--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:36:14 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1761/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -474.55 -478.03
2 -474.53 -477.60
--------------------------------------
TOTAL -474.54 -477.84
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.883104 0.088762 0.352783 1.488230 0.854249 1090.99 1147.50 1.001
r(A<->C){all} 0.167585 0.019095 0.000050 0.443355 0.136145 179.08 181.94 1.001
r(A<->G){all} 0.180049 0.021588 0.000150 0.473522 0.146768 192.99 212.69 1.000
r(A<->T){all} 0.157465 0.019037 0.000040 0.448606 0.119989 212.17 221.26 1.004
r(C<->G){all} 0.161923 0.016999 0.000191 0.420253 0.130040 152.92 229.16 1.006
r(C<->T){all} 0.164875 0.019264 0.000022 0.438127 0.126714 232.40 261.22 1.004
r(G<->T){all} 0.168103 0.019555 0.000006 0.448653 0.134615 84.48 191.38 1.001
pi(A){all} 0.225158 0.000503 0.180862 0.267063 0.225034 1226.25 1288.80 1.000
pi(C){all} 0.253768 0.000550 0.207560 0.298654 0.253385 1290.45 1395.73 1.000
pi(G){all} 0.283733 0.000598 0.235265 0.329651 0.283144 1385.16 1443.08 1.000
pi(T){all} 0.237341 0.000527 0.193574 0.282473 0.237047 1115.41 1208.27 1.000
alpha{1,2} 0.431521 0.254590 0.000114 1.456041 0.261105 1345.43 1423.22 1.001
alpha{3} 0.457958 0.229322 0.000367 1.469619 0.289619 1301.07 1309.61 1.001
pinvar{all} 0.995357 0.000029 0.984602 0.999996 0.997105 1295.48 1353.74 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -455.7719
Model 2: PositiveSelection -455.771988
Model 0: one-ratio -455.77203
Model 7: beta -455.771912
Model 8: beta&w>1 -455.772006
Model 0 vs 1 2.599999999119973E-4
Model 2 vs 1 1.7600000001039007E-4
Model 8 vs 7 1.8799999998009298E-4
>C1
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C2
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C3
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C4
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C5
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C6
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=114
C1 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C2 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C3 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C4 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C5 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C6 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
**************************************************
C1 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C2 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C3 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C4 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C5 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C6 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
**************************************************
C1 ISRLVNSEGSSSAE
C2 ISRLVNSEGSSSAE
C3 ISRLVNSEGSSSAE
C4 ISRLVNSEGSSSAE
C5 ISRLVNSEGSSSAE
C6 ISRLVNSEGSSSAE
**************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 114 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 114 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3420]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3420]--->[3420]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.457 Mb, Max= 30.641 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C2 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C3 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C4 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C5 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C6 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
**************************************************
C1 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C2 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C3 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C4 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C5 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C6 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
**************************************************
C1 ISRLVNSEGSSSAE
C2 ISRLVNSEGSSSAE
C3 ISRLVNSEGSSSAE
C4 ISRLVNSEGSSSAE
C5 ISRLVNSEGSSSAE
C6 ISRLVNSEGSSSAE
**************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
C2 TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
C3 TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
C4 TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
C5 TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
C6 TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
**************************************************
C1 TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
C2 TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
C3 TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
C4 TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
C5 TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
C6 TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
**************************************************
C1 TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
C2 TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
C3 TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
C4 TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
C5 TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
C6 TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
**************************************************
C1 AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
C2 AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
C3 AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
C4 AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
C5 AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
C6 AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
**************************************************
C1 CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
C2 CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
C3 CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
C4 CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
C5 CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
C6 CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
**************************************************
C1 TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
C2 TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
C3 TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
C4 TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
C5 TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
C6 TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
**************************************************
C1 ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
C2 ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
C3 ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
C4 ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
C5 ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
C6 ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
******************************************
>C1
TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
>C2
TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
>C3
TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
>C4
TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
>C5
TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
>C6
TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
>C1
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C2
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C3
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C4
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C5
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C6
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 342 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579858492
Setting output file names to "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 993132185
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5687294830
Seed = 1750970775
Swapseed = 1579858492
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -765.412279 -- -24.965149
Chain 2 -- -765.412395 -- -24.965149
Chain 3 -- -765.412395 -- -24.965149
Chain 4 -- -765.412395 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -765.412395 -- -24.965149
