) [-1278.384] (-1280.213) * [-1280.200] (-1278.750) (-1278.001) (-1280.632) -- 0:00:17
766500 -- (-1278.178) (-1276.125) [-1279.777] (-1277.647) * (-1276.876) (-1277.948) (-1282.532) [-1280.433] -- 0:00:17
767000 -- [-1277.893] (-1276.345) (-1278.930) (-1278.750) * (-1277.408) (-1279.593) [-1278.950] (-1281.537) -- 0:00:17
767500 -- [-1278.136] (-1277.414) (-1281.624) (-1278.359) * (-1280.684) (-1286.454) (-1278.476) [-1278.249] -- 0:00:17
768000 -- (-1278.557) (-1278.510) [-1278.539] (-1278.653) * (-1281.835) [-1279.121] (-1281.040) (-1278.197) -- 0:00:17
768500 -- (-1278.119) (-1279.573) [-1278.910] (-1277.595) * (-1283.343) (-1283.368) (-1277.819) [-1279.890] -- 0:00:17
769000 -- (-1278.262) [-1280.280] (-1277.822) (-1278.845) * (-1279.760) (-1280.785) [-1277.973] (-1277.634) -- 0:00:17
769500 -- (-1278.318) (-1278.292) (-1281.863) [-1278.435] * (-1277.987) (-1278.604) [-1279.587] (-1277.493) -- 0:00:17
770000 -- (-1277.698) (-1281.662) (-1279.583) [-1277.495] * [-1278.861] (-1278.560) (-1279.617) (-1282.049) -- 0:00:17
Average standard deviation of split frequencies: 0.006052
770500 -- (-1279.601) [-1279.733] (-1284.735) (-1277.023) * (-1278.931) [-1278.431] (-1282.012) (-1278.821) -- 0:00:17
771000 -- (-1278.242) (-1279.789) (-1280.893) [-1280.522] * (-1282.382) (-1278.935) [-1281.048] (-1276.637) -- 0:00:17
771500 -- (-1278.320) (-1279.152) [-1280.407] (-1277.627) * (-1282.089) [-1276.505] (-1280.612) (-1278.010) -- 0:00:17
772000 -- (-1279.043) (-1278.923) (-1280.388) [-1277.664] * (-1283.673) [-1278.261] (-1281.933) (-1278.444) -- 0:00:17
772500 -- [-1276.269] (-1279.391) (-1278.380) (-1279.528) * (-1280.426) (-1278.792) (-1282.128) [-1276.314] -- 0:00:17
773000 -- [-1276.160] (-1279.248) (-1278.285) (-1279.488) * (-1278.645) (-1285.139) [-1283.448] (-1277.584) -- 0:00:17
773500 -- (-1279.545) (-1278.170) [-1277.472] (-1278.427) * [-1278.666] (-1280.253) (-1290.472) (-1278.962) -- 0:00:16
774000 -- [-1280.671] (-1278.585) (-1277.359) (-1280.570) * (-1277.931) (-1278.391) (-1287.938) [-1280.048] -- 0:00:16
774500 -- (-1280.197) (-1279.732) [-1277.647] (-1281.665) * (-1277.927) (-1276.858) (-1282.490) [-1278.348] -- 0:00:16
775000 -- [-1279.853] (-1279.155) (-1278.617) (-1278.680) * [-1278.330] (-1278.105) (-1277.735) (-1274.897) -- 0:00:16
Average standard deviation of split frequencies: 0.005819
775500 -- (-1281.319) [-1280.603] (-1278.413) (-1281.829) * (-1283.214) (-1281.540) [-1281.591] (-1277.051) -- 0:00:16
776000 -- [-1278.892] (-1277.374) (-1279.751) (-1279.675) * (-1278.207) (-1277.731) [-1280.871] (-1278.459) -- 0:00:16
776500 -- [-1276.673] (-1277.747) (-1279.993) (-1278.702) * (-1278.272) (-1285.749) (-1278.970) [-1277.786] -- 0:00:16
777000 -- [-1278.011] (-1278.302) (-1279.713) (-1277.977) * (-1280.550) (-1282.724) (-1281.607) [-1278.510] -- 0:00:16
777500 -- [-1276.400] (-1278.280) (-1278.996) (-1279.017) * (-1278.464) (-1277.844) [-1276.892] (-1278.103) -- 0:00:16
778000 -- [-1279.121] (-1278.617) (-1278.488) (-1279.318) * (-1280.346) (-1278.063) [-1281.821] (-1278.289) -- 0:00:16
778500 -- [-1277.243] (-1277.024) (-1279.047) (-1278.092) * (-1280.620) [-1279.352] (-1279.060) (-1280.158) -- 0:00:16
779000 -- (-1279.580) (-1278.251) (-1278.418) [-1277.633] * (-1280.704) (-1278.817) [-1277.805] (-1279.102) -- 0:00:16
779500 -- (-1278.212) (-1278.245) (-1277.982) [-1278.185] * (-1279.143) (-1280.168) (-1278.459) [-1278.055] -- 0:00:16
780000 -- (-1277.972) (-1279.664) (-1280.026) [-1278.282] * [-1278.751] (-1281.685) (-1278.785) (-1278.102) -- 0:00:16
Average standard deviation of split frequencies: 0.005117
780500 -- [-1275.151] (-1279.541) (-1280.257) (-1279.458) * (-1278.114) (-1279.658) (-1284.528) [-1279.143] -- 0:00:16
781000 -- [-1279.936] (-1278.234) (-1277.683) (-1277.828) * (-1278.443) [-1280.309] (-1281.254) (-1279.378) -- 0:00:16
781500 -- (-1278.973) (-1279.732) [-1278.871] (-1282.501) * [-1282.929] (-1280.415) (-1286.790) (-1278.737) -- 0:00:16
782000 -- [-1277.592] (-1279.257) (-1277.120) (-1280.178) * (-1281.493) [-1278.955] (-1280.190) (-1277.407) -- 0:00:16
782500 -- (-1278.966) [-1278.674] (-1278.855) (-1282.179) * (-1279.221) (-1279.387) [-1279.368] (-1280.170) -- 0:00:16
783000 -- (-1281.361) (-1279.086) [-1278.061] (-1278.395) * (-1279.773) [-1277.863] (-1279.920) (-1279.428) -- 0:00:16
783500 -- [-1278.189] (-1278.061) (-1278.965) (-1279.251) * (-1281.905) (-1278.395) (-1277.297) [-1281.355] -- 0:00:16
784000 -- (-1280.608) (-1281.006) [-1277.190] (-1278.875) * (-1281.182) (-1279.125) [-1278.667] (-1280.481) -- 0:00:16
784500 -- (-1280.039) (-1281.383) (-1278.599) [-1278.183] * [-1277.118] (-1279.522) (-1280.841) (-1280.947) -- 0:00:16
785000 -- [-1279.750] (-1279.371) (-1278.892) (-1279.997) * (-1278.739) (-1277.302) (-1281.993) [-1278.010] -- 0:00:16
Average standard deviation of split frequencies: 0.005082
785500 -- (-1281.227) [-1279.141] (-1279.815) (-1279.442) * (-1277.212) (-1279.757) [-1279.577] (-1278.233) -- 0:00:16
786000 -- (-1285.209) (-1278.484) [-1277.581] (-1279.494) * (-1276.089) (-1279.318) [-1277.967] (-1278.315) -- 0:00:16
786500 -- (-1278.602) (-1278.518) (-1277.893) [-1279.666] * (-1279.777) (-1278.346) (-1278.173) [-1277.767] -- 0:00:16
787000 -- (-1280.976) [-1278.127] (-1281.353) (-1277.974) * (-1280.661) (-1281.071) (-1277.937) [-1278.550] -- 0:00:15
787500 -- (-1280.134) [-1278.100] (-1279.680) (-1280.227) * [-1277.910] (-1280.791) (-1279.428) (-1280.201) -- 0:00:15
788000 -- (-1278.622) [-1278.497] (-1278.907) (-1283.240) * (-1278.996) (-1280.054) [-1275.265] (-1278.090) -- 0:00:15
788500 -- (-1282.184) (-1278.125) [-1278.435] (-1279.213) * (-1281.522) (-1278.286) [-1278.403] (-1278.684) -- 0:00:15
789000 -- (-1283.603) [-1278.159] (-1279.263) (-1278.072) * [-1278.931] (-1278.193) (-1280.555) (-1278.452) -- 0:00:15
789500 -- (-1281.087) (-1278.782) (-1280.264) [-1278.081] * (-1278.430) (-1278.468) (-1278.141) [-1278.219] -- 0:00:15
790000 -- (-1278.121) (-1278.564) [-1277.619] (-1277.395) * (-1278.665) (-1277.533) [-1285.249] (-1278.336) -- 0:00:15
Average standard deviation of split frequencies: 0.004707
790500 -- [-1278.418] (-1279.004) (-1277.488) (-1278.030) * (-1278.702) (-1277.649) (-1279.952) [-1276.009] -- 0:00:15
791000 -- (-1278.271) [-1278.138] (-1279.035) (-1279.641) * [-1278.174] (-1277.972) (-1279.194) (-1279.362) -- 0:00:15
791500 -- (-1281.827) (-1279.732) (-1277.949) [-1278.349] * (-1276.736) [-1277.460] (-1280.039) (-1280.325) -- 0:00:15
792000 -- (-1281.570) [-1280.886] (-1276.891) (-1281.690) * (-1279.604) (-1280.789) (-1278.468) [-1278.207] -- 0:00:15
792500 -- (-1277.688) (-1278.344) (-1278.770) [-1281.071] * (-1279.667) (-1285.605) (-1280.473) [-1278.683] -- 0:00:15
793000 -- (-1278.349) [-1277.720] (-1278.875) (-1280.305) * (-1279.553) (-1285.710) (-1280.432) [-1278.060] -- 0:00:15
793500 -- [-1277.561] (-1279.341) (-1280.936) (-1279.151) * (-1280.407) (-1279.475) [-1278.362] (-1280.777) -- 0:00:15
794000 -- (-1278.363) (-1278.269) (-1280.263) [-1278.385] * [-1278.694] (-1279.588) (-1279.990) (-1279.915) -- 0:00:15
794500 -- (-1280.801) (-1279.990) (-1279.294) [-1281.372] * (-1280.941) (-1282.162) (-1282.337) [-1282.519] -- 0:00:15
795000 -- (-1280.979) (-1281.077) (-1284.237) [-1280.896] * [-1278.618] (-1277.954) (-1277.771) (-1279.752) -- 0:00:15
Average standard deviation of split frequencies: 0.004862
795500 -- (-1278.505) [-1281.644] (-1279.422) (-1280.589) * (-1279.870) [-1280.705] (-1279.276) (-1278.708) -- 0:00:15
796000 -- (-1282.715) [-1281.434] (-1283.527) (-1278.181) * (-1278.954) (-1278.437) [-1278.446] (-1282.046) -- 0:00:15
796500 -- [-1277.825] (-1280.927) (-1279.929) (-1278.777) * (-1277.480) [-1280.622] (-1278.914) (-1279.419) -- 0:00:15
797000 -- [-1281.701] (-1282.895) (-1279.455) (-1278.526) * [-1277.714] (-1279.851) (-1279.220) (-1277.138) -- 0:00:15
797500 -- (-1280.956) (-1279.019) [-1276.970] (-1278.107) * [-1275.169] (-1279.340) (-1278.757) (-1277.619) -- 0:00:15
798000 -- [-1279.798] (-1287.214) (-1278.997) (-1283.447) * [-1277.901] (-1281.395) (-1278.774) (-1277.580) -- 0:00:15
798500 -- (-1279.079) (-1282.861) [-1278.730] (-1278.549) * (-1279.651) (-1281.804) (-1277.558) [-1279.693] -- 0:00:15
799000 -- (-1280.701) [-1281.577] (-1278.663) (-1280.355) * [-1279.218] (-1278.999) (-1280.303) (-1280.146) -- 0:00:15
799500 -- [-1278.294] (-1277.497) (-1278.346) (-1279.523) * (-1277.727) (-1281.445) (-1277.818) [-1278.137] -- 0:00:15
800000 -- (-1278.517) [-1279.738] (-1278.916) (-1278.594) * (-1281.194) (-1277.874) (-1281.500) [-1278.806] -- 0:00:14
Average standard deviation of split frequencies: 0.004865
800500 -- [-1282.424] (-1282.445) (-1279.159) (-1278.157) * [-1275.526] (-1278.887) (-1278.440) (-1277.092) -- 0:00:14
801000 -- (-1281.538) (-1279.677) (-1277.790) [-1279.609] * (-1278.945) [-1277.150] (-1281.417) (-1280.309) -- 0:00:14
801500 -- (-1282.708) [-1279.609] (-1277.862) (-1280.182) * (-1278.974) (-1278.637) (-1280.240) [-1279.871] -- 0:00:14
802000 -- (-1278.697) [-1277.195] (-1278.726) (-1279.480) * (-1282.666) (-1279.242) (-1277.992) [-1279.883] -- 0:00:14
802500 -- (-1280.193) (-1277.841) (-1279.962) [-1281.526] * [-1280.873] (-1278.520) (-1280.672) (-1280.400) -- 0:00:14
803000 -- (-1278.596) [-1278.736] (-1277.362) (-1278.992) * (-1276.328) (-1276.935) [-1279.891] (-1278.001) -- 0:00:14
803500 -- (-1278.420) (-1278.054) (-1281.557) [-1278.220] * [-1278.714] (-1278.531) (-1278.506) (-1278.362) -- 0:00:14
804000 -- [-1278.694] (-1281.215) (-1282.020) (-1281.847) * (-1285.066) (-1279.722) (-1279.768) [-1278.282] -- 0:00:14
804500 -- (-1277.121) (-1278.036) [-1280.634] (-1280.876) * (-1282.191) (-1277.945) [-1281.991] (-1278.953) -- 0:00:14
805000 -- (-1279.578) (-1281.470) (-1277.874) [-1278.058] * (-1277.781) (-1278.021) (-1277.534) [-1275.345] -- 0:00:14
Average standard deviation of split frequencies: 0.004771
805500 -- (-1277.367) (-1278.319) [-1276.969] (-1278.809) * (-1277.908) [-1277.974] (-1276.989) (-1276.747) -- 0:00:14
806000 -- (-1278.431) (-1278.615) (-1278.116) [-1280.236] * [-1278.197] (-1278.620) (-1279.231) (-1283.047) -- 0:00:14
806500 -- (-1279.553) [-1276.293] (-1278.048) (-1279.411) * (-1278.572) (-1278.698) [-1278.225] (-1282.312) -- 0:00:14
807000 -- (-1278.915) [-1279.257] (-1278.321) (-1282.148) * [-1281.736] (-1278.996) (-1280.140) (-1277.759) -- 0:00:14
807500 -- [-1278.638] (-1278.633) (-1285.549) (-1280.633) * (-1280.358) (-1283.747) (-1278.171) [-1278.848] -- 0:00:14
808000 -- [-1277.743] (-1278.085) (-1280.111) (-1277.752) * (-1277.432) (-1278.999) [-1278.850] (-1278.973) -- 0:00:14
808500 -- (-1278.060) (-1278.154) [-1280.411] (-1278.419) * (-1282.797) (-1278.866) (-1277.467) [-1278.932] -- 0:00:14
809000 -- (-1281.503) (-1278.710) (-1278.464) [-1278.077] * (-1280.934) (-1281.004) (-1278.348) [-1277.608] -- 0:00:14
809500 -- [-1280.691] (-1279.838) (-1279.167) (-1278.199) * (-1280.427) [-1279.529] (-1277.172) (-1278.367) -- 0:00:14
810000 -- [-1282.918] (-1281.518) (-1280.000) (-1278.274) * (-1278.067) (-1280.849) (-1277.483) [-1277.653] -- 0:00:14
Average standard deviation of split frequencies: 0.004927
810500 -- (-1282.146) (-1283.071) [-1278.028] (-1282.368) * (-1278.469) (-1283.117) [-1278.231] (-1279.762) -- 0:00:14
811000 -- (-1279.808) (-1280.262) [-1281.784] (-1279.182) * (-1278.453) (-1279.231) (-1279.113) [-1276.894] -- 0:00:14
811500 -- (-1278.859) (-1279.760) [-1279.928] (-1282.365) * (-1283.437) (-1280.888) (-1279.934) [-1279.579] -- 0:00:14
812000 -- (-1277.810) (-1281.761) [-1277.506] (-1279.822) * (-1280.774) (-1280.944) [-1277.999] (-1281.654) -- 0:00:14
812500 -- (-1282.117) [-1280.283] (-1280.364) (-1279.810) * (-1279.135) [-1280.421] (-1279.365) (-1279.934) -- 0:00:14
813000 -- [-1279.455] (-1279.976) (-1279.945) (-1279.341) * (-1279.236) (-1283.049) (-1280.148) [-1279.145] -- 0:00:14
813500 -- (-1278.373) (-1285.914) [-1279.222] (-1276.934) * [-1278.860] (-1283.560) (-1282.147) (-1277.525) -- 0:00:13
814000 -- [-1278.792] (-1282.071) (-1280.863) (-1280.875) * [-1278.304] (-1279.791) (-1283.262) (-1281.182) -- 0:00:13
814500 -- (-1279.136) [-1278.245] (-1278.879) (-1281.434) * (-1281.574) (-1278.600) [-1280.139] (-1280.824) -- 0:00:13
815000 -- (-1279.968) (-1281.330) (-1279.292) [-1278.658] * [-1280.110] (-1277.015) (-1282.588) (-1279.312) -- 0:00:13
Average standard deviation of split frequencies: 0.005047
815500 -- (-1281.431) (-1278.341) (-1278.534) [-1277.485] * (-1281.828) [-1280.465] (-1278.881) (-1282.842) -- 0:00:13
816000 -- (-1279.521) [-1279.954] (-1279.803) (-1279.319) * (-1281.515) [-1276.150] (-1278.795) (-1279.681) -- 0:00:13
816500 -- (-1279.397) [-1277.248] (-1281.724) (-1281.591) * (-1279.140) (-1278.594) [-1277.852] (-1283.766) -- 0:00:13
817000 -- (-1278.276) (-1279.440) [-1280.914] (-1278.846) * (-1280.248) [-1279.102] (-1280.609) (-1282.211) -- 0:00:13
817500 -- (-1278.942) [-1277.466] (-1277.933) (-1276.786) * (-1280.050) (-1283.355) [-1277.726] (-1278.856) -- 0:00:13
818000 -- (-1280.015) [-1278.497] (-1278.341) (-1278.703) * (-1280.974) (-1278.004) [-1277.944] (-1281.115) -- 0:00:13
818500 -- (-1278.255) (-1279.070) (-1279.190) [-1277.281] * (-1278.764) (-1280.870) (-1277.672) [-1277.656] -- 0:00:13
819000 -- (-1275.323) (-1282.425) [-1278.946] (-1277.419) * (-1280.262) (-1278.153) (-1279.000) [-1278.927] -- 0:00:13
819500 -- (-1278.399) (-1279.073) [-1279.666] (-1277.900) * (-1283.978) [-1279.637] (-1279.342) (-1279.958) -- 0:00:13
820000 -- (-1281.123) [-1278.678] (-1281.829) (-1279.515) * (-1280.762) [-1278.825] (-1278.733) (-1279.181) -- 0:00:13
Average standard deviation of split frequencies: 0.004958
820500 -- (-1282.849) (-1277.713) [-1281.094] (-1278.228) * (-1281.440) (-1279.865) [-1276.767] (-1279.386) -- 0:00:13
821000 -- (-1281.731) (-1277.792) [-1279.875] (-1277.150) * (-1280.657) (-1278.342) [-1279.044] (-1279.501) -- 0:00:13
821500 -- (-1278.486) (-1279.002) (-1281.647) [-1278.410] * (-1280.261) (-1278.158) [-1281.298] (-1279.885) -- 0:00:13
822000 -- (-1278.489) [-1277.912] (-1278.842) (-1276.912) * (-1278.446) [-1278.117] (-1277.945) (-1279.715) -- 0:00:13
822500 -- (-1278.113) [-1282.263] (-1285.451) (-1280.571) * (-1279.007) (-1280.799) (-1278.075) [-1279.407] -- 0:00:13
823000 -- (-1277.663) [-1278.679] (-1278.150) (-1278.179) * (-1279.048) (-1277.761) [-1279.315] (-1281.229) -- 0:00:13
823500 -- [-1278.930] (-1278.050) (-1280.016) (-1281.235) * (-1277.760) (-1279.066) [-1277.185] (-1279.133) -- 0:00:13
824000 -- (-1277.972) (-1279.972) (-1278.367) [-1276.685] * (-1277.756) (-1281.897) (-1279.007) [-1276.160] -- 0:00:13
824500 -- (-1282.923) (-1280.100) (-1279.646) [-1278.558] * (-1279.703) (-1278.812) (-1278.310) [-1277.556] -- 0:00:13
825000 -- [-1276.359] (-1278.608) (-1278.047) (-1279.053) * (-1278.503) (-1279.638) [-1282.131] (-1277.677) -- 0:00:13
Average standard deviation of split frequencies: 0.005016
825500 -- (-1278.827) (-1277.817) [-1278.625] (-1280.170) * (-1279.699) [-1282.005] (-1278.647) (-1278.955) -- 0:00:13
826000 -- (-1279.269) (-1276.058) (-1278.529) [-1278.775] * (-1279.049) [-1278.822] (-1278.192) (-1279.350) -- 0:00:13
826500 -- (-1279.294) (-1280.799) [-1279.398] (-1279.848) * (-1279.917) [-1278.061] (-1280.474) (-1281.035) -- 0:00:13
827000 -- (-1278.244) (-1277.457) [-1277.786] (-1280.377) * [-1278.783] (-1282.098) (-1279.066) (-1279.624) -- 0:00:12
827500 -- [-1278.581] (-1276.664) (-1277.832) (-1279.019) * (-1280.231) (-1281.612) (-1282.704) [-1281.951] -- 0:00:12
828000 -- (-1279.100) (-1282.001) [-1278.286] (-1279.648) * (-1280.807) (-1280.280) [-1280.406] (-1279.105) -- 0:00:12
828500 -- (-1277.414) [-1281.855] (-1281.135) (-1279.195) * [-1277.001] (-1280.704) (-1277.929) (-1279.821) -- 0:00:12
829000 -- [-1277.827] (-1280.280) (-1278.675) (-1278.273) * [-1278.442] (-1278.844) (-1278.049) (-1278.872) -- 0:00:12
829500 -- (-1278.756) (-1280.872) [-1277.766] (-1280.310) * [-1278.900] (-1277.453) (-1280.943) (-1277.645) -- 0:00:12
830000 -- (-1284.398) [-1278.090] (-1277.990) (-1278.498) * (-1281.269) (-1278.145) [-1277.551] (-1280.794) -- 0:00:12
Average standard deviation of split frequencies: 0.004570
830500 -- (-1279.854) (-1280.533) (-1279.177) [-1277.178] * (-1277.658) [-1278.072] (-1279.762) (-1281.313) -- 0:00:12
831000 -- [-1277.671] (-1279.710) (-1281.366) (-1279.714) * [-1277.462] (-1279.995) (-1277.339) (-1278.197) -- 0:00:12
831500 -- (-1280.631) (-1281.430) (-1277.995) [-1280.290] * (-1279.694) (-1278.294) [-1277.235] (-1280.296) -- 0:00:12
832000 -- (-1279.589) [-1280.860] (-1279.142) (-1280.646) * [-1277.198] (-1280.451) (-1279.123) (-1278.027) -- 0:00:12
832500 -- (-1277.788) (-1277.832) (-1279.471) [-1279.028] * (-1280.399) (-1278.054) (-1279.281) [-1281.545] -- 0:00:12
833000 -- [-1278.006] (-1278.050) (-1278.699) (-1278.913) * (-1278.437) (-1279.482) [-1280.657] (-1281.958) -- 0:00:12
833500 -- [-1280.179] (-1279.234) (-1282.298) (-1282.202) * (-1276.561) [-1278.002] (-1278.734) (-1276.916) -- 0:00:12
834000 -- (-1279.028) (-1279.581) [-1282.898] (-1277.815) * (-1275.751) [-1279.319] (-1278.480) (-1277.172) -- 0:00:12
834500 -- [-1280.956] (-1279.833) (-1277.696) (-1282.254) * [-1280.946] (-1279.489) (-1276.337) (-1278.037) -- 0:00:12
835000 -- (-1282.990) (-1283.562) [-1277.886] (-1280.774) * [-1278.114] (-1283.722) (-1279.310) (-1277.719) -- 0:00:12
Average standard deviation of split frequencies: 0.004570
835500 -- (-1278.938) [-1284.263] (-1278.134) (-1279.318) * (-1278.128) (-1280.569) (-1278.362) [-1280.279] -- 0:00:12
836000 -- [-1277.527] (-1279.508) (-1278.247) (-1278.524) * (-1278.182) (-1279.863) (-1284.009) [-1280.048] -- 0:00:12
836500 -- (-1278.054) [-1279.171] (-1280.480) (-1278.181) * [-1276.282] (-1279.367) (-1277.494) (-1279.130) -- 0:00:12
837000 -- (-1280.106) (-1284.277) (-1280.907) [-1283.148] * [-1277.654] (-1281.821) (-1279.875) (-1276.621) -- 0:00:12
837500 -- (-1281.725) (-1279.109) [-1277.994] (-1278.058) * (-1276.114) (-1278.744) (-1282.534) [-1278.333] -- 0:00:12
838000 -- [-1279.153] (-1277.818) (-1278.267) (-1278.719) * (-1277.961) [-1278.499] (-1280.470) (-1278.259) -- 0:00:12
838500 -- [-1278.386] (-1277.838) (-1279.495) (-1281.270) * [-1278.067] (-1279.404) (-1279.308) (-1276.550) -- 0:00:12
839000 -- (-1277.852) [-1277.993] (-1277.287) (-1278.816) * (-1280.388) (-1278.561) [-1278.457] (-1277.607) -- 0:00:12
839500 -- (-1278.297) [-1278.213] (-1278.691) (-1279.948) * (-1280.556) (-1280.024) [-1281.909] (-1278.025) -- 0:00:12
840000 -- [-1277.919] (-1278.687) (-1279.076) (-1278.240) * (-1278.816) (-1280.888) [-1283.490] (-1279.209) -- 0:00:11
Average standard deviation of split frequencies: 0.004704
840500 -- (-1279.163) [-1278.948] (-1279.606) (-1280.489) * (-1277.434) (-1278.428) [-1281.540] (-1279.196) -- 0:00:11
841000 -- (-1279.274) (-1277.421) (-1280.058) [-1280.120] * (-1276.002) [-1278.863] (-1283.387) (-1278.137) -- 0:00:11
841500 -- [-1278.187] (-1278.617) (-1277.700) (-1280.830) * (-1279.922) (-1278.194) [-1278.148] (-1279.194) -- 0:00:11
842000 -- (-1277.741) (-1279.948) [-1279.066] (-1281.996) * (-1280.289) (-1282.459) (-1277.997) [-1280.893] -- 0:00:11
842500 -- (-1281.019) [-1278.078] (-1280.437) (-1279.034) * (-1279.390) (-1278.060) [-1278.234] (-1280.078) -- 0:00:11
843000 -- (-1279.059) (-1278.970) [-1279.269] (-1281.426) * (-1279.226) (-1278.825) [-1278.058] (-1279.382) -- 0:00:11
843500 -- (-1279.388) (-1278.527) [-1279.660] (-1279.592) * (-1280.207) (-1278.667) [-1280.884] (-1279.632) -- 0:00:11
844000 -- (-1278.234) [-1277.942] (-1281.078) (-1280.467) * [-1277.613] (-1278.980) (-1282.942) (-1279.515) -- 0:00:11