Chain 2 -- -765.412351 -- -24.965149
Chain 3 -- -765.412351 -- -24.965149
Chain 4 -- -765.412395 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-765.412] (-765.412) (-765.412) (-765.412) * [-765.412] (-765.412) (-765.412) (-765.412)
500 -- (-490.993) [-484.658] (-487.090) (-487.800) * (-484.033) (-480.794) [-486.579] (-488.652) -- 0:33:19
1000 -- (-494.595) (-480.918) [-490.389] (-481.916) * [-482.756] (-487.003) (-488.637) (-480.254) -- 0:16:39
1500 -- (-492.013) (-483.146) (-486.618) [-487.612] * [-484.441] (-481.693) (-482.806) (-489.838) -- 0:11:05
2000 -- (-486.935) [-482.723] (-482.866) (-489.363) * [-482.233] (-491.615) (-485.857) (-484.805) -- 0:08:19
2500 -- (-483.426) (-482.109) (-485.263) [-485.883] * [-487.542] (-490.286) (-490.919) (-483.990) -- 0:06:39
3000 -- (-486.902) [-481.369] (-482.890) (-485.282) * (-486.645) [-481.475] (-482.979) (-491.182) -- 0:05:32
3500 -- (-492.305) (-481.841) [-483.866] (-482.948) * (-484.963) [-480.357] (-487.180) (-482.165) -- 0:04:44
4000 -- (-480.734) (-482.375) (-489.270) [-481.457] * (-479.365) (-481.546) (-488.108) [-483.267] -- 0:04:09
4500 -- [-488.800] (-488.587) (-487.612) (-485.036) * [-476.862] (-485.566) (-484.704) (-482.182) -- 0:03:41
5000 -- (-484.204) [-481.201] (-485.119) (-480.170) * (-484.530) (-482.462) (-505.892) [-478.197] -- 0:03:19
Average standard deviation of split frequencies: 0.057140
5500 -- (-489.259) [-487.752] (-493.442) (-482.044) * (-483.886) [-484.481] (-490.940) (-486.288) -- 0:03:00
6000 -- (-488.139) (-493.566) (-482.809) [-482.444] * (-487.956) (-487.601) [-478.019] (-491.915) -- 0:02:45
6500 -- [-484.622] (-480.834) (-492.147) (-486.106) * [-484.564] (-484.953) (-476.422) (-480.040) -- 0:02:32
7000 -- [-479.547] (-477.057) (-478.262) (-489.045) * (-481.526) (-485.053) [-474.575] (-489.727) -- 0:02:21
7500 -- (-489.921) (-474.281) (-486.706) [-483.400] * (-487.002) (-484.175) [-478.276] (-499.092) -- 0:02:12
8000 -- (-489.861) (-474.442) (-487.839) [-495.636] * (-483.062) (-485.611) (-477.589) [-488.470] -- 0:02:04
8500 -- (-488.466) [-474.763] (-483.380) (-490.549) * [-491.843] (-483.512) (-475.656) (-483.621) -- 0:01:56
9000 -- (-481.069) (-473.816) [-487.889] (-483.823) * (-486.865) (-480.433) (-476.292) [-484.118] -- 0:01:50
9500 -- (-482.037) (-475.299) [-478.919] (-487.082) * (-484.713) (-485.778) (-474.976) [-479.243] -- 0:01:44
10000 -- [-481.597] (-477.577) (-487.468) (-476.262) * (-481.713) (-485.012) (-476.878) [-478.357] -- 0:01:39
Average standard deviation of split frequencies: 0.074432
10500 -- (-483.598) [-475.091] (-493.498) (-474.236) * (-487.473) (-485.661) [-476.496] (-483.146) -- 0:01:34
11000 -- (-479.678) (-475.705) (-488.922) [-474.047] * (-492.244) (-474.754) (-473.842) [-483.520] -- 0:01:29
11500 -- [-485.431] (-474.727) (-492.814) (-476.577) * (-495.035) (-477.979) (-473.613) [-486.663] -- 0:01:25
12000 -- (-487.747) (-476.664) [-483.927] (-475.669) * (-477.807) [-476.501] (-477.077) (-484.527) -- 0:01:22
12500 -- (-497.195) [-474.755] (-484.477) (-473.317) * (-481.868) [-479.084] (-477.225) (-481.452) -- 0:01:19
13000 -- (-486.117) [-474.950] (-481.910) (-476.028) * [-483.840] (-478.952) (-474.953) (-491.439) -- 0:01:15
13500 -- (-491.828) (-476.014) (-484.701) [-476.892] * (-483.918) (-474.822) (-478.855) [-484.189] -- 0:02:26
14000 -- (-484.736) [-475.986] (-498.131) (-476.430) * (-485.387) (-474.672) (-474.496) [-481.807] -- 0:02:20
14500 -- [-480.459] (-480.610) (-487.876) (-473.730) * (-481.138) (-473.610) [-474.307] (-481.947) -- 0:02:15
15000 -- (-489.810) (-475.458) (-484.383) [-473.407] * [-486.081] (-473.340) (-476.209) (-489.163) -- 0:02:11
Average standard deviation of split frequencies: 0.051911
15500 -- (-494.564) [-473.666] (-497.965) (-474.695) * (-483.444) (-474.965) (-474.831) [-477.831] -- 0:02:07
16000 -- (-491.152) (-474.741) [-473.584] (-474.794) * (-486.964) [-474.281] (-478.186) (-482.100) -- 0:02:03
16500 -- (-496.093) (-474.386) (-474.480) [-473.230] * (-483.168) (-473.446) [-474.538] (-486.513) -- 0:01:59
17000 -- (-474.665) (-474.690) (-476.489) [-479.913] * (-483.585) (-473.180) [-473.802] (-485.940) -- 0:01:55
17500 -- (-474.146) [-474.856] (-474.576) (-475.365) * (-482.546) [-474.961] (-474.151) (-485.719) -- 0:01:52
18000 -- (-477.286) [-473.606] (-476.863) (-474.610) * [-485.590] (-480.550) (-473.585) (-481.121) -- 0:01:49
18500 -- (-476.614) (-474.370) [-475.751] (-474.671) * (-478.284) [-475.883] (-475.917) (-492.407) -- 0:01:46
19000 -- (-478.259) (-475.508) [-479.831] (-475.434) * [-484.202] (-475.241) (-475.039) (-485.638) -- 0:01:43
19500 -- [-475.160] (-479.538) (-482.300) (-476.879) * (-491.496) [-479.075] (-478.208) (-480.369) -- 0:01:40
20000 -- (-478.992) [-476.947] (-474.999) (-475.095) * (-482.077) [-475.115] (-473.813) (-492.943) -- 0:01:38
Average standard deviation of split frequencies: 0.053223
20500 -- (-478.689) (-473.563) [-476.193] (-472.893) * (-509.578) [-476.717] (-473.144) (-486.332) -- 0:01:35
21000 -- (-476.449) (-473.438) [-475.941] (-474.825) * (-479.340) (-475.721) [-473.157] (-481.554) -- 0:01:33
21500 -- [-479.616] (-473.568) (-473.876) (-473.689) * [-478.258] (-474.471) (-473.709) (-479.432) -- 0:01:31
22000 -- [-479.949] (-473.223) (-477.364) (-474.417) * (-478.598) [-477.168] (-472.932) (-478.714) -- 0:01:28
22500 -- (-477.629) (-478.837) [-476.938] (-473.727) * (-476.117) (-475.754) (-474.602) [-487.529] -- 0:01:26
23000 -- (-474.695) (-474.662) (-475.163) [-473.106] * [-475.216] (-477.288) (-473.392) (-486.103) -- 0:01:24
23500 -- (-475.266) (-476.172) [-476.128] (-474.706) * (-473.497) (-475.662) (-476.528) [-480.956] -- 0:01:23
24000 -- (-475.193) (-474.872) (-474.032) [-473.500] * [-474.573] (-475.663) (-475.720) (-481.663) -- 0:01:21
24500 -- (-477.362) (-475.330) (-474.023) [-475.028] * (-476.265) (-474.114) [-473.689] (-489.373) -- 0:01:19
25000 -- [-475.849] (-475.482) (-476.082) (-473.852) * (-475.147) (-476.580) (-473.826) [-488.110] -- 0:01:18
Average standard deviation of split frequencies: 0.042064
25500 -- (-475.286) (-474.724) [-474.635] (-474.416) * (-475.800) (-473.940) (-474.673) [-482.221] -- 0:01:16
26000 -- (-475.346) (-473.758) (-474.377) [-473.636] * (-474.895) (-476.159) (-473.891) [-479.249] -- 0:01:14
26500 -- (-475.166) [-475.123] (-477.977) (-474.110) * [-475.745] (-475.009) (-475.349) (-480.541) -- 0:01:13
27000 -- (-477.736) (-474.607) (-476.359) [-474.866] * [-473.385] (-474.375) (-473.597) (-485.946) -- 0:01:12
27500 -- (-477.604) (-475.640) (-478.299) [-480.090] * [-475.409] (-473.705) (-473.662) (-487.701) -- 0:01:10
28000 -- (-477.164) (-475.207) [-476.632] (-474.355) * (-475.001) (-476.482) (-475.602) [-486.933] -- 0:01:09
28500 -- (-475.034) (-473.010) (-475.313) [-474.593] * (-476.969) [-474.620] (-473.676) (-485.458) -- 0:01:42
29000 -- (-473.948) (-480.528) [-473.869] (-476.470) * (-478.225) [-473.449] (-473.435) (-491.541) -- 0:01:40
29500 -- (-474.129) (-478.729) [-474.825] (-475.501) * (-479.674) (-475.146) [-472.908] (-483.614) -- 0:01:38
30000 -- (-474.837) (-476.030) [-475.462] (-475.361) * [-476.230] (-474.532) (-473.994) (-493.629) -- 0:01:37
Average standard deviation of split frequencies: 0.038796
30500 -- (-475.552) (-474.406) [-475.195] (-473.308) * [-475.023] (-475.703) (-474.424) (-488.227) -- 0:01:35
31000 -- (-478.123) (-476.418) (-474.518) [-474.395] * (-476.883) [-473.865] (-473.828) (-490.258) -- 0:01:33
31500 -- [-473.395] (-482.536) (-474.021) (-477.069) * (-477.965) [-473.596] (-475.003) (-476.904) -- 0:01:32
32000 -- (-477.698) (-485.245) (-475.304) [-476.298] * (-474.033) (-473.799) (-476.315) [-474.941] -- 0:01:30
32500 -- (-477.325) [-475.862] (-476.908) (-474.536) * (-474.788) (-474.336) (-475.508) [-476.436] -- 0:01:29
33000 -- (-474.776) (-476.105) (-476.566) [-474.410] * (-475.361) (-473.317) (-474.906) [-473.592] -- 0:01:27
33500 -- (-474.640) [-475.005] (-477.647) (-479.080) * (-479.395) [-472.891] (-474.531) (-475.158) -- 0:01:26
34000 -- [-473.819] (-475.815) (-476.625) (-473.595) * (-473.411) (-475.045) (-477.629) [-474.685] -- 0:01:25
34500 -- (-474.293) [-476.272] (-478.795) (-475.807) * (-476.772) (-475.573) [-475.751] (-474.253) -- 0:01:23