844500 -- (-1283.509) (-1280.628) [-1281.065] (-1278.573) * (-1279.610) (-1279.619) [-1279.692] (-1278.898) -- 0:00:11
845000 -- [-1278.790] (-1278.370) (-1280.043) (-1277.336) * (-1280.846) [-1279.589] (-1279.469) (-1278.168) -- 0:00:11
Average standard deviation of split frequencies: 0.004927
845500 -- (-1281.395) [-1281.525] (-1280.132) (-1278.389) * [-1276.998] (-1277.814) (-1278.172) (-1278.534) -- 0:00:11
846000 -- (-1282.688) [-1279.743] (-1280.399) (-1280.351) * (-1279.994) [-1278.962] (-1277.460) (-1278.705) -- 0:00:11
846500 -- (-1280.928) (-1284.144) [-1278.957] (-1280.087) * [-1278.486] (-1281.009) (-1277.730) (-1278.660) -- 0:00:11
847000 -- [-1279.458] (-1282.009) (-1279.444) (-1277.570) * [-1279.229] (-1280.470) (-1278.109) (-1278.230) -- 0:00:11
847500 -- [-1281.246] (-1281.522) (-1280.597) (-1277.388) * [-1278.618] (-1280.074) (-1281.352) (-1278.651) -- 0:00:11
848000 -- (-1279.574) (-1278.619) (-1278.476) [-1278.388] * (-1278.711) [-1282.485] (-1280.513) (-1279.896) -- 0:00:11
848500 -- (-1278.550) [-1279.085] (-1280.088) (-1281.213) * (-1280.660) (-1281.826) (-1280.766) [-1278.247] -- 0:00:11
849000 -- (-1284.070) (-1281.596) [-1279.225] (-1280.411) * [-1283.352] (-1284.840) (-1278.860) (-1277.958) -- 0:00:11
849500 -- (-1282.696) [-1279.237] (-1282.252) (-1278.793) * (-1279.925) (-1279.134) [-1278.331] (-1277.382) -- 0:00:11
850000 -- (-1278.474) (-1283.592) (-1278.325) [-1279.067] * (-1275.959) [-1280.652] (-1276.926) (-1277.971) -- 0:00:11
Average standard deviation of split frequencies: 0.005017
850500 -- (-1278.858) [-1282.078] (-1281.110) (-1277.486) * (-1278.765) [-1276.062] (-1279.264) (-1279.738) -- 0:00:11
851000 -- (-1276.280) [-1280.790] (-1277.142) (-1275.585) * (-1278.691) [-1277.816] (-1279.343) (-1280.758) -- 0:00:11
851500 -- (-1279.092) (-1278.589) [-1277.965] (-1278.613) * (-1277.462) (-1276.787) [-1282.136] (-1280.547) -- 0:00:11
852000 -- (-1280.523) [-1277.260] (-1282.225) (-1278.856) * (-1278.810) [-1277.361] (-1285.264) (-1280.176) -- 0:00:11
852500 -- (-1281.121) [-1278.077] (-1282.914) (-1278.552) * (-1278.829) (-1278.876) [-1279.069] (-1279.655) -- 0:00:11
853000 -- [-1278.041] (-1280.284) (-1283.019) (-1279.656) * (-1282.396) (-1280.832) [-1277.440] (-1278.998) -- 0:00:11
853500 -- (-1280.450) (-1279.441) (-1279.925) [-1279.687] * (-1284.814) (-1279.727) (-1280.462) [-1278.678] -- 0:00:10
854000 -- (-1281.238) [-1278.641] (-1279.083) (-1278.543) * (-1282.457) (-1280.843) (-1277.652) [-1278.285] -- 0:00:10
854500 -- (-1279.877) [-1279.689] (-1280.121) (-1280.265) * (-1280.289) (-1278.641) [-1277.623] (-1280.023) -- 0:00:10
855000 -- (-1280.096) (-1278.421) (-1280.029) [-1279.328] * [-1282.508] (-1279.844) (-1277.536) (-1287.973) -- 0:00:10
Average standard deviation of split frequencies: 0.005101
855500 -- (-1278.473) (-1277.179) (-1280.220) [-1277.698] * [-1278.653] (-1283.089) (-1279.713) (-1281.228) -- 0:00:10
856000 -- (-1280.209) (-1279.759) [-1279.526] (-1278.532) * [-1278.942] (-1278.449) (-1282.255) (-1280.397) -- 0:00:10
856500 -- [-1278.446] (-1278.977) (-1280.495) (-1278.294) * (-1277.821) (-1280.414) (-1279.881) [-1279.362] -- 0:00:10
857000 -- (-1280.986) (-1281.520) [-1281.195] (-1277.440) * (-1280.691) (-1277.842) [-1277.541] (-1278.351) -- 0:00:10
857500 -- [-1278.257] (-1277.832) (-1279.360) (-1278.398) * (-1281.391) [-1277.976] (-1278.245) (-1277.885) -- 0:00:10
858000 -- (-1277.431) [-1280.277] (-1288.168) (-1279.224) * [-1279.384] (-1283.971) (-1281.219) (-1280.433) -- 0:00:10
858500 -- (-1278.602) (-1278.015) (-1281.935) [-1282.158] * (-1279.242) [-1279.355] (-1280.750) (-1277.241) -- 0:00:10
859000 -- [-1277.726] (-1278.027) (-1277.786) (-1278.565) * (-1277.875) [-1278.414] (-1281.363) (-1279.014) -- 0:00:10
859500 -- [-1278.067] (-1278.509) (-1279.075) (-1278.754) * (-1277.853) (-1278.987) [-1278.523] (-1279.552) -- 0:00:10
860000 -- [-1277.305] (-1280.726) (-1280.069) (-1280.694) * [-1278.501] (-1278.746) (-1278.016) (-1283.254) -- 0:00:10
Average standard deviation of split frequencies: 0.005508
860500 -- (-1282.946) [-1279.487] (-1277.754) (-1280.179) * [-1279.584] (-1277.618) (-1278.577) (-1284.590) -- 0:00:10
861000 -- (-1280.556) (-1279.198) [-1278.686] (-1278.304) * (-1281.489) [-1279.449] (-1277.321) (-1278.705) -- 0:00:10
861500 -- (-1280.841) [-1279.133] (-1279.953) (-1279.368) * (-1278.342) (-1278.159) [-1278.691] (-1278.041) -- 0:00:10
862000 -- [-1281.676] (-1278.804) (-1280.234) (-1278.585) * (-1281.499) [-1277.937] (-1278.621) (-1276.733) -- 0:00:10
862500 -- (-1278.594) [-1279.370] (-1281.540) (-1281.523) * (-1278.126) (-1277.517) [-1277.600] (-1278.777) -- 0:00:10
863000 -- (-1279.634) (-1278.795) [-1280.644] (-1277.762) * (-1279.469) (-1279.243) (-1278.203) [-1279.752] -- 0:00:10
863500 -- [-1278.025] (-1279.549) (-1280.060) (-1280.301) * (-1278.940) [-1277.906] (-1278.634) (-1279.362) -- 0:00:10
864000 -- [-1278.988] (-1281.069) (-1277.544) (-1282.102) * (-1281.680) [-1278.767] (-1278.132) (-1279.616) -- 0:00:10
864500 -- (-1282.567) (-1278.356) [-1279.605] (-1277.755) * [-1278.968] (-1280.391) (-1278.193) (-1277.828) -- 0:00:10
865000 -- (-1278.899) [-1279.664] (-1280.115) (-1278.996) * [-1279.152] (-1278.012) (-1277.859) (-1278.717) -- 0:00:10
Average standard deviation of split frequencies: 0.005358
865500 -- (-1278.616) (-1283.344) (-1279.954) [-1278.120] * [-1280.309] (-1277.180) (-1277.836) (-1279.852) -- 0:00:10
866000 -- [-1277.723] (-1278.886) (-1280.386) (-1279.823) * (-1281.975) (-1282.049) (-1277.816) [-1278.324] -- 0:00:10
866500 -- (-1277.869) [-1274.336] (-1280.180) (-1281.813) * (-1278.658) (-1276.803) (-1277.843) [-1279.643] -- 0:00:10
867000 -- (-1275.416) (-1278.794) [-1277.227] (-1278.823) * [-1278.220] (-1278.349) (-1279.191) (-1280.649) -- 0:00:09
867500 -- (-1279.771) (-1276.363) [-1278.277] (-1279.888) * [-1279.191] (-1280.262) (-1279.091) (-1278.889) -- 0:00:09
868000 -- (-1277.582) [-1278.574] (-1278.913) (-1281.395) * (-1279.008) (-1278.534) [-1278.588] (-1277.365) -- 0:00:09
868500 -- (-1278.940) [-1277.583] (-1278.395) (-1286.905) * [-1278.052] (-1278.277) (-1277.292) (-1278.894) -- 0:00:09
869000 -- (-1277.691) [-1278.147] (-1280.403) (-1278.585) * (-1280.537) [-1277.354] (-1278.220) (-1281.473) -- 0:00:09
869500 -- (-1275.700) [-1278.436] (-1278.759) (-1279.605) * [-1278.966] (-1277.042) (-1277.770) (-1281.323) -- 0:00:09
870000 -- (-1278.026) (-1279.015) (-1277.609) [-1282.868] * (-1282.906) (-1278.870) [-1278.067] (-1278.330) -- 0:00:09
Average standard deviation of split frequencies: 0.005300
870500 -- [-1276.883] (-1279.173) (-1281.801) (-1278.064) * (-1278.826) [-1278.818] (-1281.161) (-1277.739) -- 0:00:09
871000 -- (-1278.351) [-1277.945] (-1277.636) (-1279.344) * (-1280.311) (-1277.652) [-1279.764] (-1280.403) -- 0:00:09
871500 -- (-1276.888) (-1278.822) [-1278.171] (-1278.325) * (-1278.587) [-1277.707] (-1280.137) (-1279.401) -- 0:00:09
872000 -- (-1276.291) (-1283.410) (-1279.851) [-1277.330] * (-1280.732) [-1279.147] (-1278.047) (-1279.365) -- 0:00:09
872500 -- (-1276.047) (-1278.277) [-1277.327] (-1278.148) * [-1278.907] (-1279.657) (-1278.222) (-1279.464) -- 0:00:09
873000 -- (-1280.837) (-1280.785) (-1278.565) [-1278.663] * (-1282.970) [-1278.639] (-1276.571) (-1279.583) -- 0:00:09
873500 -- (-1278.036) [-1278.733] (-1278.478) (-1282.164) * (-1279.955) [-1282.722] (-1278.469) (-1277.312) -- 0:00:09
874000 -- (-1278.762) (-1278.643) (-1279.096) [-1280.642] * [-1277.637] (-1277.059) (-1282.022) (-1276.416) -- 0:00:09
874500 -- (-1278.138) (-1281.519) [-1279.346] (-1287.539) * (-1289.173) (-1278.852) [-1277.015] (-1279.219) -- 0:00:09
875000 -- [-1277.833] (-1277.448) (-1284.558) (-1276.991) * [-1276.963] (-1279.020) (-1281.367) (-1279.950) -- 0:00:09
Average standard deviation of split frequencies: 0.005268
875500 -- (-1280.594) [-1280.589] (-1279.559) (-1277.492) * (-1281.479) [-1280.913] (-1279.894) (-1280.232) -- 0:00:09
876000 -- (-1278.534) (-1279.517) (-1280.907) [-1279.350] * [-1277.457] (-1280.421) (-1277.556) (-1280.130) -- 0:00:09
876500 -- (-1278.096) [-1276.929] (-1282.817) (-1279.980) * (-1281.080) (-1280.988) [-1275.614] (-1281.717) -- 0:00:09
877000 -- [-1278.110] (-1277.758) (-1282.924) (-1277.612) * [-1280.244] (-1280.610) (-1282.530) (-1284.303) -- 0:00:09
877500 -- [-1278.609] (-1277.386) (-1283.026) (-1278.443) * (-1281.773) (-1283.458) (-1276.856) [-1278.168] -- 0:00:09
878000 -- (-1277.978) (-1279.102) [-1282.239] (-1281.450) * [-1276.864] (-1281.153) (-1282.293) (-1278.765) -- 0:00:09
878500 -- (-1279.435) (-1278.734) (-1277.685) [-1278.677] * (-1277.128) (-1279.473) [-1280.727] (-1279.227) -- 0:00:09
879000 -- (-1278.882) [-1276.105] (-1279.728) (-1280.021) * (-1277.209) [-1278.196] (-1279.560) (-1279.526) -- 0:00:09
879500 -- (-1281.287) [-1277.687] (-1281.722) (-1279.353) * (-1278.627) [-1277.318] (-1279.081) (-1277.699) -- 0:00:09
880000 -- (-1279.812) (-1279.092) (-1281.904) [-1278.874] * (-1278.091) [-1278.176] (-1279.890) (-1279.352) -- 0:00:09
Average standard deviation of split frequencies: 0.005650
880500 -- [-1277.374] (-1277.242) (-1281.776) (-1279.764) * (-1276.826) [-1277.653] (-1276.464) (-1280.932) -- 0:00:08
881000 -- (-1278.471) [-1277.979] (-1278.774) (-1278.364) * (-1280.017) (-1279.145) [-1276.981] (-1278.545) -- 0:00:08
881500 -- (-1278.506) (-1278.519) [-1280.355] (-1281.238) * [-1282.052] (-1278.756) (-1277.981) (-1277.447) -- 0:00:08
882000 -- (-1280.723) (-1279.645) [-1280.189] (-1278.522) * [-1280.392] (-1277.866) (-1277.480) (-1277.758) -- 0:00:08
882500 -- [-1278.855] (-1279.636) (-1279.312) (-1279.768) * [-1280.194] (-1282.824) (-1279.703) (-1278.248) -- 0:00:08
883000 -- [-1278.099] (-1278.133) (-1278.185) (-1279.673) * (-1280.073) [-1277.820] (-1285.233) (-1280.935) -- 0:00:08
883500 -- (-1279.548) (-1282.010) [-1277.395] (-1277.396) * (-1277.461) (-1278.768) [-1280.181] (-1279.235) -- 0:00:08
884000 -- (-1278.084) [-1278.136] (-1276.062) (-1279.880) * (-1278.621) (-1278.759) [-1279.920] (-1277.805) -- 0:00:08
884500 -- (-1281.844) (-1283.430) (-1280.364) [-1281.139] * (-1278.959) (-1276.222) (-1277.748) [-1280.134] -- 0:00:08
885000 -- [-1278.058] (-1278.766) (-1280.608) (-1278.157) * (-1277.513) [-1282.498] (-1278.680) (-1282.497) -- 0:00:08
Average standard deviation of split frequencies: 0.005143
885500 -- (-1282.202) (-1279.635) (-1279.397) [-1278.544] * (-1278.621) [-1280.915] (-1279.430) (-1279.559) -- 0:00:08
886000 -- (-1279.453) [-1283.861] (-1279.970) (-1278.698) * [-1279.026] (-1278.584) (-1278.087) (-1281.636) -- 0:00:08
886500 -- (-1279.287) (-1279.010) [-1281.972] (-1278.411) * [-1280.003] (-1279.044) (-1277.567) (-1277.884) -- 0:00:08
887000 -- (-1283.790) (-1282.315) [-1279.925] (-1280.933) * (-1281.064) (-1278.853) [-1277.656] (-1280.220) -- 0:00:08
887500 -- (-1279.662) (-1280.447) (-1280.211) [-1278.352] * (-1278.907) (-1278.454) [-1278.895] (-1276.632) -- 0:00:08
888000 -- [-1279.602] (-1280.629) (-1279.033) (-1281.811) * [-1278.126] (-1279.519) (-1277.813) (-1278.180) -- 0:00:08
888500 -- (-1278.487) (-1280.908) (-1278.694) [-1278.227] * (-1282.327) [-1276.346] (-1280.152) (-1282.866) -- 0:00:08
889000 -- (-1279.669) [-1278.737] (-1280.261) (-1278.159) * (-1277.561) (-1278.024) [-1278.056] (-1278.247) -- 0:00:08
889500 -- [-1277.000] (-1278.142) (-1280.115) (-1277.817) * [-1277.992] (-1280.711) (-1280.972) (-1279.849) -- 0:00:08
890000 -- [-1279.156] (-1282.654) (-1278.447) (-1281.379) * (-1278.160) (-1282.751) (-1280.622) [-1276.585] -- 0:00:08
Average standard deviation of split frequencies: 0.004852
890500 -- [-1279.724] (-1280.090) (-1279.213) (-1285.084) * (-1277.925) [-1278.890] (-1278.757) (-1277.731) -- 0:00:08
891000 -- (-1279.092) (-1280.427) [-1279.016] (-1278.190) * (-1282.122) [-1278.621] (-1280.480) (-1277.552) -- 0:00:08
891500 -- (-1279.231) [-1278.171] (-1281.124) (-1279.364) * (-1276.428) (-1279.555) [-1279.550] (-1278.120) -- 0:00:08
892000 -- (-1278.843) [-1279.237] (-1277.527) (-1279.443) * [-1279.564] (-1282.827) (-1279.161) (-1278.058) -- 0:00:08
892500 -- (-1279.263) (-1281.481) (-1279.317) [-1281.104] * (-1278.957) (-1280.886) [-1279.508] (-1279.267) -- 0:00:08
893000 -- (-1278.116) (-1280.249) (-1277.449) [-1279.732] * (-1278.058) (-1283.272) [-1283.991] (-1278.000) -- 0:00:08
893500 -- [-1278.125] (-1282.522) (-1278.023) (-1275.782) * [-1279.234] (-1284.597) (-1287.820) (-1279.798) -- 0:00:07
894000 -- (-1278.948) (-1279.306) (-1278.923) [-1278.911] * (-1277.959) (-1280.683) (-1280.070) [-1282.971] -- 0:00:07
894500 -- (-1279.115) [-1278.175] (-1278.791) (-1277.233) * (-1280.958) (-1280.135) (-1283.235) [-1278.798] -- 0:00:07
895000 -- (-1277.621) [-1276.854] (-1282.463) (-1282.108) * [-1279.123] (-1278.323) (-1283.124) (-1277.857) -- 0:00:07
Average standard deviation of split frequencies: 0.005144
895500 -- (-1276.698) [-1275.981] (-1277.365) (-1279.773) * [-1277.911] (-1280.404) (-1276.968) (-1279.556) -- 0:00:07
896000 -- (-1278.400) (-1279.068) [-1279.493] (-1279.915) * (-1282.863) (-1278.069) [-1278.321] (-1279.784) -- 0:00:07
896500 -- (-1278.253) (-1284.096) [-1278.117] (-1282.353) * (-1283.685) (-1279.875) (-1279.643) [-1278.005] -- 0:00:07
897000 -- (-1279.821) (-1279.723) [-1275.811] (-1282.998) * (-1276.663) (-1279.973) (-1277.750) [-1278.827] -- 0:00:07
897500 -- (-1278.254) [-1281.827] (-1279.379) (-1277.781) * (-1278.435) [-1277.884] (-1274.750) (-1279.416) -- 0:00:07
898000 -- (-1280.085) [-1277.944] (-1279.571) (-1281.303) * [-1281.481] (-1278.413) (-1276.544) (-1279.971) -- 0:00:07
898500 -- [-1277.935] (-1278.663) (-1278.133) (-1278.040) * (-1279.039) [-1279.004] (-1279.137) (-1277.916) -- 0:00:07
899000 -- [-1282.661] (-1278.165) (-1279.012) (-1277.728) * (-1278.431) (-1279.299) (-1280.917) [-1276.513] -- 0:00:07
899500 -- (-1278.004) (-1278.378) (-1278.257) [-1276.733] * (-1279.205) (-1278.148) [-1282.063] (-1277.946) -- 0:00:07
900000 -- (-1279.529) (-1280.268) [-1279.094] (-1279.521) * [-1278.274] (-1277.792) (-1282.388) (-1280.659) -- 0:00:07
Average standard deviation of split frequencies: 0.005030
900500 -- (-1278.953) (-1280.088) [-1280.138] (-1279.339) * (-1280.109) [-1277.269] (-1279.839) (-1277.314) -- 0:00:07
901000 -- (-1282.181) (-1278.760) (-1282.389) [-1277.203] * (-1284.281) [-1277.793] (-1279.642) (-1278.206) -- 0:00:07
901500 -- [-1281.593] (-1278.649) (-1279.075) (-1278.081) * (-1278.802) (-1280.267) (-1280.201) [-1281.755] -- 0:00:07
902000 -- (-1281.440) (-1277.637) [-1278.308] (-1277.959) * (-1277.984) (-1275.406) (-1278.758) [-1280.878] -- 0:00:07
902500 -- [-1278.905] (-1277.507) (-1280.299) (-1278.508) * [-1275.445] (-1276.809) (-1275.766) (-1280.146) -- 0:00:07
903000 -- (-1278.513) (-1279.121) [-1280.724] (-1278.952) * (-1280.051) (-1279.681) [-1279.693] (-1280.040) -- 0:00:07
903500 -- [-1277.892] (-1278.596) (-1278.859) (-1281.215) * (-1279.078) [-1278.807] (-1279.306) (-1280.000) -- 0:00:07
904000 -- (-1280.033) (-1282.375) (-1279.381) [-1278.784] * (-1279.544) (-1280.178) (-1278.038) [-1279.138] -- 0:00:07
904500 -- (-1278.500) (-1281.921) (-1279.775) [-1280.173] * [-1279.399] (-1278.114) (-1279.686) (-1280.835) -- 0:00:07
905000 -- [-1278.294] (-1282.665) (-1280.014) (-1278.712) * [-1278.623] (-1277.255) (-1277.825) (-1277.579) -- 0:00:07
Average standard deviation of split frequencies: 0.004596
905500 -- (-1279.625) (-1278.635) (-1277.455) [-1277.493] * (-1278.693) (-1278.376) [-1280.758] (-1280.127) -- 0:00:07
906000 -- (-1279.802) (-1280.651) [-1279.733] (-1279.312) * [-1279.876] (-1281.156) (-1278.585) (-1282.457) -- 0:00:07
906500 -- [-1278.265] (-1280.323) (-1277.849) (-1280.284) * [-1277.984] (-1281.473) (-1278.126) (-1279.666) -- 0:00:07
907000 -- (-1279.406) (-1279.746) [-1279.021] (-1280.594) * [-1277.385] (-1281.533) (-1281.883) (-1280.094) -- 0:00:06
907500 -- (-1281.928) (-1277.937) [-1277.412] (-1277.919) * (-1279.143) (-1279.898) (-1278.132) [-1279.816] -- 0:00:06
908000 -- (-1278.785) (-1278.151) [-1279.687] (-1280.293) * [-1282.005] (-1280.430) (-1277.893) (-1280.927) -- 0:00:06
908500 -- (-1279.310) [-1276.661] (-1280.753) (-1279.100) * (-1279.187) (-1277.633) [-1277.561] (-1279.796) -- 0:00:06
909000 -- (-1278.702) (-1278.459) (-1283.033) [-1282.617] * [-1278.824] (-1283.089) (-1278.583) (-1279.280) -- 0:00:06
909500 -- (-1279.860) (-1276.562) (-1280.740) [-1281.857] * (-1278.032) (-1284.250) [-1277.161] (-1285.377) -- 0:00:06
910000 -- (-1279.750) (-1278.250) [-1278.131] (-1279.220) * (-1281.967) (-1279.877) (-1279.634) [-1278.268] -- 0:00:06
Average standard deviation of split frequencies: 0.004716
910500 -- (-1278.877) (-1278.280) (-1278.335) [-1277.816] * (-1280.608) (-1280.640) [-1275.200] (-1280.612) -- 0:00:06
911000 -- (-1278.581) (-1279.166) [-1277.647] (-1277.701) * [-1281.146] (-1279.949) (-1277.295) (-1280.146) -- 0:00:06
911500 -- (-1277.272) (-1278.609) [-1278.927] (-1282.145) * (-1279.961) (-1279.432) [-1277.277] (-1278.915) -- 0:00:06
912000 -- (-1277.557) [-1280.931] (-1278.903) (-1283.087) * [-1277.259] (-1277.837) (-1279.764) (-1278.410) -- 0:00:06
912500 -- (-1279.530) (-1278.946) [-1276.571] (-1279.099) * (-1279.089) (-1277.535) [-1278.855] (-1281.246) -- 0:00:06
913000 -- (-1277.934) (-1279.001) (-1277.343) [-1278.420] * (-1277.926) (-1279.389) [-1279.080] (-1277.504) -- 0:00:06
913500 -- (-1280.634) [-1277.855] (-1277.734) (-1280.811) * (-1279.673) [-1280.007] (-1280.588) (-1283.157) -- 0:00:06
914000 -- [-1278.073] (-1280.590) (-1278.817) (-1277.805) * (-1277.919) [-1279.450] (-1282.201) (-1281.353) -- 0:00:06
914500 -- (-1278.744) (-1283.371) (-1285.166) [-1277.818] * [-1276.866] (-1279.145) (-1280.434) (-1279.392) -- 0:00:06
915000 -- (-1277.677) (-1277.751) [-1282.685] (-1278.363) * (-1278.095) [-1278.104] (-1279.220) (-1279.029) -- 0:00:06
Average standard deviation of split frequencies: 0.004746
915500 -- (-1279.226) (-1277.694) [-1278.959] (-1278.394) * (-1280.070) (-1277.100) [-1277.231] (-1282.309) -- 0:00:06
916000 -- [-1278.327] (-1280.381) (-1279.179) (-1277.711) * (-1279.643) (-1280.080) [-1279.431] (-1278.996) -- 0:00:06
916500 -- (-1278.479) (-1278.134) (-1279.340) [-1277.309] * [-1277.165] (-1279.951) (-1282.521) (-1279.908) -- 0:00:06
917000 -- (-1278.790) (-1277.748) [-1277.727] (-1279.543) * (-1279.122) (-1279.398) (-1278.470) [-1277.974] -- 0:00:06
917500 -- (-1282.002) [-1278.282] (-1281.567) (-1279.049) * (-1278.920) (-1279.096) (-1280.738) [-1278.041] -- 0:00:06
918000 -- (-1279.433) (-1282.399) (-1280.773) [-1277.617] * (-1283.202) (-1283.076) [-1277.228] (-1278.074) -- 0:00:06
918500 -- (-1278.815) (-1280.309) (-1280.669) [-1279.500] * [-1282.481] (-1278.314) (-1279.949) (-1280.647) -- 0:00:06
919000 -- (-1278.520) (-1278.194) [-1281.132] (-1280.332) * (-1277.431) [-1278.995] (-1280.717) (-1279.070) -- 0:00:06
919500 -- [-1276.382] (-1277.146) (-1279.436) (-1280.140) * (-1277.831) (-1279.552) [-1277.189] (-1284.347) -- 0:00:06
920000 -- [-1277.916] (-1278.848) (-1281.935) (-1280.203) * (-1278.003) [-1279.445] (-1278.996) (-1279.967) -- 0:00:05
Average standard deviation of split frequencies: 0.004637
920500 -- [-1277.719] (-1278.354) (-1282.766) (-1278.920) * [-1280.223] (-1277.683) (-1280.537) (-1279.445) -- 0:00:05
921000 -- (-1279.507) [-1279.204] (-1274.999) (-1278.191) * (-1281.429) (-1282.692) [-1278.058] (-1278.839) -- 0:00:05
921500 -- (-1277.934) (-1280.171) [-1280.182] (-1281.047) * (-1278.667) (-1281.360) (-1279.465) [-1280.745] -- 0:00:05
922000 -- (-1279.537) (-1280.542) [-1276.670] (-1278.189) * [-1278.377] (-1281.830) (-1278.719) (-1283.088) -- 0:00:05