35000 -- (-474.492) (-475.539) (-475.932) [-476.711] * (-474.522) [-475.654] (-473.216) (-478.714) -- 0:01:22
Average standard deviation of split frequencies: 0.035712
35500 -- (-473.500) (-478.185) (-477.048) [-477.680] * (-475.398) (-475.547) (-476.854) [-483.006] -- 0:01:21
36000 -- (-474.440) (-474.921) (-477.652) [-476.040] * (-476.921) (-474.575) [-476.769] (-478.193) -- 0:01:20
36500 -- (-474.324) [-475.038] (-474.980) (-476.501) * [-473.034] (-474.504) (-478.052) (-474.704) -- 0:01:19
37000 -- (-474.449) (-476.161) [-473.061] (-473.492) * (-476.942) [-475.764] (-478.179) (-474.735) -- 0:01:18
37500 -- (-475.972) (-474.675) [-474.335] (-475.659) * (-476.380) (-475.602) [-474.354] (-474.469) -- 0:01:17
38000 -- (-475.456) (-474.209) [-473.880] (-477.326) * (-474.553) [-474.720] (-474.536) (-476.521) -- 0:01:15
38500 -- (-477.492) [-473.263] (-475.140) (-476.008) * (-473.595) [-477.355] (-474.741) (-473.179) -- 0:01:14
39000 -- (-474.890) [-475.706] (-476.387) (-474.416) * [-475.231] (-477.931) (-479.541) (-474.414) -- 0:01:13
39500 -- (-483.068) [-474.502] (-477.270) (-481.066) * (-475.311) [-476.350] (-476.295) (-473.875) -- 0:01:12
40000 -- (-480.242) [-473.451] (-475.118) (-478.312) * [-473.461] (-475.418) (-473.881) (-473.539) -- 0:01:12
Average standard deviation of split frequencies: 0.036515
40500 -- (-476.859) (-477.957) (-476.606) [-476.786] * (-475.113) (-474.798) [-477.621] (-476.242) -- 0:01:11
41000 -- (-475.753) (-473.077) [-477.807] (-476.043) * [-474.247] (-474.473) (-474.556) (-482.021) -- 0:01:10
41500 -- [-477.458] (-473.073) (-476.938) (-477.294) * [-473.836] (-475.602) (-475.216) (-476.237) -- 0:01:09
42000 -- (-477.975) (-475.298) [-475.710] (-476.075) * (-474.483) (-475.430) [-475.488] (-473.728) -- 0:01:08
42500 -- (-481.831) (-476.493) (-475.616) [-476.836] * [-473.739] (-475.507) (-473.803) (-475.824) -- 0:01:07
43000 -- (-474.546) (-477.168) [-476.985] (-477.036) * (-474.822) [-473.200] (-477.019) (-474.246) -- 0:01:06
43500 -- (-473.943) [-477.047] (-479.358) (-476.769) * [-475.696] (-475.573) (-476.627) (-474.185) -- 0:01:05
44000 -- (-477.784) [-474.590] (-478.029) (-474.735) * (-476.318) (-474.603) (-476.352) [-474.336] -- 0:01:05
44500 -- (-474.848) (-474.765) (-473.696) [-479.616] * [-477.256] (-473.906) (-474.613) (-476.874) -- 0:01:04
45000 -- (-475.403) (-476.077) (-474.407) [-477.967] * [-475.055] (-473.386) (-473.337) (-477.539) -- 0:01:24
Average standard deviation of split frequencies: 0.036112
45500 -- (-478.510) [-478.255] (-474.590) (-474.413) * (-479.808) (-473.904) [-474.223] (-476.723) -- 0:01:23
46000 -- (-478.692) [-473.977] (-478.235) (-473.587) * (-478.195) (-478.323) [-476.262] (-473.567) -- 0:01:22
46500 -- (-477.780) (-473.697) [-474.111] (-474.044) * [-474.374] (-476.576) (-474.974) (-473.120) -- 0:01:22
47000 -- (-477.445) (-473.439) [-473.509] (-475.365) * [-475.022] (-479.929) (-474.765) (-473.217) -- 0:01:21
47500 -- (-476.476) [-477.243] (-475.349) (-477.327) * [-473.983] (-475.122) (-477.085) (-476.752) -- 0:01:20
48000 -- (-477.022) (-474.810) [-474.938] (-482.774) * [-475.432] (-477.068) (-475.853) (-473.602) -- 0:01:19
48500 -- (-474.461) [-475.133] (-477.685) (-473.970) * (-476.978) (-474.265) [-474.733] (-477.680) -- 0:01:18
49000 -- (-473.877) (-475.577) (-475.347) [-475.157] * [-473.095] (-475.603) (-474.593) (-473.273) -- 0:01:17
49500 -- (-474.841) (-474.168) [-473.470] (-476.300) * (-475.346) [-474.670] (-476.751) (-473.907) -- 0:01:16
50000 -- (-475.381) [-474.136] (-477.894) (-474.163) * (-476.858) (-474.392) [-474.438] (-478.832) -- 0:01:16
Average standard deviation of split frequencies: 0.032099
50500 -- (-475.056) [-474.057] (-473.430) (-476.947) * (-478.825) (-473.477) [-475.140] (-476.721) -- 0:01:15
51000 -- (-473.349) (-473.267) (-484.226) [-476.241] * (-478.313) (-473.979) [-473.660] (-474.911) -- 0:01:14
51500 -- (-473.859) (-474.808) (-480.790) [-475.445] * (-473.620) (-476.366) (-473.230) [-474.412] -- 0:01:13
52000 -- (-476.178) (-477.254) [-474.937] (-474.212) * (-474.115) [-478.026] (-473.922) (-478.394) -- 0:01:12
52500 -- [-476.301] (-474.784) (-475.345) (-475.546) * (-476.000) (-478.037) (-476.323) [-476.083] -- 0:01:12
53000 -- (-477.293) (-474.623) [-474.141] (-474.494) * (-478.352) (-476.939) [-474.013] (-477.019) -- 0:01:11
53500 -- (-482.038) [-475.019] (-476.816) (-476.533) * (-473.997) [-476.837] (-475.184) (-477.263) -- 0:01:10
54000 -- (-476.073) (-475.481) [-475.632] (-475.562) * [-474.360] (-481.185) (-474.740) (-475.338) -- 0:01:10
54500 -- (-476.748) (-473.994) [-478.500] (-474.842) * (-474.904) (-477.559) [-476.406] (-476.977) -- 0:01:09
55000 -- (-476.511) [-474.073] (-477.967) (-475.508) * (-474.135) (-475.409) [-475.033] (-479.138) -- 0:01:08
Average standard deviation of split frequencies: 0.031567
55500 -- [-475.459] (-478.005) (-476.459) (-475.067) * [-473.108] (-477.679) (-473.408) (-479.813) -- 0:01:08
56000 -- (-477.613) (-476.070) [-477.224] (-474.230) * (-473.913) (-475.279) [-474.526] (-475.206) -- 0:01:07
56500 -- (-475.276) (-476.077) [-474.487] (-474.949) * (-474.698) (-474.623) (-475.643) [-474.871] -- 0:01:06
57000 -- (-477.522) (-476.512) [-475.917] (-475.733) * (-473.099) (-474.418) [-477.970] (-477.362) -- 0:01:06
57500 -- (-477.700) (-475.457) [-474.796] (-473.617) * (-474.571) [-473.551] (-475.958) (-476.550) -- 0:01:05
58000 -- (-476.067) [-474.710] (-478.767) (-474.986) * (-477.407) (-473.911) (-480.147) [-474.534] -- 0:01:04
58500 -- (-476.407) (-473.593) (-476.093) [-476.384] * (-480.813) [-473.928] (-477.876) (-474.925) -- 0:01:04
59000 -- (-475.558) (-475.937) [-476.138] (-476.472) * (-474.824) [-474.962] (-480.292) (-474.797) -- 0:01:03
59500 -- [-474.675] (-474.615) (-474.744) (-476.796) * [-474.184] (-475.454) (-474.154) (-473.419) -- 0:01:03
60000 -- (-475.190) (-473.311) [-474.303] (-477.259) * (-474.733) [-474.446] (-473.862) (-477.014) -- 0:01:02
Average standard deviation of split frequencies: 0.033126
60500 -- (-474.196) (-477.980) (-474.172) [-475.911] * [-475.003] (-475.554) (-473.573) (-473.380) -- 0:01:02
61000 -- (-473.470) (-482.233) (-473.986) [-476.734] * (-478.244) (-473.376) [-474.899] (-473.715) -- 0:01:16
61500 -- [-474.705] (-476.570) (-474.839) (-475.792) * (-474.746) [-474.148] (-476.307) (-473.966) -- 0:01:16
62000 -- (-473.872) (-479.935) (-474.486) [-474.905] * (-475.644) [-474.071] (-477.636) (-477.298) -- 0:01:15
62500 -- (-474.126) [-477.088] (-475.528) (-476.654) * [-475.478] (-474.654) (-477.661) (-482.623) -- 0:01:15
63000 -- (-474.783) (-473.719) (-473.073) [-473.388] * (-474.082) (-475.128) [-474.788] (-480.536) -- 0:01:14
63500 -- [-475.592] (-473.965) (-473.172) (-474.358) * (-475.328) (-475.076) [-474.948] (-475.594) -- 0:01:13
64000 -- (-477.422) (-476.255) [-473.543] (-477.748) * [-473.160] (-476.120) (-476.276) (-473.731) -- 0:01:13
64500 -- (-475.626) (-475.554) [-473.605] (-475.161) * [-473.236] (-478.086) (-474.330) (-477.962) -- 0:01:12
65000 -- [-473.856] (-475.786) (-473.313) (-476.622) * (-474.513) (-475.876) [-477.067] (-476.416) -- 0:01:11
Average standard deviation of split frequencies: 0.027818
65500 -- (-475.248) (-477.442) [-473.881] (-474.104) * (-475.078) (-480.170) [-476.597] (-475.597) -- 0:01:11
66000 -- (-477.034) (-474.869) [-473.700] (-475.433) * (-473.531) [-475.987] (-474.383) (-475.646) -- 0:01:10
66500 -- [-475.410] (-473.669) (-475.739) (-474.123) * (-473.334) (-475.481) [-474.570] (-477.729) -- 0:01:10
67000 -- [-474.454] (-473.449) (-474.979) (-475.500) * (-475.190) [-475.767] (-477.457) (-477.008) -- 0:01:09
67500 -- [-474.820] (-473.276) (-475.528) (-475.819) * (-474.967) [-476.417] (-474.858) (-474.548) -- 0:01:09
68000 -- (-476.941) (-480.129) [-473.285] (-478.226) * (-475.078) [-474.628] (-474.937) (-477.643) -- 0:01:08
68500 -- (-475.575) (-478.026) (-474.388) [-480.165] * (-475.999) [-473.412] (-474.387) (-477.307) -- 0:01:07
69000 -- (-478.011) (-474.892) [-475.265] (-474.914) * (-474.605) [-473.051] (-479.944) (-477.527) -- 0:01:07
69500 -- (-474.270) (-473.708) (-479.282) [-473.846] * [-475.528] (-476.659) (-473.599) (-473.293) -- 0:01:06