922500 -- (-1278.907) (-1277.758) [-1282.362] (-1281.149) * (-1278.897) (-1279.375) [-1277.511] (-1281.378) -- 0:00:05
923000 -- (-1277.538) [-1277.930] (-1277.675) (-1279.475) * (-1279.653) [-1277.740] (-1278.158) (-1281.381) -- 0:00:05
923500 -- [-1280.901] (-1280.521) (-1277.577) (-1279.737) * (-1280.454) (-1279.732) [-1281.372] (-1280.992) -- 0:00:05
924000 -- [-1279.846] (-1279.551) (-1278.449) (-1278.218) * (-1278.963) [-1280.181] (-1279.754) (-1278.537) -- 0:00:05
924500 -- (-1280.396) [-1279.551] (-1279.919) (-1276.807) * (-1279.805) (-1281.023) (-1279.513) [-1280.793] -- 0:00:05
925000 -- (-1277.893) (-1277.756) [-1279.906] (-1279.695) * (-1286.159) [-1278.070] (-1278.406) (-1279.540) -- 0:00:05
Average standard deviation of split frequencies: 0.004921
925500 -- (-1277.773) (-1279.709) [-1278.392] (-1278.264) * (-1284.697) (-1280.882) [-1278.837] (-1280.086) -- 0:00:05
926000 -- (-1278.789) (-1282.518) (-1278.937) [-1278.395] * (-1280.306) (-1278.297) [-1279.291] (-1280.032) -- 0:00:05
926500 -- (-1278.296) (-1279.113) [-1280.086] (-1278.859) * (-1278.500) [-1280.589] (-1279.355) (-1280.575) -- 0:00:05
927000 -- (-1279.773) (-1279.697) [-1279.299] (-1281.781) * [-1278.213] (-1276.722) (-1280.034) (-1278.670) -- 0:00:05
927500 -- (-1278.392) [-1277.972] (-1279.749) (-1282.749) * (-1277.729) (-1283.565) [-1278.843] (-1280.094) -- 0:00:05
928000 -- (-1281.532) (-1279.372) (-1281.709) [-1281.794] * (-1278.495) (-1278.134) [-1279.580] (-1281.277) -- 0:00:05
928500 -- (-1277.520) [-1278.445] (-1279.828) (-1280.897) * (-1277.107) [-1276.738] (-1278.270) (-1279.403) -- 0:00:05
929000 -- (-1277.881) (-1278.753) [-1284.045] (-1282.238) * (-1281.591) (-1279.494) [-1278.367] (-1278.891) -- 0:00:05
929500 -- (-1278.682) (-1279.745) [-1280.635] (-1281.749) * (-1280.726) (-1280.913) [-1277.998] (-1287.351) -- 0:00:05
930000 -- (-1281.213) [-1277.766] (-1278.667) (-1279.599) * (-1280.046) [-1278.898] (-1279.164) (-1281.604) -- 0:00:05
Average standard deviation of split frequencies: 0.004959
930500 -- (-1278.242) (-1277.641) (-1279.782) [-1277.695] * (-1278.434) (-1277.891) (-1279.749) [-1279.270] -- 0:00:05
931000 -- (-1278.342) [-1278.285] (-1280.636) (-1278.224) * (-1282.557) [-1278.120] (-1277.023) (-1283.806) -- 0:00:05
931500 -- (-1280.614) (-1282.303) (-1279.584) [-1279.050] * (-1278.640) (-1277.894) [-1277.894] (-1284.919) -- 0:00:05
932000 -- [-1280.795] (-1280.881) (-1278.421) (-1278.304) * (-1279.553) (-1279.748) [-1280.052] (-1280.961) -- 0:00:05
932500 -- (-1283.500) (-1280.166) [-1279.081] (-1279.399) * (-1281.808) [-1277.669] (-1275.899) (-1284.007) -- 0:00:04
933000 -- (-1283.632) (-1279.671) (-1278.069) [-1278.945] * (-1278.258) [-1278.304] (-1278.016) (-1277.159) -- 0:00:05
933500 -- (-1281.444) [-1277.015] (-1278.180) (-1278.655) * (-1278.510) (-1281.245) (-1278.125) [-1278.617] -- 0:00:04
934000 -- (-1281.284) (-1275.897) [-1277.540] (-1278.145) * (-1282.816) (-1278.251) (-1278.540) [-1275.088] -- 0:00:04
934500 -- [-1280.025] (-1277.601) (-1278.236) (-1280.493) * (-1279.466) (-1282.265) [-1278.148] (-1277.797) -- 0:00:04
935000 -- (-1275.598) (-1278.612) (-1278.849) [-1279.117] * [-1279.488] (-1280.743) (-1279.865) (-1279.137) -- 0:00:04
Average standard deviation of split frequencies: 0.005008
935500 -- [-1280.628] (-1278.279) (-1278.275) (-1277.865) * [-1277.454] (-1280.662) (-1278.486) (-1277.766) -- 0:00:04
936000 -- (-1281.553) (-1278.107) [-1279.870] (-1277.558) * [-1279.401] (-1277.958) (-1279.655) (-1284.986) -- 0:00:04
936500 -- (-1281.989) (-1282.804) [-1281.179] (-1277.494) * (-1282.093) (-1278.287) (-1280.315) [-1279.019] -- 0:00:04
937000 -- (-1279.840) (-1280.255) (-1278.190) [-1279.897] * (-1279.240) [-1277.634] (-1280.422) (-1280.311) -- 0:00:04
937500 -- (-1279.115) [-1279.156] (-1278.340) (-1280.704) * (-1279.926) [-1279.873] (-1279.239) (-1278.728) -- 0:00:04
938000 -- [-1278.729] (-1278.691) (-1278.414) (-1284.223) * [-1278.756] (-1278.911) (-1277.782) (-1277.307) -- 0:00:04
938500 -- (-1279.548) [-1278.538] (-1276.359) (-1283.764) * [-1278.198] (-1278.220) (-1281.450) (-1278.079) -- 0:00:04
939000 -- (-1277.017) (-1278.991) (-1278.303) [-1278.679] * [-1277.149] (-1282.252) (-1278.701) (-1280.094) -- 0:00:04
939500 -- (-1277.519) (-1279.619) (-1277.738) [-1278.044] * [-1279.298] (-1287.301) (-1279.379) (-1278.186) -- 0:00:04
940000 -- (-1279.144) (-1277.559) [-1278.876] (-1280.479) * (-1278.108) (-1285.380) [-1277.668] (-1279.317) -- 0:00:04
Average standard deviation of split frequencies: 0.005345
940500 -- (-1279.237) (-1277.589) [-1278.254] (-1284.586) * (-1278.830) (-1280.705) [-1277.912] (-1281.314) -- 0:00:04
941000 -- (-1282.821) (-1278.131) [-1280.011] (-1282.180) * (-1278.596) [-1277.904] (-1278.548) (-1280.081) -- 0:00:04
941500 -- [-1279.594] (-1279.928) (-1279.073) (-1276.801) * (-1285.919) (-1280.205) (-1278.605) [-1277.917] -- 0:00:04
942000 -- [-1278.629] (-1279.511) (-1277.307) (-1277.943) * [-1281.021] (-1277.593) (-1280.377) (-1279.830) -- 0:00:04
942500 -- (-1278.725) (-1276.382) [-1279.002] (-1279.622) * (-1277.213) (-1277.951) (-1279.401) [-1278.575] -- 0:00:04
943000 -- (-1280.968) (-1280.694) (-1280.614) [-1279.630] * [-1280.083] (-1278.206) (-1279.976) (-1278.205) -- 0:00:04
943500 -- [-1278.875] (-1279.767) (-1278.012) (-1277.708) * (-1279.275) (-1275.842) [-1278.770] (-1277.222) -- 0:00:04
944000 -- (-1278.814) (-1277.100) (-1279.953) [-1278.151] * (-1279.005) (-1280.962) [-1281.276] (-1277.323) -- 0:00:04
944500 -- (-1282.409) (-1278.335) [-1277.294] (-1278.468) * (-1279.803) (-1286.644) (-1284.594) [-1277.645] -- 0:00:04
945000 -- (-1282.312) (-1279.535) (-1280.710) [-1279.232] * [-1281.349] (-1281.333) (-1278.573) (-1280.341) -- 0:00:04
Average standard deviation of split frequencies: 0.005371
945500 -- (-1278.201) [-1279.209] (-1277.688) (-1277.871) * (-1278.400) (-1277.688) (-1278.424) [-1278.506] -- 0:00:04
946000 -- (-1279.151) (-1277.232) (-1279.533) [-1280.974] * (-1281.868) (-1281.495) [-1278.912] (-1276.281) -- 0:00:03
946500 -- [-1279.141] (-1279.638) (-1278.839) (-1280.093) * (-1279.797) (-1279.780) [-1277.449] (-1279.213) -- 0:00:03
947000 -- (-1281.177) (-1278.289) (-1277.410) [-1277.711] * (-1279.294) [-1277.618] (-1278.301) (-1279.094) -- 0:00:03
947500 -- (-1279.147) [-1279.435] (-1278.928) (-1279.421) * (-1280.568) (-1279.601) (-1278.257) [-1277.721] -- 0:00:03
948000 -- (-1278.447) (-1278.827) [-1277.397] (-1281.307) * (-1279.799) [-1278.113] (-1278.259) (-1277.309) -- 0:00:03
948500 -- (-1278.694) [-1278.991] (-1278.646) (-1278.312) * (-1280.960) (-1278.064) (-1280.378) [-1276.097] -- 0:00:03
949000 -- (-1279.463) [-1278.950] (-1281.232) (-1278.165) * [-1279.800] (-1281.137) (-1283.056) (-1277.813) -- 0:00:03
949500 -- (-1280.630) (-1279.198) [-1281.535] (-1281.119) * [-1277.613] (-1279.358) (-1277.737) (-1280.856) -- 0:00:03
950000 -- (-1278.721) (-1279.473) [-1279.603] (-1278.767) * (-1279.688) (-1278.693) [-1277.430] (-1277.540) -- 0:00:03
Average standard deviation of split frequencies: 0.005647
950500 -- [-1279.485] (-1282.194) (-1279.098) (-1279.568) * (-1283.803) (-1278.309) [-1278.057] (-1280.991) -- 0:00:03
951000 -- (-1278.788) [-1282.086] (-1279.553) (-1279.219) * (-1282.243) (-1278.004) [-1277.628] (-1278.195) -- 0:00:03
951500 -- (-1282.847) (-1279.170) (-1282.304) [-1280.045] * (-1278.099) [-1277.353] (-1278.806) (-1278.823) -- 0:00:03
952000 -- [-1278.892] (-1281.881) (-1281.702) (-1278.051) * (-1277.126) (-1279.830) [-1279.211] (-1279.255) -- 0:00:03
952500 -- (-1279.933) (-1280.230) (-1279.343) [-1277.115] * (-1285.447) (-1279.872) [-1278.456] (-1279.224) -- 0:00:03
953000 -- (-1284.847) (-1283.129) (-1281.028) [-1279.937] * (-1282.436) (-1279.670) [-1278.512] (-1279.400) -- 0:00:03
953500 -- [-1280.603] (-1281.280) (-1280.851) (-1285.770) * (-1278.297) [-1278.083] (-1280.190) (-1278.401) -- 0:00:03
954000 -- [-1279.162] (-1287.165) (-1278.020) (-1279.914) * [-1277.809] (-1281.704) (-1277.902) (-1277.919) -- 0:00:03
954500 -- (-1280.892) [-1280.100] (-1280.105) (-1278.257) * (-1278.881) (-1276.341) (-1279.505) [-1275.895] -- 0:00:03
955000 -- (-1281.368) (-1283.508) (-1277.824) [-1279.169] * (-1279.077) (-1277.450) [-1277.211] (-1280.201) -- 0:00:03
Average standard deviation of split frequencies: 0.005917
955500 -- [-1279.215] (-1280.727) (-1278.872) (-1278.588) * (-1278.916) [-1278.670] (-1282.289) (-1278.682) -- 0:00:03
956000 -- [-1279.169] (-1282.628) (-1276.809) (-1279.469) * (-1279.378) [-1278.720] (-1282.013) (-1279.026) -- 0:00:03
956500 -- [-1280.686] (-1280.197) (-1279.592) (-1281.147) * (-1281.771) [-1280.252] (-1279.449) (-1277.898) -- 0:00:03
957000 -- [-1279.413] (-1284.491) (-1279.801) (-1280.585) * (-1281.569) (-1278.702) [-1280.796] (-1279.213) -- 0:00:03
957500 -- (-1278.521) (-1281.954) (-1278.059) [-1277.800] * [-1281.296] (-1278.072) (-1278.488) (-1279.227) -- 0:00:03
958000 -- [-1280.139] (-1279.664) (-1277.502) (-1280.857) * (-1279.902) (-1280.782) (-1279.589) [-1278.524] -- 0:00:03
958500 -- (-1277.442) [-1282.127] (-1283.902) (-1279.620) * (-1278.208) (-1277.649) (-1281.433) [-1279.282] -- 0:00:03
959000 -- (-1280.699) (-1281.975) (-1278.576) [-1274.373] * (-1280.544) (-1277.773) [-1278.691] (-1283.337) -- 0:00:03
959500 -- (-1278.698) (-1279.714) (-1279.430) [-1276.403] * [-1279.313] (-1278.652) (-1279.607) (-1278.685) -- 0:00:02
960000 -- (-1278.658) (-1279.919) (-1278.756) [-1277.705] * (-1278.934) (-1278.447) [-1277.902] (-1277.664) -- 0:00:02
Average standard deviation of split frequencies: 0.005943
960500 -- (-1280.638) [-1278.739] (-1279.093) (-1282.779) * (-1278.851) (-1280.505) [-1280.491] (-1274.420) -- 0:00:02
961000 -- (-1281.035) (-1279.641) [-1277.260] (-1279.827) * (-1278.445) (-1277.764) [-1278.582] (-1278.157) -- 0:00:02
961500 -- (-1279.517) (-1279.590) [-1276.096] (-1276.386) * (-1278.389) (-1279.338) (-1279.175) [-1281.231] -- 0:00:02
962000 -- [-1280.023] (-1281.870) (-1281.281) (-1281.308) * (-1281.496) (-1279.760) (-1278.752) [-1279.735] -- 0:00:02
962500 -- (-1285.732) [-1281.204] (-1278.367) (-1281.358) * (-1280.158) (-1278.988) [-1279.453] (-1278.241) -- 0:00:02
963000 -- (-1279.313) (-1282.187) (-1278.994) [-1276.928] * [-1277.876] (-1279.914) (-1280.666) (-1279.746) -- 0:00:02
963500 -- (-1276.978) (-1283.047) [-1278.239] (-1282.415) * (-1283.146) (-1285.046) [-1278.821] (-1277.825) -- 0:00:02
964000 -- (-1279.858) (-1278.852) (-1278.060) [-1275.988] * (-1277.616) (-1290.536) [-1278.093] (-1279.465) -- 0:00:02
964500 -- [-1279.465] (-1279.709) (-1277.559) (-1279.103) * (-1281.509) (-1282.530) [-1278.982] (-1279.957) -- 0:00:02
965000 -- (-1280.272) (-1278.876) (-1281.014) [-1277.867] * (-1278.632) (-1282.585) (-1280.192) [-1278.135] -- 0:00:02
Average standard deviation of split frequencies: 0.005964
965500 -- [-1279.770] (-1279.145) (-1280.344) (-1278.499) * (-1278.671) [-1276.427] (-1280.275) (-1278.873) -- 0:00:02
966000 -- [-1278.207] (-1280.165) (-1279.369) (-1279.965) * [-1279.074] (-1282.542) (-1280.930) (-1280.026) -- 0:00:02
966500 -- (-1278.363) [-1277.873] (-1278.868) (-1278.344) * (-1280.605) (-1283.779) [-1276.611] (-1280.670) -- 0:00:02
967000 -- (-1279.995) (-1278.527) (-1281.464) [-1280.208] * (-1281.083) [-1279.579] (-1278.662) (-1279.406) -- 0:00:02
967500 -- (-1275.689) (-1279.246) [-1278.249] (-1279.606) * (-1282.245) [-1280.904] (-1280.744) (-1281.861) -- 0:00:02
968000 -- (-1277.867) (-1280.649) [-1277.619] (-1282.257) * (-1279.350) (-1279.599) (-1278.186) [-1277.847] -- 0:00:02
968500 -- [-1279.860] (-1278.679) (-1277.738) (-1283.763) * (-1281.047) (-1279.265) [-1278.025] (-1278.363) -- 0:00:02
969000 -- (-1278.087) [-1277.964] (-1279.140) (-1280.384) * (-1279.369) (-1278.712) (-1285.262) [-1277.262] -- 0:00:02
969500 -- (-1281.342) [-1279.522] (-1279.941) (-1278.214) * [-1278.821] (-1279.075) (-1283.612) (-1279.775) -- 0:00:02
970000 -- (-1278.048) [-1277.991] (-1280.409) (-1278.791) * [-1279.054] (-1277.513) (-1277.631) (-1279.391) -- 0:00:02
Average standard deviation of split frequencies: 0.005828
970500 -- (-1278.225) (-1279.242) (-1280.316) [-1278.202] * [-1277.950] (-1280.782) (-1278.745) (-1281.661) -- 0:00:02
971000 -- (-1277.886) (-1279.993) [-1282.616] (-1279.687) * (-1278.776) (-1283.186) (-1277.804) [-1278.287] -- 0:00:02
971500 -- (-1277.694) [-1280.558] (-1278.781) (-1281.014) * (-1278.297) [-1275.975] (-1277.584) (-1279.456) -- 0:00:02
972000 -- (-1283.026) (-1277.715) [-1277.322] (-1280.325) * (-1277.450) (-1280.105) (-1277.974) [-1278.835] -- 0:00:02
972500 -- (-1277.890) (-1280.028) [-1279.569] (-1280.751) * (-1278.095) (-1277.511) (-1279.495) [-1279.711] -- 0:00:02
973000 -- (-1277.452) (-1278.398) [-1279.234] (-1278.998) * (-1276.223) (-1277.864) (-1282.509) [-1277.885] -- 0:00:01
973500 -- (-1278.435) (-1280.110) [-1279.971] (-1279.449) * (-1281.792) [-1279.019] (-1283.721) (-1277.472) -- 0:00:01
974000 -- (-1280.717) [-1278.802] (-1283.015) (-1278.248) * (-1278.577) (-1278.471) (-1279.142) [-1277.319] -- 0:00:01
974500 -- (-1283.165) [-1279.298] (-1281.979) (-1278.384) * (-1279.600) (-1278.865) [-1280.268] (-1277.629) -- 0:00:01
975000 -- (-1278.095) [-1279.457] (-1279.409) (-1280.411) * (-1279.315) [-1277.482] (-1280.537) (-1276.310) -- 0:00:01
Average standard deviation of split frequencies: 0.005876
975500 -- (-1282.666) (-1278.947) [-1278.577] (-1281.474) * (-1278.089) (-1277.608) (-1278.464) [-1279.663] -- 0:00:01
976000 -- (-1279.677) [-1279.231] (-1280.104) (-1285.490) * (-1278.559) (-1276.123) (-1280.915) [-1278.587] -- 0:00:01
976500 -- (-1278.751) [-1280.530] (-1280.561) (-1278.274) * [-1279.439] (-1278.755) (-1279.912) (-1276.049) -- 0:00:01
977000 -- (-1278.182) [-1277.912] (-1277.531) (-1279.457) * [-1276.909] (-1279.449) (-1278.638) (-1278.472) -- 0:00:01
977500 -- (-1279.169) (-1276.376) (-1277.663) [-1279.583] * [-1278.417] (-1278.950) (-1279.232) (-1277.901) -- 0:00:01
978000 -- (-1279.212) (-1277.682) (-1279.121) [-1279.608] * (-1276.444) (-1278.679) (-1278.347) [-1279.602] -- 0:00:01
978500 -- (-1281.510) (-1279.399) (-1279.535) [-1278.345] * (-1278.734) [-1278.965] (-1278.405) (-1276.966) -- 0:00:01
979000 -- (-1281.310) (-1277.773) [-1278.457] (-1280.978) * (-1278.289) (-1280.358) [-1278.406] (-1278.987) -- 0:00:01
979500 -- (-1279.603) [-1277.286] (-1277.988) (-1279.962) * (-1278.689) (-1277.801) (-1277.608) [-1280.051] -- 0:00:01
980000 -- (-1279.854) (-1278.777) (-1278.559) [-1278.316] * (-1278.748) [-1277.434] (-1277.832) (-1279.170) -- 0:00:01
Average standard deviation of split frequencies: 0.006062
980500 -- [-1278.830] (-1280.430) (-1278.695) (-1282.663) * (-1277.717) (-1277.733) (-1278.436) [-1280.846] -- 0:00:01
981000 -- (-1278.161) (-1277.483) [-1279.135] (-1279.121) * (-1278.754) (-1278.836) [-1276.939] (-1279.870) -- 0:00:01
981500 -- (-1278.720) (-1277.905) (-1280.197) [-1279.110] * (-1283.088) (-1276.090) (-1275.648) [-1279.046] -- 0:00:01
982000 -- (-1280.220) (-1279.513) (-1278.286) [-1279.418] * (-1279.970) [-1277.718] (-1277.770) (-1277.888) -- 0:00:01
982500 -- [-1279.382] (-1279.542) (-1279.899) (-1277.534) * [-1286.284] (-1279.961) (-1277.532) (-1279.342) -- 0:00:01
983000 -- [-1278.998] (-1278.382) (-1279.394) (-1279.029) * (-1280.396) (-1277.732) [-1277.650] (-1277.546) -- 0:00:01
983500 -- (-1278.745) (-1278.404) (-1280.769) [-1279.783] * (-1279.716) [-1278.833] (-1279.982) (-1278.726) -- 0:00:01
984000 -- (-1284.081) [-1279.295] (-1279.073) (-1278.762) * (-1277.834) (-1278.844) (-1281.962) [-1278.384] -- 0:00:01
984500 -- (-1280.237) [-1277.935] (-1280.111) (-1279.452) * (-1279.992) (-1282.484) (-1283.056) [-1278.795] -- 0:00:01
985000 -- (-1278.915) (-1281.301) [-1278.586] (-1282.709) * (-1278.846) [-1280.605] (-1280.566) (-1282.453) -- 0:00:01
Average standard deviation of split frequencies: 0.005897
985500 -- [-1281.191] (-1278.405) (-1281.526) (-1278.424) * (-1281.548) (-1280.619) (-1278.599) [-1278.164] -- 0:00:01
986000 -- (-1278.950) [-1276.696] (-1280.786) (-1280.461) * (-1278.116) (-1281.004) (-1279.973) [-1278.521] -- 0:00:01
986500 -- (-1279.485) (-1279.060) [-1278.793] (-1279.294) * (-1278.809) (-1278.028) [-1277.749] (-1283.871) -- 0:00:00
987000 -- (-1280.077) [-1277.266] (-1278.426) (-1278.261) * [-1278.948] (-1278.583) (-1279.132) (-1278.812) -- 0:00:00
987500 -- [-1277.933] (-1278.994) (-1282.200) (-1279.620) * (-1277.399) [-1277.716] (-1278.677) (-1278.984) -- 0:00:00
988000 -- (-1279.053) (-1279.400) [-1278.212] (-1280.783) * (-1278.654) [-1278.651] (-1277.394) (-1280.757) -- 0:00:00
988500 -- (-1284.620) (-1279.027) [-1279.650] (-1281.964) * [-1279.963] (-1280.126) (-1277.166) (-1279.822) -- 0:00:00
989000 -- (-1280.052) [-1278.270] (-1277.653) (-1280.800) * [-1277.285] (-1279.704) (-1281.659) (-1281.700) -- 0:00:00
989500 -- (-1278.266) [-1278.368] (-1277.974) (-1278.870) * (-1281.148) (-1276.685) [-1280.345] (-1278.144) -- 0:00:00
990000 -- [-1279.864] (-1277.513) (-1278.085) (-1278.180) * [-1278.745] (-1279.824) (-1279.715) (-1278.494) -- 0:00:00
Average standard deviation of split frequencies: 0.005975
990500 -- [-1277.888] (-1278.267) (-1278.241) (-1277.306) * (-1282.334) (-1277.802) [-1279.131] (-1280.823) -- 0:00:00
991000 -- (-1279.651) (-1277.988) (-1282.064) [-1278.477] * (-1280.403) [-1279.338] (-1282.138) (-1278.499) -- 0:00:00
991500 -- (-1282.863) (-1279.568) (-1279.570) [-1276.332] * (-1279.397) (-1279.281) (-1281.453) [-1278.781] -- 0:00:00
992000 -- [-1278.000] (-1283.726) (-1279.820) (-1279.305) * (-1278.647) (-1277.921) (-1279.971) [-1280.311] -- 0:00:00
992500 -- [-1278.510] (-1277.674) (-1280.004) (-1277.007) * [-1277.369] (-1280.364) (-1282.342) (-1277.466) -- 0:00:00
993000 -- (-1278.547) [-1277.235] (-1280.136) (-1276.307) * (-1278.268) [-1282.255] (-1282.174) (-1277.602) -- 0:00:00
993500 -- (-1277.451) (-1280.397) [-1280.516] (-1280.259) * (-1279.719) (-1278.442) (-1282.647) [-1278.231] -- 0:00:00
994000 -- (-1276.865) (-1279.003) (-1279.713) [-1280.662] * (-1281.394) (-1277.783) (-1285.281) [-1278.164] -- 0:00:00
994500 -- (-1281.004) (-1280.898) (-1278.263) [-1278.773] * (-1279.863) (-1278.597) [-1279.868] (-1280.269) -- 0:00:00
995000 -- (-1282.188) (-1277.740) (-1280.813) [-1278.353] * [-1277.239] (-1279.129) (-1278.458) (-1279.165) -- 0:00:00
Average standard deviation of split frequencies: 0.005943
995500 -- [-1284.015] (-1278.482) (-1278.560) (-1278.663) * [-1278.805] (-1279.613) (-1280.153) (-1282.029) -- 0:00:00
996000 -- (-1279.004) [-1280.534] (-1280.983) (-1279.775) * (-1283.160) (-1279.637) [-1278.442] (-1279.351) -- 0:00:00
996500 -- (-1278.907) (-1280.993) (-1284.982) [-1279.528] * (-1277.626) (-1277.724) (-1278.133) [-1278.933] -- 0:00:00
997000 -- [-1281.578] (-1282.477) (-1277.909) (-1276.731) * (-1283.417) [-1278.461] (-1279.013) (-1280.737) -- 0:00:00
997500 -- (-1277.085) (-1280.079) (-1277.780) [-1277.379] * (-1279.149) [-1278.331] (-1282.094) (-1280.316) -- 0:00:00
998000 -- (-1280.707) (-1282.716) [-1278.159] (-1278.094) * (-1277.986) (-1280.517) (-1277.363) [-1278.596] -- 0:00:00
998500 -- (-1279.675) [-1280.006] (-1278.574) (-1277.735) * (-1279.122) [-1279.720] (-1277.601) (-1281.788) -- 0:00:00
999000 -- [-1279.123] (-1277.994) (-1278.836) (-1281.387) * (-1284.320) (-1277.867) [-1276.705] (-1280.441) -- 0:00:00
999500 -- [-1277.449] (-1280.666) (-1280.358) (-1284.868) * (-1285.414) (-1280.002) (-1277.627) [-1280.722] -- 0:00:00
1000000 -- (-1278.711) (-1280.027) [-1278.520] (-1284.964) * [-1278.899] (-1281.068) (-1279.925) (-1276.828) -- 0:00:00