70000 -- [-477.422] (-473.976) (-473.986) (-479.622) * (-475.641) (-478.427) [-474.427] (-473.945) -- 0:01:06
Average standard deviation of split frequencies: 0.029277
70500 -- (-473.261) [-473.049] (-474.860) (-474.193) * [-474.901] (-475.438) (-480.516) (-476.534) -- 0:01:05
71000 -- [-475.714] (-476.808) (-477.466) (-476.167) * (-478.387) (-474.026) [-476.198] (-475.933) -- 0:01:05
71500 -- [-476.555] (-478.106) (-478.937) (-475.677) * (-473.841) (-475.476) (-475.592) [-474.176] -- 0:01:04
72000 -- (-478.997) [-475.430] (-473.917) (-478.437) * (-474.048) (-479.586) (-474.472) [-475.207] -- 0:01:04
72500 -- (-475.504) (-479.213) [-475.029] (-478.676) * [-473.367] (-476.812) (-474.861) (-474.645) -- 0:01:03
73000 -- [-474.682] (-477.411) (-479.348) (-473.384) * (-477.473) [-477.283] (-475.221) (-477.017) -- 0:01:03
73500 -- [-475.849] (-474.254) (-479.288) (-474.155) * (-476.459) (-473.982) (-477.943) [-474.122] -- 0:01:03
74000 -- (-476.489) [-474.829] (-475.121) (-474.954) * (-475.256) [-473.843] (-480.433) (-474.784) -- 0:01:02
74500 -- (-474.531) [-474.465] (-480.591) (-474.158) * [-474.067] (-475.039) (-475.733) (-477.529) -- 0:01:02
75000 -- [-474.394] (-476.461) (-473.301) (-475.284) * [-476.606] (-475.992) (-476.057) (-480.742) -- 0:01:01
Average standard deviation of split frequencies: 0.028075
75500 -- (-475.402) (-473.599) [-474.453] (-474.712) * (-475.256) [-473.582] (-477.418) (-474.934) -- 0:01:13
76000 -- (-476.452) [-473.961] (-475.660) (-474.340) * (-475.524) (-474.708) [-478.895] (-478.686) -- 0:01:12
76500 -- (-475.036) [-476.105] (-475.665) (-474.354) * [-476.852] (-475.572) (-476.895) (-477.076) -- 0:01:12
77000 -- (-473.811) [-474.495] (-474.534) (-474.666) * (-478.139) [-476.530] (-473.812) (-477.394) -- 0:01:11
77500 -- [-476.394] (-476.007) (-477.502) (-476.547) * (-475.709) (-475.348) [-473.740] (-475.980) -- 0:01:11
78000 -- (-477.073) (-476.025) [-475.645] (-474.265) * (-474.381) (-476.736) [-473.417] (-477.049) -- 0:01:10
78500 -- (-474.193) (-473.514) [-475.484] (-475.464) * (-473.956) (-474.876) [-475.999] (-473.391) -- 0:01:10
79000 -- [-474.515] (-475.287) (-474.853) (-474.558) * (-474.404) (-474.761) (-475.133) [-474.697] -- 0:01:09
79500 -- [-473.920] (-476.740) (-475.633) (-474.868) * [-477.064] (-474.627) (-478.099) (-473.578) -- 0:01:09
80000 -- (-477.626) (-476.233) [-475.896] (-474.991) * [-474.442] (-478.067) (-477.483) (-474.795) -- 0:01:09
Average standard deviation of split frequencies: 0.026590
80500 -- (-475.056) (-475.120) [-480.150] (-477.413) * [-476.059] (-474.863) (-475.238) (-475.783) -- 0:01:08
81000 -- (-474.021) (-476.639) (-475.455) [-476.802] * (-474.019) (-474.055) [-474.864] (-473.793) -- 0:01:08
81500 -- (-478.209) [-474.351] (-475.328) (-477.289) * [-474.006] (-473.711) (-473.493) (-473.750) -- 0:01:07
82000 -- [-476.214] (-476.017) (-477.780) (-476.081) * (-475.187) (-474.411) [-473.794] (-473.354) -- 0:01:07
82500 -- (-473.686) (-482.901) [-481.978] (-475.604) * (-473.265) (-474.876) (-473.338) [-474.203] -- 0:01:06
83000 -- [-475.594] (-475.309) (-473.625) (-476.802) * (-475.120) (-475.237) [-474.152] (-474.637) -- 0:01:06
83500 -- [-476.949] (-474.223) (-474.134) (-475.444) * [-475.205] (-476.434) (-476.616) (-474.374) -- 0:01:05
84000 -- (-474.668) (-473.029) (-476.348) [-474.637] * (-474.928) (-477.961) [-476.410] (-476.349) -- 0:01:05
84500 -- [-477.331] (-473.576) (-476.049) (-475.696) * (-479.593) (-477.626) [-479.358] (-476.525) -- 0:01:05
85000 -- (-480.585) (-475.755) (-474.730) [-473.798] * [-478.799] (-475.339) (-474.050) (-476.782) -- 0:01:04
Average standard deviation of split frequencies: 0.026885
85500 -- (-476.522) (-475.359) [-475.848] (-473.391) * (-479.296) [-477.561] (-473.415) (-473.837) -- 0:01:04
86000 -- [-476.255] (-478.738) (-473.753) (-474.560) * (-474.418) (-475.292) (-476.994) [-475.435] -- 0:01:03
86500 -- (-476.073) [-474.835] (-473.629) (-475.129) * (-476.804) (-476.171) (-478.892) [-478.664] -- 0:01:03
87000 -- (-474.720) [-474.469] (-473.824) (-476.273) * (-473.763) (-476.555) (-474.634) [-477.375] -- 0:01:02
87500 -- (-475.420) (-473.559) [-474.538] (-475.784) * (-473.608) [-474.010] (-473.313) (-474.762) -- 0:01:02
88000 -- [-473.504] (-473.119) (-475.073) (-474.684) * [-476.140] (-473.430) (-474.123) (-477.628) -- 0:01:02
88500 -- (-477.237) (-473.788) (-474.059) [-473.600] * (-474.704) (-477.015) (-475.642) [-474.898] -- 0:01:01
89000 -- (-479.609) [-473.061] (-473.824) (-474.713) * (-476.308) (-475.977) (-473.786) [-475.499] -- 0:01:01
89500 -- (-475.048) (-473.109) [-474.827] (-475.508) * (-474.014) (-473.852) (-475.193) [-477.041] -- 0:01:01
90000 -- (-475.663) [-474.498] (-474.110) (-477.918) * (-475.833) (-475.361) (-476.493) [-475.263] -- 0:01:00
Average standard deviation of split frequencies: 0.025477
90500 -- [-474.248] (-473.583) (-474.049) (-473.289) * (-474.908) (-473.659) (-475.554) [-473.704] -- 0:01:10
91000 -- (-478.079) (-478.915) [-474.042] (-475.436) * (-475.873) (-475.856) (-474.548) [-477.061] -- 0:01:09
91500 -- (-477.833) (-474.861) (-475.758) [-473.638] * (-473.903) (-474.827) (-475.829) [-477.414] -- 0:01:09
92000 -- [-479.992] (-476.924) (-477.280) (-478.612) * [-477.005] (-475.642) (-481.511) (-475.329) -- 0:01:09
92500 -- [-477.136] (-474.747) (-474.325) (-475.601) * (-476.153) (-474.358) [-474.482] (-474.282) -- 0:01:08
93000 -- [-476.588] (-473.231) (-474.448) (-476.012) * [-476.200] (-476.674) (-476.043) (-474.841) -- 0:01:08
93500 -- (-473.704) (-473.691) [-476.651] (-473.894) * [-473.439] (-475.487) (-475.223) (-475.675) -- 0:01:07
94000 -- (-473.621) (-473.364) [-478.148] (-476.554) * (-474.420) [-474.438] (-473.778) (-477.213) -- 0:01:07
94500 -- (-476.563) [-474.578] (-474.985) (-475.057) * [-475.145] (-474.323) (-474.433) (-476.262) -- 0:01:07
95000 -- (-475.383) [-475.283] (-477.704) (-476.684) * [-476.817] (-475.870) (-474.135) (-479.343) -- 0:01:06
Average standard deviation of split frequencies: 0.025043
95500 -- [-473.845] (-473.209) (-474.812) (-473.669) * (-478.910) (-474.135) (-475.724) [-474.235] -- 0:01:06
96000 -- (-478.261) (-475.720) (-473.607) [-475.331] * [-479.346] (-476.114) (-474.309) (-474.270) -- 0:01:05
96500 -- (-476.514) [-473.111] (-475.023) (-479.391) * (-474.222) (-475.805) (-474.155) [-473.892] -- 0:01:05
97000 -- (-473.751) [-476.515] (-478.070) (-476.110) * [-473.541] (-479.151) (-474.748) (-475.989) -- 0:01:05
97500 -- (-474.868) (-477.066) [-474.580] (-476.687) * (-474.704) [-473.969] (-474.604) (-482.077) -- 0:01:04
98000 -- (-474.125) (-476.652) [-473.085] (-473.222) * [-475.702] (-474.250) (-473.690) (-479.133) -- 0:01:04
98500 -- (-473.561) (-476.401) [-473.910] (-475.590) * (-478.273) (-477.574) [-474.071] (-474.347) -- 0:01:04
99000 -- (-475.223) [-476.942] (-477.257) (-478.576) * (-475.217) [-475.085] (-474.928) (-474.194) -- 0:01:03
99500 -- (-474.965) [-474.676] (-474.627) (-476.055) * (-475.257) (-473.122) [-473.387] (-476.375) -- 0:01:03
100000 -- [-474.543] (-473.691) (-474.845) (-473.850) * (-475.204) (-473.459) [-473.491] (-474.177) -- 0:01:02
Average standard deviation of split frequencies: 0.025421
100500 -- (-476.773) (-474.902) (-477.834) [-474.520] * [-474.460] (-475.513) (-475.074) (-473.778) -- 0:01:02
101000 -- (-478.006) (-475.076) (-476.751) [-473.860] * (-473.702) (-474.698) (-473.791) [-475.175] -- 0:01:02
101500 -- (-478.204) (-486.264) (-475.917) [-473.403] * (-474.961) [-472.935] (-476.662) (-476.475) -- 0:01:01
102000 -- (-476.279) (-479.971) [-475.402] (-475.619) * (-477.912) [-474.068] (-479.267) (-478.064) -- 0:01:10
102500 -- (-475.015) (-474.976) [-474.607] (-474.617) * (-475.100) (-478.852) [-478.374] (-473.191) -- 0:01:10
103000 -- (-474.465) (-474.343) [-473.753] (-476.289) * (-476.676) (-479.768) [-475.968] (-473.939) -- 0:01:09
103500 -- (-473.823) [-475.811] (-477.603) (-475.692) * [-474.836] (-476.963) (-474.942) (-475.791) -- 0:01:09
104000 -- (-474.811) (-474.877) [-475.648] (-474.957) * (-476.321) (-477.091) (-476.158) [-477.336] -- 0:01:08
104500 -- (-484.995) [-474.498] (-474.703) (-476.984) * (-474.784) (-474.075) [-475.651] (-476.991) -- 0:01:08
105000 -- (-481.863) (-485.095) [-476.898] (-475.633) * (-474.931) (-474.077) [-474.029] (-476.821) -- 0:01:08
Average standard deviation of split frequencies: 0.025413
105500 -- [-475.017] (-473.852) (-475.579) (-476.404) * (-475.311) (-475.002) [-473.530] (-477.550) -- 0:01:07
106000 -- (-476.298) (-476.959) (-475.295) [-477.829] * [-475.479] (-474.557) (-475.147) (-474.544) -- 0:01:07
106500 -- (-478.643) (-476.809) [-473.371] (-479.902) * [-473.815] (-474.023) (-474.252) (-474.875) -- 0:01:07
107000 -- (-474.551) [-477.402] (-478.326) (-478.540) * [-477.081] (-473.806) (-473.625) (-475.526) -- 0:01:06
107500 -- (-473.940) [-477.163] (-476.825) (-473.473) * (-475.236) (-474.616) [-476.028] (-479.392) -- 0:01:06
108000 -- (-473.981) (-475.907) (-475.090) [-473.370] * [-473.605] (-475.561) (-480.414) (-475.579) -- 0:01:06
108500 -- [-476.604] (-475.350) (-475.324) (-479.037) * [-474.003] (-477.531) (-476.774) (-476.819) -- 0:01:05
109000 -- (-477.907) (-476.547) (-475.225) [-476.923] * (-473.606) (-473.437) (-478.796) [-476.371] -- 0:01:05
109500 -- (-474.493) (-479.837) (-474.668) [-474.667] * (-475.898) (-474.152) [-477.068] (-476.653) -- 0:01:05
110000 -- [-475.171] (-474.848) (-476.479) (-475.185) * (-474.932) [-477.364] (-475.470) (-475.631) -- 0:01:04
Average standard deviation of split frequencies: 0.024138
110500 -- [-475.701] (-474.801) (-475.003) (-474.723) * [-473.062] (-475.568) (-475.866) (-473.424) -- 0:01:04
111000 -- (-475.294) [-476.312] (-476.203) (-475.009) * [-476.371] (-476.910) (-477.860) (-475.420) -- 0:01:04
111500 -- (-475.264) [-475.912] (-474.163) (-474.711) * (-474.259) (-476.067) [-475.966] (-481.068) -- 0:01:03
112000 -- (-475.481) (-473.888) (-476.018) [-476.488] * [-473.154] (-479.496) (-473.956) (-480.301) -- 0:01:03
112500 -- (-477.172) [-474.375] (-475.489) (-481.897) * (-477.811) (-480.174) [-474.488] (-479.372) -- 0:01:03
113000 -- (-475.222) [-476.546] (-474.530) (-474.360) * [-473.441] (-474.617) (-474.500) (-476.609) -- 0:01:02
113500 -- (-475.698) (-477.692) (-474.643) [-476.467] * (-479.371) (-476.681) [-478.247] (-474.938) -- 0:01:02
114000 -- (-476.317) [-476.221] (-477.533) (-473.855) * (-477.931) (-476.023) [-474.013] (-477.147) -- 0:01:02
114500 -- (-474.095) (-475.307) (-477.593) [-475.005] * (-473.451) (-475.446) (-477.981) [-475.473] -- 0:01:01
115000 -- (-475.151) [-474.022] (-473.122) (-474.027) * (-474.892) (-475.580) [-475.446] (-476.106) -- 0:01:01
Average standard deviation of split frequencies: 0.023367
115500 -- (-478.338) (-475.074) [-473.648] (-475.371) * [-474.427] (-474.141) (-475.013) (-474.009) -- 0:01:01
116000 -- [-480.123] (-474.787) (-474.321) (-474.392) * (-473.945) (-478.699) (-479.174) [-473.788] -- 0:01:08
116500 -- (-478.862) (-475.307) [-476.466] (-474.845) * (-475.402) [-475.987] (-477.539) (-476.190) -- 0:01:08
117000 -- [-473.813] (-477.937) (-478.049) (-474.095) * (-474.024) (-481.274) [-475.511] (-479.082) -- 0:01:07
117500 -- (-476.458) (-474.473) (-475.921) [-477.952] * [-474.196] (-475.580) (-475.143) (-477.816) -- 0:01:07
118000 -- (-475.121) (-476.383) [-476.348] (-474.452) * [-474.082] (-474.344) (-474.370) (-476.561) -- 0:01:07
118500 -- (-478.978) (-474.455) (-476.997) [-473.789] * [-476.140] (-474.061) (-474.347) (-476.111) -- 0:01:06
119000 -- [-474.292] (-474.914) (-478.999) (-474.291) * (-476.219) (-474.156) (-479.577) [-476.109] -- 0:01:06
119500 -- (-475.481) (-473.534) (-475.350) [-473.548] * [-477.151] (-475.113) (-477.500) (-473.767) -- 0:01:06
120000 -- (-475.416) (-474.608) [-477.694] (-473.618) * (-475.365) [-474.709] (-478.114) (-474.687) -- 0:01:06
Average standard deviation of split frequencies: 0.020836
120500 -- (-474.207) (-475.522) [-478.073] (-477.205) * (-475.168) (-477.224) (-479.124) [-474.154] -- 0:01:05
121000 -- (-474.990) [-477.808] (-477.879) (-475.818) * [-475.152] (-473.298) (-474.670) (-474.565) -- 0:01:05
121500 -- (-476.218) (-478.796) (-474.460) [-473.850] * (-475.983) (-474.055) (-476.093) [-474.916] -- 0:01:05
122000 -- (-474.725) (-475.024) [-474.206] (-477.684) * (-476.319) [-474.352] (-476.236) (-475.266) -- 0:01:04
122500 -- (-476.910) (-475.416) (-473.137) [-476.373] * [-477.180] (-477.002) (-475.244) (-474.212) -- 0:01:04
123000 -- (-480.369) (-476.453) [-473.302] (-476.361) * (-481.585) (-474.187) [-474.720] (-477.409) -- 0:01:04
123500 -- (-477.905) [-474.318] (-476.220) (-478.594) * [-477.082] (-473.327) (-475.433) (-474.349) -- 0:01:03
124000 -- (-479.605) [-474.317] (-475.847) (-478.175) * [-477.172] (-474.338) (-477.304) (-474.152) -- 0:01:03
124500 -- (-475.777) [-475.111] (-475.707) (-477.070) * (-480.774) (-477.350) [-474.138] (-474.418) -- 0:01:03
125000 -- (-474.581) [-477.861] (-474.593) (-476.002) * (-478.396) (-474.317) (-474.531) [-475.233] -- 0:01:03
Average standard deviation of split frequencies: 0.017919
125500 -- [-474.684] (-480.675) (-473.996) (-476.617) * (-475.581) (-474.460) (-474.735) [-478.316] -- 0:01:02
126000 -- [-474.521] (-475.218) (-477.430) (-477.325) * (-473.608) [-477.042] (-476.307) (-476.068) -- 0:01:02
126500 -- (-478.540) [-475.720] (-474.139) (-477.583) * (-475.026) [-475.873] (-475.667) (-474.725) -- 0:01:02
127000 -- (-475.543) (-475.594) [-475.675] (-475.723) * (-473.452) [-473.515] (-482.286) (-474.630) -- 0:01:01
127500 -- (-476.869) [-478.156] (-474.481) (-475.150) * [-474.121] (-477.364) (-474.629) (-478.049) -- 0:01:01
128000 -- (-478.978) (-476.215) [-474.336] (-480.983) * [-476.048] (-474.578) (-474.831) (-474.812) -- 0:01:01
128500 -- (-474.352) (-475.561) (-475.066) [-479.460] * [-477.909] (-474.360) (-478.503) (-474.609) -- 0:01:01
129000 -- [-479.216] (-475.141) (-480.659) (-476.061) * (-476.138) [-475.655] (-474.339) (-473.907) -- 0:01:00
129500 -- (-478.572) [-473.513] (-479.674) (-475.399) * (-473.224) (-475.800) (-476.263) [-476.203] -- 0:01:00
130000 -- (-478.636) (-477.748) (-473.951) [-474.834] * [-474.905] (-475.901) (-473.353) (-478.036) -- 0:01:00
Average standard deviation of split frequencies: 0.018228
130500 -- (-476.519) (-473.889) [-474.287] (-478.359) * (-474.559) (-473.852) [-473.752] (-474.730) -- 0:00:59
131000 -- (-475.545) (-482.008) (-477.016) [-477.831] * [-476.309] (-474.339) (-475.041) (-475.793) -- 0:00:59
131500 -- (-479.887) (-474.615) [-474.586] (-475.481) * (-473.861) (-475.765) [-474.894] (-475.588) -- 0:01:06
132000 -- (-475.317) [-476.603] (-473.659) (-474.002) * [-474.441] (-477.247) (-475.004) (-476.101) -- 0:01:05
132500 -- (-475.433) (-478.801) (-473.595) [-474.151] * [-473.873] (-474.947) (-474.971) (-474.096) -- 0:01:05
133000 -- (-478.276) (-474.201) (-474.261) [-474.521] * (-476.427) [-479.290] (-474.644) (-475.806) -- 0:01:05
133500 -- (-475.084) (-476.281) [-473.903] (-474.308) * (-473.760) (-474.514) (-480.406) [-474.938] -- 0:01:04
134000 -- [-475.984] (-474.707) (-473.948) (-477.846) * (-474.948) (-474.619) [-476.641] (-476.246) -- 0:01:04
134500 -- [-474.675] (-477.788) (-477.023) (-479.335) * (-475.541) (-476.589) [-475.915] (-474.984) -- 0:01:04
135000 -- (-474.450) (-478.854) [-473.808] (-476.862) * (-473.488) (-474.423) (-475.738) [-473.883] -- 0:01:04
Average standard deviation of split frequencies: 0.019338
135500 -- (-477.682) (-474.995) (-473.866) [-474.508] * (-474.391) (-476.217) [-474.499] (-478.557) -- 0:01:03
136000 -- (-476.199) (-474.485) [-473.751] (-475.289) * [-474.881] (-476.822) (-479.378) (-476.862) -- 0:01:03
136500 -- (-475.850) (-473.464) (-474.094) [-474.912] * (-473.453) [-475.834] (-474.401) (-479.490) -- 0:01:03
137000 -- (-478.773) (-474.398) (-474.554) [-474.601] * (-473.518) [-475.902] (-474.468) (-479.001) -- 0:01:02
137500 -- (-479.414) (-475.694) (-474.108) [-475.209] * [-475.864] (-478.225) (-474.984) (-473.116) -- 0:01:02
138000 -- (-479.771) (-475.529) [-477.090] (-473.929) * (-476.146) [-475.206] (-474.963) (-476.172) -- 0:01:02
138500 -- (-480.217) (-475.099) [-474.387] (-473.436) * (-475.508) (-477.403) (-476.956) [-475.386] -- 0:01:02
139000 -- (-476.745) (-475.032) (-474.474) [-473.479] * [-474.660] (-475.800) (-476.110) (-476.908) -- 0:01:01
139500 -- (-474.741) [-474.023] (-476.091) (-474.498) * (-475.156) (-478.504) (-475.493) [-474.779] -- 0:01:01