Average standard deviation of split frequencies: 0.005705
Analysis completed in 1 mins 14 seconds
Analysis used 73.03 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1273.90
Likelihood of best state for "cold" chain of run 2 was -1273.98
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 78 %) Dirichlet(Revmat{all})
99.1 % ( 99 %) Slider(Revmat{all})
26.4 % ( 20 %) Dirichlet(Pi{all})
28.4 % ( 27 %) Slider(Pi{all})
73.3 % ( 44 %) Multiplier(Alpha{1,2})
79.1 % ( 55 %) Multiplier(Alpha{3})
24.4 % ( 29 %) Slider(Pinvar{all})
92.5 % ( 95 %) ExtSPR(Tau{all},V{all})
64.2 % ( 68 %) ExtTBR(Tau{all},V{all})
92.5 % ( 95 %) NNI(Tau{all},V{all})
81.3 % ( 85 %) ParsSPR(Tau{all},V{all})
28.1 % ( 25 %) Multiplier(V{all})
94.6 % ( 87 %) Nodeslider(V{all})
30.5 % ( 34 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 74 %) Dirichlet(Revmat{all})
99.0 % ( 99 %) Slider(Revmat{all})
26.3 % ( 30 %) Dirichlet(Pi{all})
27.7 % ( 30 %) Slider(Pi{all})
72.3 % ( 51 %) Multiplier(Alpha{1,2})
79.0 % ( 55 %) Multiplier(Alpha{3})
23.2 % ( 29 %) Slider(Pinvar{all})
93.1 % ( 92 %) ExtSPR(Tau{all},V{all})
64.3 % ( 60 %) ExtTBR(Tau{all},V{all})
93.1 % ( 93 %) NNI(Tau{all},V{all})
81.7 % ( 83 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
94.6 % ( 97 %) Nodeslider(V{all})
30.3 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.50
2 | 166985 0.82 0.67
3 | 166099 166772 0.84
4 | 166333 166557 167254
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166892 0.82 0.66
3 | 166643 165848 0.83
4 | 166779 167449 166389
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1278.26
|1 2 2 2 1 |
| 1 1 2 1 2 2 |
| 2 2 1 |
| 2 1 2 2 1 222 12 2 |
| 1 22 *1 1 1 2 1 22 1 2 |
| 1 12 2 2 1 2 1*2|
| * 1 1 1 212 1 12 112 22 11 1|
| 2 2 2 2 1 11 1 1 2 21 1 1 |
| 1 12 * 2 1 1 |
| 2 1 1 2 2 2 2 121 1 1 |
| 1 22 2 2 1 |
|2 2 2 2 1 |
| 1 11 |
| 1 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1279.98
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1278.08 -1281.85
2 -1277.99 -1281.00
--------------------------------------
TOTAL -1278.04 -1281.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886710 0.086831 0.359831 1.467244 0.857778 1478.26 1489.63 1.000
r(A<->C){all} 0.156934 0.017416 0.000089 0.417183 0.124070 124.07 189.43 1.000
r(A<->G){all} 0.165557 0.020941 0.000049 0.462444 0.124650 133.48 226.81 1.004
r(A<->T){all} 0.171909 0.019869 0.000069 0.458637 0.138632 144.27 181.69 1.003
r(C<->G){all} 0.189137 0.022575 0.000111 0.485098 0.154806 309.51 352.56 1.014
r(C<->T){all} 0.158919 0.019558 0.000093 0.448204 0.116489 173.05 221.18 1.008
r(G<->T){all} 0.157544 0.019357 0.000050 0.442194 0.119884 183.60 290.96 1.000
pi(A){all} 0.169833 0.000147 0.144766 0.191629 0.169662 1212.73 1356.86 1.000
pi(C){all} 0.281320 0.000225 0.252404 0.311027 0.281598 1198.72 1246.63 1.000
pi(G){all} 0.345545 0.000242 0.318649 0.379219 0.345290 1268.77 1320.56 1.000
pi(T){all} 0.203301 0.000171 0.178951 0.229670 0.203223 1341.32 1401.69 1.000
alpha{1,2} 0.414864 0.214487 0.000174 1.392668 0.253203 1180.12 1209.75 1.000
alpha{3} 0.423791 0.216216 0.000484 1.354872 0.257375 1246.03 1279.02 1.000
pinvar{all} 0.996728 0.000009 0.991109 0.999937 0.997557 1206.04 1274.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..****
8 -- ...*.*
9 -- ..*.*.
10 -- ..*..*
11 -- ...**.
12 -- ....**
13 -- ..**..
14 -- .*.***
15 -- .****.
16 -- .*...*
17 -- .*..*.
18 -- .*.*..
19 -- .**.**
20 -- .***.*
21 -- .**...
22 -- ..***.
23 -- ...***
24 -- ..*.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 771 0.256829 0.009893 0.249833 0.263824 2
8 481 0.160227 0.011777 0.151899 0.168554 2
9 480 0.159893 0.003769 0.157229 0.162558 2
10 462 0.153897 0.013191 0.144570 0.163225 2
11 459 0.152898 0.006124 0.148568 0.157229 2
12 442 0.147235 0.002827 0.145237 0.149234 2
13 437 0.145570 0.004240 0.142572 0.148568 2
14 389 0.129580 0.008951 0.123251 0.135909 2
15 378 0.125916 0.005653 0.121919 0.129913 2
16 366 0.121919 0.002827 0.119920 0.123917 2
17 366 0.121919 0.002827 0.119920 0.123917 2
18 364 0.121252 0.002827 0.119254 0.123251 2
19 362 0.120586 0.003769 0.117921 0.123251 2
20 361 0.120253 0.005182 0.116589 0.123917 2
21 359 0.119587 0.006124 0.115256 0.123917 2
22 318 0.105929 0.002827 0.103931 0.107928 2
23 304 0.101266 0.009422 0.094604 0.107928 2
24 301 0.100266 0.000471 0.099933 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1740/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.103374 0.010386 0.000004 0.292566 0.072977 1.000 2
length{all}[2] 0.101001 0.010238 0.000032 0.303933 0.067823 1.000 2
length{all}[3] 0.097803 0.009570 0.000043 0.288714 0.068778 1.001 2
length{all}[4] 0.092653 0.008916 0.000004 0.286350 0.063574 1.000 2
length{all}[5] 0.096265 0.009146 0.000011 0.284748 0.066582 1.000 2
length{all}[6] 0.093409 0.008813 0.000063 0.280200 0.064038 1.000 2
length{all}[7] 0.139664 0.016447 0.000313 0.377737 0.099206 0.999 2
length{all}[8] 0.086650 0.007736 0.000742 0.264274 0.062879 0.999 2
length{all}[9] 0.100097 0.008141 0.000027 0.267909 0.072677 0.999 2
length{all}[10] 0.088838 0.008584 0.000103 0.252801 0.059566 0.998 2
length{all}[11] 0.101235 0.012166 0.000227 0.312330 0.067438 0.999 2
length{all}[12] 0.091786 0.008212 0.000109 0.271718 0.063971 1.001 2
length{all}[13] 0.096736 0.009444 0.000055 0.286593 0.066564 0.999 2
length{all}[14] 0.094569 0.009481 0.000118 0.256599 0.066766 0.998 2
length{all}[15] 0.098627 0.009712 0.000063 0.291073 0.063014 0.999 2
length{all}[16] 0.088977 0.008246 0.000009 0.276668 0.062013 0.999 2
length{all}[17] 0.101273 0.009938 0.000080 0.319582 0.073894 0.999 2
length{all}[18] 0.098716 0.008525 0.000317 0.278124 0.077192 1.001 2
length{all}[19] 0.111199 0.012753 0.000079 0.309032 0.076255 0.998 2
length{all}[20] 0.098580 0.011687 0.000479 0.304606 0.065210 0.997 2
length{all}[21] 0.089057 0.008005 0.000404 0.275177 0.059760 1.001 2
length{all}[22] 0.097048 0.008098 0.000337 0.271643 0.070436 0.998 2
length{all}[23] 0.097542 0.011311 0.000370 0.340809 0.058288 0.997 2
length{all}[24] 0.098294 0.008263 0.000357 0.260318 0.072145 1.002 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005705
Maximum standard deviation of split frequencies = 0.013191
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------ C5 (5)
|
\--------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 39 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 936
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 312 / 312 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 312 / 312 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.051289 0.010148 0.039139 0.104450 0.094595 0.079229 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1347.818107
Iterating by ming2
Initial: fx= 1347.818107
x= 0.05129 0.01015 0.03914 0.10445 0.09459 0.07923 0.30000 1.30000
1 h-m-p 0.0000 0.0000 702.2691 +YYCCYC 1327.072708 5 0.0000 23 | 0/8
2 h-m-p 0.0000 0.0000 7549.7463 ++ 1290.733834 m 0.0000 34 | 1/8
3 h-m-p 0.0000 0.0000 3104.2999 ++ 1252.791984 m 0.0000 45 | 2/8
4 h-m-p 0.0000 0.0000 5391.6844 ++ 1242.840628 m 0.0000 56 | 3/8
5 h-m-p 0.0000 0.0000 262.3406 ++ 1239.687903 m 0.0000 67 | 4/8
6 h-m-p 0.0013 0.1946 0.5755 +++YCYYCCC 1238.107999 6 0.1296 91 | 4/8
7 h-m-p 0.0441 0.2206 1.1015 ++ 1237.823539 m 0.2206 106 | 5/8
8 h-m-p 0.3007 8.0000 0.3043 +++ 1237.474635 m 8.0000 118 | 5/8
9 h-m-p 1.6000 8.0000 0.0528 YC 1237.461781 1 3.8023 133 | 5/8
10 h-m-p 1.6000 8.0000 0.0444 YC 1237.449480 1 3.9024 148 | 5/8
11 h-m-p 0.5547 8.0000 0.3126 ++ 1237.406001 m 8.0000 162 | 5/8
12 h-m-p 1.6000 8.0000 1.1336 CCC 1237.369163 2 2.1191 180 | 5/8
13 h-m-p 1.6000 8.0000 1.2285 +YCC 1237.345596 2 4.7849 195 | 5/8
14 h-m-p 1.6000 8.0000 2.2098 CCC 1237.331614 2 2.3276 210 | 5/8
15 h-m-p 1.6000 8.0000 2.8040 +YC 1237.320622 1 4.9861 223 | 5/8
16 h-m-p 1.6000 8.0000 4.8030 CC 1237.314706 1 2.2454 236 | 5/8
17 h-m-p 1.6000 8.0000 6.2645 +CC 1237.309507 1 5.5884 250 | 5/8
18 h-m-p 1.6000 8.0000 11.0715 CC 1237.307058 1 2.1121 263 | 5/8
19 h-m-p 1.6000 8.0000 13.9753 +C 1237.304740 0 6.2844 275 | 5/8
20 h-m-p 1.6000 8.0000 24.9721 CC 1237.303722 1 1.9625 288 | 5/8
21 h-m-p 1.5573 8.0000 31.4703 ++ 1237.302680 m 8.0000 299 | 5/8
22 h-m-p 1.6000 8.0000 52.9042 C 1237.302251 0 1.6359 310 | 5/8
23 h-m-p 1.2164 6.0819 69.2167 ++ 1237.301819 m 6.0819 321 | 6/8
24 h-m-p 1.6000 8.0000 0.0000 Y 1237.301817 0 0.9804 332 | 6/8
25 h-m-p 1.6000 8.0000 0.0000 C 1237.301817 0 0.4199 345
Out..
lnL = -1237.301817
346 lfun, 346 eigenQcodon, 2076 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.088305 0.085394 0.025051 0.089471 0.060181 0.031522 0.000100 0.818488 0.191701
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 17.060401
np = 9
lnL0 = -1340.337816
Iterating by ming2
Initial: fx= 1340.337816
x= 0.08831 0.08539 0.02505 0.08947 0.06018 0.03152 0.00011 0.81849 0.19170
1 h-m-p 0.0000 0.0000 671.1932 ++ 1339.723541 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0001 947.7281 ++ 1293.163923 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0000 578.0127 ++ 1286.920129 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0002 708.2909 ++ 1259.166184 m 0.0002 50 | 4/9
5 h-m-p 0.0000 0.0000 1386.5461 ++ 1251.622372 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0001 512.8583 ++ 1243.499283 m 0.0001 74 | 6/9
7 h-m-p 0.0002 0.0008 38.3450 +YYYCYYCCC 1237.514549 8 0.0007 99 | 6/9
8 h-m-p 0.0430 1.3048 0.6295 +CC 1237.454306 1 0.1722 114 | 6/9
9 h-m-p 0.8049 4.0243 0.0115 YC 1237.453369 1 0.1375 130 | 6/9
10 h-m-p 0.6981 8.0000 0.0023 +YC 1237.453311 1 1.8746 147 | 6/9
11 h-m-p 0.6706 8.0000 0.0063 -C 1237.453306 0 0.0531 163 | 6/9
12 h-m-p 1.6000 8.0000 0.0000 Y 1237.453306 0 0.2550 178 | 6/9
13 h-m-p 0.3380 8.0000 0.0000 --C 1237.453306 0 0.0053 195 | 6/9
14 h-m-p 0.0160 8.0000 0.0000 --------N 1237.453306 0 0.0000 218
Out..