140000 -- (-476.195) (-475.157) [-474.486] (-474.852) * (-475.062) (-476.091) [-474.494] (-477.544) -- 0:01:01
Average standard deviation of split frequencies: 0.020293
140500 -- [-476.068] (-473.708) (-475.044) (-473.789) * (-477.984) (-476.551) (-479.018) [-474.039] -- 0:01:01
141000 -- [-475.683] (-475.214) (-480.363) (-474.937) * (-476.949) (-475.095) [-475.349] (-476.637) -- 0:01:00
141500 -- (-475.320) (-474.021) [-473.657] (-477.255) * [-475.214] (-476.368) (-473.950) (-476.527) -- 0:01:00
142000 -- (-477.076) (-475.775) (-473.749) [-475.826] * (-479.940) (-475.188) (-474.318) [-477.573] -- 0:01:00
142500 -- (-478.846) (-476.732) (-477.130) [-475.228] * (-479.781) (-484.460) (-482.011) [-475.746] -- 0:01:00
143000 -- (-479.636) (-477.533) [-474.496] (-477.583) * [-476.340] (-476.143) (-481.938) (-478.991) -- 0:00:59
143500 -- [-481.106] (-476.633) (-474.726) (-476.317) * (-473.950) (-474.047) [-475.557] (-485.292) -- 0:00:59
144000 -- (-478.399) (-474.827) (-478.449) [-473.299] * [-475.227] (-475.221) (-474.570) (-474.763) -- 0:00:59
144500 -- (-477.596) [-474.633] (-476.821) (-474.418) * (-475.822) [-475.408] (-475.733) (-477.485) -- 0:00:59
145000 -- (-478.421) (-476.796) (-475.486) [-474.963] * (-480.457) [-476.122] (-474.109) (-480.210) -- 0:00:58
Average standard deviation of split frequencies: 0.019033
145500 -- (-480.078) (-478.317) [-474.441] (-474.857) * (-476.537) [-473.273] (-474.415) (-478.349) -- 0:00:58
146000 -- (-476.144) (-482.071) [-474.012] (-478.136) * (-475.667) (-473.452) [-474.424] (-475.264) -- 0:00:58
146500 -- [-475.816] (-474.905) (-473.743) (-478.513) * [-474.775] (-474.744) (-474.295) (-476.348) -- 0:00:58
147000 -- (-477.578) (-476.744) [-474.079] (-473.353) * (-476.041) (-476.940) (-476.390) [-476.100] -- 0:00:58
147500 -- (-476.899) (-478.232) [-475.520] (-474.233) * [-474.440] (-476.884) (-474.521) (-476.311) -- 0:01:03
148000 -- (-476.409) [-475.362] (-474.770) (-475.500) * (-473.888) (-477.263) (-474.016) [-474.906] -- 0:01:03
148500 -- (-475.304) (-477.706) [-473.352] (-473.448) * [-477.815] (-476.675) (-476.042) (-475.065) -- 0:01:03
149000 -- (-479.805) (-473.609) (-474.459) [-474.089] * (-475.728) [-477.182] (-480.563) (-474.755) -- 0:01:02
149500 -- [-482.698] (-473.733) (-473.721) (-475.219) * (-475.307) [-475.413] (-476.928) (-475.158) -- 0:01:02
150000 -- (-474.707) (-475.070) (-473.518) [-474.101] * [-477.777] (-474.672) (-476.086) (-478.677) -- 0:01:02
Average standard deviation of split frequencies: 0.018114
150500 -- (-473.703) (-474.469) [-477.907] (-474.008) * [-475.384] (-474.564) (-474.779) (-477.259) -- 0:01:02
151000 -- [-474.878] (-474.785) (-478.342) (-474.232) * (-478.793) (-477.673) (-474.847) [-477.043] -- 0:01:01
151500 -- (-474.025) [-473.560] (-474.823) (-474.437) * (-474.980) (-473.367) (-474.261) [-475.228] -- 0:01:01
152000 -- (-475.537) [-474.852] (-476.909) (-473.985) * (-476.289) (-475.978) [-474.211] (-473.403) -- 0:01:01
152500 -- (-475.319) (-474.657) (-478.780) [-475.110] * (-477.014) (-477.454) [-473.760] (-476.368) -- 0:01:01
153000 -- (-474.235) (-473.818) [-479.353] (-475.672) * (-477.470) (-477.519) (-473.535) [-475.218] -- 0:01:00
153500 -- (-474.271) (-475.107) (-474.525) [-473.335] * [-478.149] (-475.725) (-476.141) (-473.327) -- 0:01:00
154000 -- (-474.325) [-473.773] (-475.819) (-474.161) * (-473.979) [-473.627] (-474.646) (-475.464) -- 0:01:00
154500 -- (-474.832) (-476.787) [-473.779] (-475.980) * (-474.109) (-473.970) (-475.212) [-475.595] -- 0:01:00
155000 -- [-473.090] (-476.407) (-473.080) (-473.935) * (-477.669) [-475.135] (-475.787) (-475.708) -- 0:00:59
Average standard deviation of split frequencies: 0.017654
155500 -- (-474.879) (-475.680) (-474.821) [-475.067] * (-478.506) (-473.713) (-473.613) [-476.063] -- 0:00:59
156000 -- (-476.023) (-473.727) (-474.346) [-476.283] * (-481.221) (-474.848) [-473.658] (-481.894) -- 0:00:59
156500 -- [-474.482] (-474.158) (-476.208) (-474.918) * (-480.656) [-473.256] (-476.157) (-473.374) -- 0:00:59
157000 -- (-474.174) [-473.119] (-473.253) (-474.411) * (-482.648) (-475.306) (-476.385) [-475.088] -- 0:00:59
157500 -- (-474.885) (-474.707) [-473.538] (-473.455) * (-474.933) [-473.629] (-476.260) (-476.147) -- 0:00:58
158000 -- [-474.449] (-475.265) (-474.545) (-478.096) * (-474.106) (-475.652) [-477.840] (-475.194) -- 0:00:58
158500 -- (-474.256) [-473.562] (-474.663) (-476.484) * (-478.161) (-476.481) [-475.143] (-476.090) -- 0:00:58
159000 -- [-473.140] (-476.300) (-474.210) (-474.222) * (-478.930) [-473.607] (-473.386) (-476.351) -- 0:00:58
159500 -- (-473.155) (-474.021) [-477.463] (-477.904) * [-476.118] (-474.053) (-473.305) (-475.855) -- 0:00:57
160000 -- (-474.291) [-473.333] (-474.917) (-478.765) * (-474.910) [-474.591] (-474.777) (-474.398) -- 0:00:57
Average standard deviation of split frequencies: 0.018631
160500 -- (-479.166) (-479.240) [-473.379] (-475.410) * (-475.582) (-475.959) [-473.685] (-473.900) -- 0:00:57
161000 -- [-474.500] (-479.699) (-478.536) (-474.960) * [-475.947] (-478.229) (-474.216) (-474.758) -- 0:00:57
161500 -- (-474.672) (-479.638) (-474.807) [-474.531] * (-476.423) [-481.676] (-474.522) (-473.333) -- 0:00:57
162000 -- (-473.798) (-476.262) (-477.929) [-478.091] * (-476.164) [-476.136] (-475.981) (-475.482) -- 0:01:02
162500 -- (-472.923) (-477.264) [-473.701] (-475.171) * (-478.752) (-476.116) [-473.682] (-477.606) -- 0:01:01
163000 -- (-474.697) (-473.493) [-474.608] (-475.972) * (-477.592) (-474.800) (-472.948) [-481.378] -- 0:01:01
163500 -- (-475.602) (-475.731) [-473.229] (-475.123) * (-477.387) (-475.346) [-473.767] (-476.177) -- 0:01:01
164000 -- [-475.694] (-474.907) (-474.307) (-478.743) * [-475.275] (-475.867) (-478.521) (-475.685) -- 0:01:01
164500 -- (-474.896) [-473.952] (-478.315) (-479.938) * (-475.387) [-480.902] (-477.587) (-475.806) -- 0:01:00
165000 -- (-475.194) (-477.535) [-475.396] (-474.285) * (-475.633) [-474.338] (-478.084) (-479.238) -- 0:01:00
Average standard deviation of split frequencies: 0.018601
165500 -- (-477.143) (-478.683) [-474.306] (-481.790) * (-475.115) (-473.488) [-474.425] (-474.160) -- 0:01:00
166000 -- (-476.019) (-476.454) [-473.349] (-474.166) * (-475.087) (-473.423) [-474.897] (-473.559) -- 0:01:00
166500 -- [-477.658] (-478.730) (-477.228) (-474.127) * (-476.433) (-473.900) (-474.191) [-475.309] -- 0:01:00
167000 -- (-474.802) (-475.032) (-476.917) [-476.053] * (-473.884) [-473.261] (-477.353) (-475.238) -- 0:00:59
167500 -- (-473.677) [-474.056] (-475.959) (-476.586) * [-474.007] (-473.718) (-474.267) (-474.391) -- 0:00:59
168000 -- (-477.979) (-475.136) (-475.212) [-478.920] * (-474.092) [-474.927] (-473.979) (-475.278) -- 0:00:59
168500 -- (-475.293) (-473.825) (-475.264) [-475.383] * [-474.427] (-474.195) (-475.555) (-475.596) -- 0:00:59
169000 -- (-475.587) [-473.516] (-478.131) (-475.286) * [-473.594] (-474.126) (-477.419) (-475.347) -- 0:00:59
169500 -- (-476.597) [-474.797] (-483.284) (-473.402) * [-474.479] (-473.508) (-478.996) (-478.735) -- 0:00:58
170000 -- (-476.687) (-475.944) [-477.447] (-474.109) * (-473.675) [-473.986] (-477.331) (-477.578) -- 0:00:58
Average standard deviation of split frequencies: 0.017300
170500 -- [-476.468] (-473.868) (-473.704) (-473.533) * (-474.680) [-473.710] (-476.704) (-479.532) -- 0:00:58
171000 -- (-475.467) [-475.215] (-475.337) (-473.339) * (-475.463) (-474.035) [-476.198] (-475.840) -- 0:00:58
171500 -- [-474.842] (-477.781) (-473.894) (-473.197) * (-474.550) [-473.673] (-477.275) (-473.590) -- 0:00:57
172000 -- (-474.610) [-474.082] (-476.275) (-476.811) * (-477.937) [-473.194] (-475.912) (-476.044) -- 0:00:57
172500 -- [-474.879] (-473.668) (-474.702) (-474.535) * (-475.247) [-473.899] (-475.264) (-474.363) -- 0:00:57
173000 -- (-473.967) [-474.454] (-478.773) (-476.484) * (-476.165) [-474.794] (-474.588) (-475.929) -- 0:00:57
173500 -- [-474.263] (-475.661) (-477.273) (-475.274) * (-474.209) [-474.786] (-474.855) (-477.158) -- 0:00:57
174000 -- (-473.885) [-475.649] (-476.739) (-474.077) * (-475.942) (-478.295) [-474.038] (-476.899) -- 0:00:56
174500 -- (-479.010) (-473.144) [-477.126] (-474.601) * (-474.359) (-475.100) (-478.064) [-473.960] -- 0:00:56