lnL = -1237.453306
219 lfun, 657 eigenQcodon, 2628 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.051060 0.011289 0.058526 0.020125 0.014038 0.033401 0.000100 1.368068 0.532157 0.226172 1084.914709
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.073642
np = 11
lnL0 = -1263.861818
Iterating by ming2
Initial: fx= 1263.861818
x= 0.05106 0.01129 0.05853 0.02012 0.01404 0.03340 0.00011 1.36807 0.53216 0.22617 951.42857
1 h-m-p 0.0000 0.0000 214.6439 ++ 1263.721215 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0023 47.1666 +++CYCCC 1263.314187 4 0.0007 40 | 1/11
3 h-m-p 0.0009 0.0046 33.5266 ++ 1259.722983 m 0.0046 54 | 2/11
4 h-m-p 0.0000 0.0002 240.4151 ++ 1258.036430 m 0.0002 68 | 3/11
5 h-m-p 0.0003 0.0014 77.4691 ++ 1257.229573 m 0.0014 82 | 4/11
6 h-m-p 0.0000 0.0001 127.9398 ++ 1256.786935 m 0.0001 96 | 5/11
7 h-m-p 0.0003 0.0588 24.2362 ++++ 1245.192043 m 0.0588 112 | 5/11
8 h-m-p 0.1061 0.5304 1.6955 +YYYCCCC 1237.675243 6 0.3800 136 | 5/11
9 h-m-p 0.0274 0.1371 1.8311 ++ 1236.951426 m 0.1371 150 | 6/11
10 h-m-p 0.0765 8.0000 3.1578 +YCCC 1234.511676 3 0.5237 170 | 6/11
11 h-m-p 1.0106 5.0528 0.0499 CYCYC 1234.414365 4 2.1312 191 | 6/11
12 h-m-p 1.3618 8.0000 0.0781 YC 1234.409909 1 1.0351 211 | 6/11
13 h-m-p 1.6000 8.0000 0.0022 C 1234.409731 0 2.0843 230 | 6/11
14 h-m-p 1.0309 8.0000 0.0045 ++ 1234.404584 m 8.0000 249 | 6/11
15 h-m-p 0.0002 0.0462 168.3190 +++CYYYCYCYC 1233.675575 8 0.0350 282 | 6/11
16 h-m-p 0.0322 0.1611 19.0645 YCYCCC 1233.461647 5 0.0958 305 | 6/11
17 h-m-p 0.0095 0.0475 26.0196 CYCYC 1233.377770 4 0.0205 326 | 6/11
18 h-m-p 0.2002 1.0009 0.7119 YCYCCC 1233.113143 5 0.4706 348 | 6/11
19 h-m-p 0.4549 8.0000 0.7364 YCYCC 1232.734550 4 0.8420 373 | 6/11
20 h-m-p 1.6000 8.0000 0.1894 +YCYC 1232.510623 3 4.4287 397 | 6/11
21 h-m-p 1.6000 8.0000 0.0264 CC 1232.507529 1 2.3527 418 | 6/11
22 h-m-p 0.6420 8.0000 0.0968 YC 1232.504440 1 1.3629 438 | 6/11
23 h-m-p 1.6000 8.0000 0.0064 YC 1232.500472 1 3.2244 458 | 6/11
24 h-m-p 1.6000 8.0000 0.0054 Y 1232.500465 0 0.9823 477 | 6/11
25 h-m-p 1.6000 8.0000 0.0002 C 1232.500465 0 1.4834 496 | 6/11
26 h-m-p 1.6000 8.0000 0.0002 ++ 1232.500465 m 8.0000 515 | 6/11
27 h-m-p 0.1984 8.0000 0.0071 ++C 1232.500463 0 3.0999 536 | 6/11
28 h-m-p 1.5190 8.0000 0.0145 ++ 1232.500446 m 8.0000 555 | 6/11
29 h-m-p 0.0049 1.7047 23.5995 +++++ 1232.496914 m 1.7047 577 | 7/11
30 h-m-p 0.9649 8.0000 0.2180 CC 1232.494535 1 0.9858 593 | 7/11
31 h-m-p 1.6000 8.0000 0.0032 Y 1232.494527 0 1.0569 611 | 7/11
32 h-m-p 1.6000 8.0000 0.0005 Y 1232.494527 0 0.8014 629 | 7/11
33 h-m-p 1.6000 8.0000 0.0001 ------C 1232.494527 0 0.0001 653
Out..
lnL = -1232.494527
654 lfun, 2616 eigenQcodon, 11772 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1237.271878 S = -1233.600401 -5.132821
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:04
did 20 / 55 patterns 0:04
did 30 / 55 patterns 0:04
did 40 / 55 patterns 0:04
did 50 / 55 patterns 0:04
did 55 / 55 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.101514 0.090811 0.067700 0.016834 0.051668 0.080940 0.000100 1.052075 1.983119
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.880812
np = 9
lnL0 = -1350.758998
Iterating by ming2
Initial: fx= 1350.758998
x= 0.10151 0.09081 0.06770 0.01683 0.05167 0.08094 0.00011 1.05208 1.98312
1 h-m-p 0.0000 0.0000 689.6397 ++ 1350.126843 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0011 124.2129 ++++ 1341.521942 m 0.0011 28 | 1/9
3 h-m-p 0.0001 0.0003 180.7223 ++ 1337.181298 m 0.0003 40 | 2/9
4 h-m-p 0.0000 0.0000 81926.8801 ++ 1310.548287 m 0.0000 52 | 3/9
5 h-m-p 0.0000 0.0000 282963.6338 +CYYYCCCCC 1289.944298 8 0.0000 79 | 3/9
6 h-m-p 0.0001 0.0004 106.2803 +YYCYCCC 1286.215617 6 0.0003 101 | 2/9
7 h-m-p 0.0000 0.0000 332167.4445 ++ 1285.270583 m 0.0000 113 | 3/9
8 h-m-p 0.0000 0.0008 160.5870 +++ 1278.537063 m 0.0008 126 | 3/9
9 h-m-p 0.0000 0.0000 1104225.0200 -YYCCCCC 1273.622650 6 0.0000 150 | 3/9
10 h-m-p 0.0000 0.0013 174.2706 +++ 1239.283457 m 0.0013 163 | 4/9
11 h-m-p 0.0153 0.0764 0.4130 ++ 1239.082023 m 0.0764 175 | 5/9
12 h-m-p 0.0882 8.0000 0.3575 +++CYCCC 1238.385128 4 4.6863 202 | 5/9
13 h-m-p 1.6000 8.0000 0.1508 ++ 1238.218368 m 8.0000 218 | 5/9
14 h-m-p 0.0584 0.2918 6.0088 +
QuantileBeta(0.85, 2.66396, 0.00500) = 1.000000e+00 2000 rounds
+ 1238.045245 m 0.2918 234
QuantileBeta(0.85, 2.66396, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.66396, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.66396, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.66396, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.66396, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.66396, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.66396, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.66396, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.66396, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
15 h-m-p 1.6000 8.0000 0.0181
QuantileBeta(0.85, 2.69292, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.77980, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.70718, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.74349, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.70399, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 2.70368, 0.00500) = 1.000000e+00 2000 rounds
C 1238.036446 2 2.1946 249
QuantileBeta(0.85, 2.70368, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.70368, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.70368, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.70368, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.70368, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.70368, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.70368, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.70368, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.70368, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.70382, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.70355, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.70368, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
16 h-m-p 0.3404 8.0000 0.1167
QuantileBeta(0.85, 2.74341, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.86258, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.33925, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.63718, 0.00500) = 1.000000e+00 2000 rounds
+ 1238.003758 m 8.0000 265
QuantileBeta(0.85, 3.63718, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.63718, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.63718, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.63718, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.63718, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.63718, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.63718, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.63718, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.63718, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.63734, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.63702, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.63718, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
17 h-m-p 0.1309 8.0000 7.1319
QuantileBeta(0.85, 4.57068, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.37116, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 18.57311, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 23.93965, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 12.97214, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 19.12311, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 15.77263, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.80145, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 18.79811, 0.00500) = 1.000000e+00 2000 rounds
C 1237.810790 3 2.1258 287
QuantileBeta(0.85, 18.79811, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.79811, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.79811, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.79811, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.79811, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.79811, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.79811, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.79812, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.79811, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
18 h-m-p 1.6000 8.0000 0.0029
QuantileBeta(0.85, 18.80272, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.81654, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.80153, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 18.80160, 0.00500) = 1.000000e+00 2000 rounds
C 1237.810600 1 1.2128 300
QuantileBeta(0.85, 18.80160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.80160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.80160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.80160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.80160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.80160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.80160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.80160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.80160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.80201, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.80119, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.80160, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
19 h-m-p 0.2697 8.0000 0.0130
QuantileBeta(0.85, 18.80509, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.81557, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 18.85749, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82392, 0.00500) = 1.000000e+00 2000 rounds
C 1237.810599 0 1.7230 316
QuantileBeta(0.85, 18.82392, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82392, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82392, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82392, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82392, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82392, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82392, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82392, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82392, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82433, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82350, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82392, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
20 h-m-p 1.6000 8.0000 0.0036
QuantileBeta(0.85, 18.82970, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82536, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
C 1237.810599 0 0.4356 331
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82591, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82508, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
21 h-m-p 0.7710 8.0000 0.0020
QuantileBeta(0.85, 18.82707, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82589, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82559, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82552, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82550, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82550, 0.00500) = 1.000000e+00 2000 rounds
Y 1237.810599 0 0.0008 350
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82591, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82508, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
22 h-m-p 0.0160 8.0000 0.0020
QuantileBeta(0.85, 18.82553, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82550, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
Y 1237.810599 0 0.0003 367
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82591, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82508, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
23 h-m-p 0.0160 8.0000 0.0451
QuantileBeta(0.85, 18.82621, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82567, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82554, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82550, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82550, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
N 1237.810599 0 0.0000 389
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82591, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82508, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
24 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 18.82549, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82550, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 18.82550, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 18.82552, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 18.82562, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
+ 1237.810599 m 8.0000 407
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82615, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82532, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
25 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.85, 18.82552, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82568, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82572, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
C 1237.810599 0 0.0000 429
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -1237.810599
430 lfun, 4730 eigenQcodon, 25800 P(t)
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.82573, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:12
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.013212 0.076797 0.026406 0.028408 0.016130 0.028274 0.000100 0.900000 0.632396 1.133418 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.110885
np = 11
lnL0 = -1256.297149
Iterating by ming2
Initial: fx= 1256.297149
x= 0.01321 0.07680 0.02641 0.02841 0.01613 0.02827 0.00011 0.90000 0.63240 1.13342 951.42857
1 h-m-p 0.0000 0.0000 210.5596 ++ 1256.145968 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0000 4136.0158 ++ 1246.952526 m 0.0000 30 | 2/11
3 h-m-p 0.0000 0.0000 82336.6357 ++ 1241.300356 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0000 6555.2005 ++ 1240.472271 m 0.0000 58 | 4/11
5 h-m-p 0.0000 0.0000 1037.3728 ++ 1240.434100 m 0.0000 72 | 5/11
6 h-m-p 0.0000 0.0000 195694.4592 +YYYYCCCCC 1237.687174 8 0.0000 99 | 5/11
7 h-m-p 0.0002 0.0009 40.7229 +YYCYCCC 1235.751384 6 0.0006 123 | 5/11
8 h-m-p 0.0357 0.2164 0.7109 +YYCYYCCC 1232.776847 7 0.1955 149 | 5/11
9 h-m-p 0.1215 0.6077 0.2309 YCC 1232.770181 2 0.0766 172 | 5/11
10 h-m-p 0.0269 0.8318 0.6577 ++YCYCCC 1232.608468 5 0.6254 202 | 5/11
11 h-m-p 0.0620 0.3099 0.3995 ++ 1232.580315 m 0.3099 222 | 6/11
12 h-m-p 1.5260 8.0000 0.0119 C 1232.560701 0 1.5260 242 | 6/11
13 h-m-p 1.1199 8.0000 0.0161 YCCC 1232.550853 3 2.3341 266 | 6/11
14 h-m-p 1.6000 8.0000 0.0183 ++ 1232.522688 m 8.0000 285 | 6/11
15 h-m-p 0.7847 6.6021 0.1865 YCCC 1232.501818 3 1.7106 309 | 6/11
16 h-m-p 1.6000 8.0000 0.0103 YC 1232.501583 1 1.0393 329 | 6/11
17 h-m-p 1.6000 8.0000 0.0032 C 1232.501571 0 1.3808 348 | 6/11
18 h-m-p 1.6000 8.0000 0.0004 C 1232.501571 0 1.3950 367 | 6/11
19 h-m-p 1.6000 8.0000 0.0003 ++ 1232.501570 m 8.0000 386 | 6/11
20 h-m-p 0.2813 8.0000 0.0075 +Y 1232.501569 0 2.5635 406 | 6/11
21 h-m-p 1.2350 8.0000 0.0157 ++ 1232.501556 m 8.0000 425 | 6/11
22 h-m-p 0.1778 8.0000 0.7053 ++C 1232.501436 0 2.8442 446 | 6/11
23 h-m-p 1.6000 8.0000 1.0233 ++ 1232.500195 m 8.0000 465 | 6/11
24 h-m-p 0.0146 0.0728 511.4468 ++ 1232.494692 m 0.0728 479 | 7/11
25 h-m-p 0.1121 0.5605 3.3636 +Y 1232.494638 0 0.2802 494 | 7/11
26 h-m-p 0.7077 8.0000 1.3320
QuantileBeta(0.15, 0.00500, 4.71797) = 4.871731e-161 2000 rounds
C 1232.494524 0 0.8142 508 | 7/11
27 h-m-p 1.6000 8.0000 0.0582 Y 1232.494524 0 0.7543 522 | 7/11
28 h-m-p 0.7908 8.0000 0.0555 -------Y 1232.494524 0 0.0000 547 | 7/11
29 h-m-p 0.0160 8.0000 0.0039 Y 1232.494524 0 0.0112 565 | 7/11
30 h-m-p 0.0274 8.0000 0.0016 ----Y 1232.494524 0 0.0000 587 | 7/11
31 h-m-p 0.0160 8.0000 0.0140 --C 1232.494524 0 0.0003 607 | 7/11
32 h-m-p 0.0160 8.0000 0.0087 -----C 1232.494524 0 0.0000 630 | 7/11
33 h-m-p 0.0160 8.0000 0.0001 -----------N 1232.494524 0 0.0000 659
Out..
lnL = -1232.494524
660 lfun, 7920 eigenQcodon, 43560 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1237.289801 S = -1233.600439 -4.598988
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:23
did 20 / 55 patterns 0:24
did 30 / 55 patterns 0:24
did 40 / 55 patterns 0:24
did 50 / 55 patterns 0:24
did 55 / 55 patterns 0:24
Time used: 0:24
CodeML output code: -1