175000 -- (-474.509) [-478.592] (-477.262) (-476.760) * (-476.518) (-474.084) [-477.995] (-474.488) -- 0:00:56
Average standard deviation of split frequencies: 0.019595
175500 -- [-475.145] (-475.768) (-475.640) (-479.956) * (-474.000) [-473.197] (-474.196) (-475.663) -- 0:00:56
176000 -- (-478.190) (-478.162) [-475.341] (-477.920) * (-476.422) (-473.178) [-475.911] (-474.437) -- 0:01:00
176500 -- [-474.210] (-475.269) (-476.937) (-478.260) * (-476.339) (-475.363) [-473.593] (-474.368) -- 0:01:00
177000 -- (-474.838) [-476.658] (-477.818) (-476.232) * [-474.735] (-476.622) (-473.765) (-474.178) -- 0:01:00
177500 -- [-475.311] (-475.585) (-477.674) (-475.379) * (-476.179) (-478.125) (-473.822) [-474.329] -- 0:01:00
178000 -- (-474.322) [-479.323] (-480.184) (-474.075) * (-474.324) (-475.512) (-474.303) [-474.479] -- 0:01:00
178500 -- (-473.628) [-475.426] (-474.835) (-474.561) * (-474.664) (-478.937) [-476.715] (-475.177) -- 0:00:59
179000 -- (-474.944) [-473.660] (-475.731) (-473.973) * (-481.053) (-475.302) (-477.845) [-475.202] -- 0:00:59
179500 -- (-478.111) [-474.860] (-476.570) (-475.302) * [-476.447] (-475.862) (-475.448) (-477.970) -- 0:00:59
180000 -- (-476.017) (-477.904) (-476.756) [-475.093] * (-476.161) [-474.722] (-474.810) (-473.121) -- 0:00:59
Average standard deviation of split frequencies: 0.018120
180500 -- (-474.338) (-480.272) (-475.917) [-473.430] * (-474.764) (-474.312) (-473.471) [-473.923] -- 0:00:59
181000 -- (-477.924) (-476.441) (-473.789) [-477.585] * (-475.985) (-477.125) [-474.977] (-473.516) -- 0:00:58
181500 -- (-478.201) (-478.167) [-476.380] (-477.346) * (-474.201) (-473.789) [-475.448] (-474.345) -- 0:00:58
182000 -- (-475.651) (-474.431) (-476.990) [-478.637] * (-473.263) (-476.017) [-475.390] (-476.969) -- 0:00:58
182500 -- [-473.966] (-475.141) (-479.954) (-479.450) * (-478.715) (-474.032) (-474.248) [-475.422] -- 0:00:58
183000 -- (-474.754) (-474.712) [-478.999] (-479.430) * (-476.554) (-475.210) [-473.602] (-476.149) -- 0:00:58
183500 -- (-474.466) [-475.170] (-477.154) (-475.887) * (-474.321) [-473.854] (-474.470) (-474.454) -- 0:00:57
184000 -- [-476.264] (-476.150) (-474.951) (-474.312) * (-476.228) (-478.184) (-477.759) [-474.710] -- 0:00:57
184500 -- (-478.305) (-475.267) [-473.958] (-474.234) * (-473.656) (-479.490) (-473.659) [-474.117] -- 0:00:57
185000 -- (-473.609) (-482.320) [-473.753] (-476.683) * [-473.827] (-474.209) (-473.520) (-474.011) -- 0:00:57
Average standard deviation of split frequencies: 0.015740
185500 -- (-473.547) (-479.558) [-478.621] (-478.338) * [-474.740] (-473.187) (-479.343) (-477.971) -- 0:00:57
186000 -- [-474.575] (-475.376) (-474.548) (-474.435) * (-473.227) (-475.840) (-477.895) [-474.537] -- 0:00:56
186500 -- (-474.271) (-474.215) [-473.932] (-476.197) * [-473.937] (-479.299) (-474.911) (-475.716) -- 0:00:56
187000 -- (-475.621) (-476.414) [-477.639] (-475.459) * (-479.310) (-475.641) [-477.470] (-475.111) -- 0:00:56
187500 -- (-474.809) (-474.724) (-477.547) [-475.096] * (-474.136) (-477.450) [-474.172] (-475.058) -- 0:00:56
188000 -- (-473.941) (-478.887) (-474.432) [-474.105] * [-473.975] (-477.915) (-474.074) (-474.827) -- 0:00:56
188500 -- (-474.962) (-475.932) [-473.594] (-474.499) * (-476.585) (-486.340) (-475.377) [-475.999] -- 0:00:55
189000 -- (-476.422) (-478.526) (-475.835) [-478.526] * (-477.039) (-478.103) [-473.990] (-474.716) -- 0:00:55
189500 -- (-474.811) [-475.094] (-474.909) (-477.339) * [-474.723] (-478.297) (-474.135) (-481.339) -- 0:00:55
190000 -- (-476.345) [-473.261] (-473.972) (-475.994) * [-474.302] (-474.337) (-474.387) (-474.152) -- 0:00:55
Average standard deviation of split frequencies: 0.014148
190500 -- (-474.909) (-473.870) (-475.076) [-475.262] * [-474.093] (-479.855) (-476.385) (-474.053) -- 0:00:55
191000 -- (-474.582) (-476.289) (-475.883) [-475.605] * (-478.095) (-475.179) [-476.834] (-475.799) -- 0:00:59
191500 -- (-475.336) [-474.853] (-473.523) (-477.277) * (-475.622) (-475.102) (-476.286) [-478.479] -- 0:00:59
192000 -- (-476.134) [-474.209] (-473.263) (-478.030) * (-473.184) [-474.357] (-477.675) (-476.319) -- 0:00:58
192500 -- (-475.095) (-474.893) [-474.170] (-478.333) * (-474.250) [-474.929] (-473.895) (-476.298) -- 0:00:58
193000 -- (-475.466) (-476.581) [-473.648] (-475.191) * (-474.702) (-477.880) (-473.148) [-477.290] -- 0:00:58
193500 -- (-475.488) (-474.576) [-474.910] (-476.820) * (-473.798) (-476.328) [-473.818] (-478.767) -- 0:00:58
194000 -- (-476.180) (-475.745) (-474.027) [-473.518] * (-476.144) (-476.199) [-474.477] (-477.018) -- 0:00:58
194500 -- [-474.774] (-473.625) (-477.482) (-474.370) * [-475.367] (-475.326) (-476.973) (-476.259) -- 0:00:57
195000 -- (-475.606) (-475.104) [-480.121] (-474.024) * [-475.888] (-475.764) (-474.275) (-474.925) -- 0:00:57
Average standard deviation of split frequencies: 0.016270
195500 -- (-474.524) (-475.303) [-475.033] (-478.677) * (-474.853) (-477.643) [-476.775] (-475.640) -- 0:00:57
196000 -- (-474.327) (-475.724) [-475.428] (-474.723) * (-475.843) (-477.517) (-476.823) [-474.286] -- 0:00:57
196500 -- [-473.256] (-475.312) (-477.119) (-476.149) * (-479.027) (-475.824) [-472.974] (-474.889) -- 0:00:57
197000 -- (-475.799) [-475.633] (-476.423) (-477.480) * (-475.857) (-475.818) [-474.394] (-474.949) -- 0:00:57
197500 -- [-474.354] (-474.612) (-474.892) (-475.494) * (-487.930) (-476.046) (-476.838) [-475.034] -- 0:00:56
198000 -- (-473.681) (-474.385) [-473.773] (-475.611) * (-477.493) [-475.584] (-475.088) (-474.637) -- 0:00:56
198500 -- (-476.646) (-474.823) (-474.729) [-476.998] * (-475.874) (-474.980) [-476.738] (-473.385) -- 0:00:56
199000 -- (-475.652) (-474.142) [-475.614] (-475.420) * (-478.230) (-478.993) (-475.357) [-475.193] -- 0:00:56
199500 -- (-477.636) (-474.885) (-473.034) [-473.912] * (-481.220) (-475.956) (-476.293) [-475.722] -- 0:00:56
200000 -- (-477.715) (-473.764) (-473.879) [-476.660] * [-473.344] (-475.224) (-473.676) (-474.947) -- 0:00:55
Average standard deviation of split frequencies: 0.016721
200500 -- (-475.183) (-473.974) [-475.185] (-474.961) * (-475.013) (-475.147) [-474.261] (-474.871) -- 0:00:55
201000 -- (-479.102) (-474.480) (-476.770) [-477.265] * [-473.651] (-474.897) (-473.879) (-474.129) -- 0:00:55
201500 -- (-481.266) [-476.286] (-475.640) (-475.859) * (-476.618) [-474.767] (-474.084) (-474.968) -- 0:00:55
202000 -- (-475.583) (-477.537) [-475.222] (-474.177) * [-476.027] (-476.721) (-476.018) (-474.322) -- 0:00:55
202500 -- (-478.456) (-474.151) [-476.316] (-475.585) * (-474.304) [-474.280] (-476.169) (-475.419) -- 0:00:55
203000 -- (-479.819) (-474.929) [-475.046] (-474.356) * (-478.101) (-474.237) (-477.730) [-474.607] -- 0:00:54
203500 -- (-477.052) [-475.362] (-476.391) (-473.654) * (-474.403) (-474.452) [-474.329] (-474.773) -- 0:00:54
204000 -- (-478.808) [-476.109] (-476.416) (-473.325) * (-477.119) (-474.794) [-474.328] (-473.325) -- 0:00:54
204500 -- (-475.030) [-475.269] (-474.860) (-479.473) * (-478.552) (-473.723) [-476.309] (-476.454) -- 0:00:54
205000 -- (-474.103) [-475.555] (-476.623) (-479.161) * (-476.001) [-475.274] (-475.680) (-478.895) -- 0:00:54
Average standard deviation of split frequencies: 0.016288
205500 -- (-481.409) (-474.316) (-476.529) [-476.020] * (-473.983) [-473.761] (-477.344) (-476.766) -- 0:00:54
206000 -- (-476.003) (-474.257) [-474.798] (-475.782) * (-473.864) (-476.001) (-477.828) [-477.298] -- 0:00:53
206500 -- (-476.553) (-474.712) [-480.275] (-473.558) * (-474.700) [-478.255] (-476.179) (-474.838) -- 0:00:57
207000 -- (-473.989) (-480.951) [-474.867] (-476.233) * (-475.228) (-475.184) (-478.030) [-476.525] -- 0:00:57
207500 -- [-473.595] (-483.698) (-473.908) (-474.644) * (-474.769) [-473.993] (-475.318) (-476.725) -- 0:00:57
208000 -- [-473.268] (-477.869) (-480.697) (-474.812) * [-474.939] (-478.880) (-474.692) (-474.743) -- 0:00:57
208500 -- [-477.008] (-475.238) (-474.264) (-474.319) * (-474.516) (-473.935) [-477.559] (-474.849) -- 0:00:56
209000 -- [-474.675] (-475.049) (-473.822) (-473.810) * [-474.733] (-473.466) (-476.947) (-475.793) -- 0:00:56
209500 -- (-475.618) (-474.841) (-481.958) [-474.447] * (-474.209) (-473.176) [-478.426] (-473.433) -- 0:00:56
210000 -- (-476.132) [-475.312] (-475.513) (-476.469) * [-476.284] (-476.334) (-474.592) (-476.775) -- 0:00:56
Average standard deviation of split frequencies: 0.015927
210500 -- (-474.196) (-477.537) [-475.079] (-477.116) * (-474.830) (-475.029) [-474.631] (-474.533) -- 0:00:56
211000 -- (-477.938) (-476.569) [-475.453] (-475.022) * (-475.434) (-476.067) [-474.216] (-474.815) -- 0:00:56
211500 -- [-473.539] (-473.739) (-474.576) (-476.862) * (-474.756) [-476.682] (-475.735) (-474.973) -- 0:00:55
212000 -- (-473.690) (-474.921) (-475.197) [-474.790] * (-473.461) [-475.294] (-475.914) (-475.021) -- 0:00:55
212500 -- (-474.135) (-478.089) (-474.940) [-477.289] * [-473.631] (-475.491) (-473.099) (-474.644) -- 0:00:55
213000 -- (-474.799) (-475.513) [-477.279] (-478.141) * (-476.616) [-474.077] (-473.241) (-475.895) -- 0:00:55
213500 -- (-474.997) (-473.231) [-473.799] (-478.917) * (-479.327) [-474.477] (-478.486) (-475.039) -- 0:00:55
214000 -- (-478.349) [-475.306] (-477.246) (-476.418) * [-478.083] (-478.214) (-477.047) (-474.225) -- 0:00:55
214500 -- [-474.036] (-475.354) (-477.105) (-476.164) * (-475.099) (-478.618) (-477.306) [-473.200] -- 0:00:54
215000 -- [-474.256] (-475.132) (-474.214) (-477.603) * (-476.156) (-474.977) (-476.956) [-475.902] -- 0:00:54
Average standard deviation of split frequencies: 0.016818
215500 -- (-473.306) [-473.536] (-474.064) (-475.789) * (-476.165) (-474.680) (-476.105) [-476.331] -- 0:00:54
216000 -- (-474.527) [-473.730] (-473.096) (-475.408) * (-475.776) (-474.211) (-475.675) [-475.382] -- 0:00:54
216500 -- [-474.825] (-473.878) (-474.239) (-473.788) * [-475.740] (-475.218) (-478.060) (-476.807) -- 0:00:54
217000 -- (-474.097) (-475.135) (-473.892) [-473.822] * (-474.300) (-474.114) (-478.291) [-474.476] -- 0:00:54
217500 -- [-473.987] (-475.898) (-473.314) (-473.727) * [-473.860] (-474.157) (-483.114) (-476.212) -- 0:00:53
218000 -- (-474.353) (-476.311) (-475.062) [-475.159] * (-474.687) [-476.233] (-475.220) (-474.365) -- 0:00:53
218500 -- (-479.436) (-477.831) [-474.270] (-477.240) * (-475.388) [-477.146] (-474.743) (-475.569) -- 0:00:53
219000 -- (-476.362) (-476.705) [-473.983] (-477.020) * (-475.752) [-474.415] (-476.493) (-477.350) -- 0:00:53
219500 -- (-474.495) (-475.978) (-476.022) [-474.630] * [-479.274] (-474.667) (-476.658) (-475.722) -- 0:00:53
220000 -- [-475.030] (-475.943) (-475.940) (-474.067) * [-478.324] (-477.039) (-476.899) (-475.428) -- 0:00:53
Average standard deviation of split frequencies: 0.015080
220500 -- [-474.980] (-474.994) (-474.556) (-476.023) * (-474.732) (-478.417) [-474.198] (-473.402) -- 0:00:53
221000 -- (-476.674) (-474.255) [-475.524] (-473.695) * (-475.137) (-473.855) [-473.488] (-477.787) -- 0:00:52
221500 -- (-480.816) (-474.022) [-474.500] (-473.248) * (-473.801) (-474.160) (-474.752) [-475.420] -- 0:00:52
222000 -- [-474.652] (-475.717) (-475.120) (-473.947) * [-475.279] (-473.779) (-476.819) (-476.309) -- 0:00:52
222500 -- (-475.369) (-473.032) [-476.963] (-476.175) * [-475.480] (-476.283) (-473.769) (-476.095) -- 0:00:52
223000 -- (-473.889) (-473.820) [-475.372] (-475.056) * (-475.014) (-475.699) (-474.791) [-473.943] -- 0:00:55
223500 -- (-476.830) (-477.727) (-473.995) [-477.342] * (-475.119) [-474.550] (-474.716) (-473.313) -- 0:00:55
224000 -- (-477.302) (-473.602) (-475.254) [-473.704] * (-474.769) [-474.788] (-474.000) (-475.925) -- 0:00:55
224500 -- (-474.871) [-473.315] (-474.291) (-477.927) * (-477.240) (-474.153) (-474.109) [-474.149] -- 0:00:55
225000 -- (-474.421) (-473.437) (-477.271) [-475.812] * (-474.733) (-474.851) [-475.843] (-474.794) -- 0:00:55
Average standard deviation of split frequencies: 0.017266
225500 -- [-479.401] (-473.046) (-474.251) (-473.953) * (-478.007) (-479.571) [-477.126] (-474.718) -- 0:00:54
226000 -- (-480.574) (-473.564) (-474.372) [-477.207] * (-474.330) [-485.304] (-474.298) (-475.735) -- 0:00:54
226500 -- [-475.230] (-474.620) (-476.307) (-474.893) * (-477.743) [-475.805] (-475.707) (-475.298) -- 0:00:54
227000 -- (-480.092) [-477.165] (-478.512) (-477.822) * [-474.705] (-474.679) (-474.939) (-475.339) -- 0:00:54
227500 -- (-476.890) [-476.083] (-476.564) (-476.182) * (-475.886) (-479.432) (-476.092) [-476.462] -- 0:00:54
228000 -- [-473.792] (-477.599) (-477.611) (-473.520) * (-475.325) (-476.624) (-477.571) [-476.712] -- 0:00:54
228500 -- (-474.779) (-476.030) [-477.207] (-474.730) * (-478.384) (-477.572) (-476.949) [-473.252] -- 0:00:54
229000 -- [-475.339] (-477.236) (-477.510) (-476.898) * (-475.506) (-480.153) (-479.610) [-474.168] -- 0:00:53
229500 -- [-475.234] (-476.745) (-476.301) (-474.372) * (-474.405) (-472.977) (-477.885) [-474.493] -- 0:00:53
230000 -- [-474.853] (-481.125) (-477.016) (-473.717) * (-474.973) [-474.167] (-476.837) (-473.210) -- 0:00:53
Average standard deviation of split frequencies: 0.016803
230500 -- [-473.393] (-477.541) (-475.604) (-473.311) * (-476.115) (-477.516) [-473.340] (-475.598) -- 0:00:53
231000 -- [-473.913] (-476.908) (-477.552) (-475.159) * (-475.155) [-476.169] (-474.412) (-473.652) -- 0:00:53
231500 -- (-476.214) (-476.801) [-477.343] (-473.985) * (-477.351) (-476.526) (-475.845) [-474.600] -- 0:00:53
232000 -- (-476.816) (-480.077) (-475.133) [-473.305] * [-473.810] (-473.976) (-474.360) (-474.471) -- 0:00:52
232500 -- (-473.670) [-478.144] (-473.604) (-477.212) * (-474.733) (-474.655) (-475.041) [-474.945] -- 0:00:52
233000 -- (-479.713) (-476.094) (-474.068) [-479.867] * (-474.167) (-474.241) [-474.008] (-477.084) -- 0:00:52
233500 -- (-480.437) (-478.770) [-478.275] (-476.214) * (-473.518) [-473.220] (-475.999) (-475.413) -- 0:00:52
234000 -- [-476.123] (-473.548) (-474.840) (-477.726) * [-479.362] (-478.290) (-473.928) (-477.300) -- 0:00:52
234500 -- (-474.264) (-482.722) (-474.245) [-474.403] * (-472.944) [-476.696] (-475.957) (-476.634) -- 0:00:52
235000 -- (-476.633) (-474.645) [-474.995] (-474.013) * (-474.801) (-474.233) [-475.236] (-479.880) -- 0:00:52
Average standard deviation of split frequencies: 0.016332
235500 -- (-474.560) [-475.302] (-479.484) (-479.698) * [-476.469] (-484.168) (-478.613) (-475.507) -- 0:00:51
236000 -- (-474.739) (-474.799) (-475.848) [-476.907] * (-473.366) [-474.623] (-475.006) (-476.980) -- 0:00:51
236500 -- (-476.901) (-476.131) (-477.423) [-476.444] * (-476.596) (-474.306) [-474.678] (-475.449) -- 0:00:51
237000 -- (-475.430) (-475.701) (-475.068) [-474.341] * (-473.419) (-474.614) (-476.474) [-475.370] -- 0:00:51
237500 -- (-475.142) (-475.930) (-476.381) [-477.098] * (-473.918) [-473.899] (-477.553) (-476.041) -- 0:00:51
238000 -- (-476.737) [-473.155] (-478.721) (-475.622) * (-474.355) (-478.882) (-474.968) [-475.029] -- 0:00:51
238500 -- (-476.161) (-476.510) [-477.818] (-474.356) * (-474.383) [-474.446] (-475.022) (-479.262) -- 0:00:54
239000 -- (-474.019) (-477.857) [-474.749] (-475.700) * (-479.101) [-475.438] (-475.973) (-477.401) -- 0:00:54
239500 -- (-475.295) (-478.201) [-474.436] (-474.117) * (-478.063) (-478.316) [-474.252] (-478.983) -- 0:00:53
240000 -- [-473.435] (-479.770) (-474.053) (-478.584) * (-474.440) (-475.224) [-474.681] (-474.120) -- 0:00:53
Average standard deviation of split frequencies: 0.015440
240500 -- [-476.312] (-475.249) (-474.152) (-474.641) * (-477.946) (-475.043) [-475.015] (-474.991) -- 0:00:53
241000 -- (-474.937) [-478.745] (-476.785) (-476.305) * (-474.048) (-473.947) [-473.106] (-477.056) -- 0:00:53
241500 -- [-475.581] (-480.595) (-474.475) (-475.016) * [-474.606] (-475.054) (-474.815) (-475.899) -- 0:00:53
242000 -- [-474.516] (-479.273) (-473.859) (-474.902) * (-475.608) (-475.825) (-476.457) [-474.344] -- 0:00:53
242500 -- [-477.936] (-476.600) (-474.590) (-475.156) * (-475.248) (-474.367) (-475.200) [-474.834] -- 0:00:53
243000 -- (-474.217) (-475.143) [-473.864] (-477.588) * (-475.869) (-474.440) (-475.399) [-473.502] -- 0:00:52
243500 -- [-474.443] (-474.173) (-475.797) (-478.330) * [-480.117] (-473.252) (-478.399) (-474.041) -- 0:00:52
244000 -- (-475.786) [-474.949] (-482.023) (-478.136) * [-475.445] (-479.357) (-475.163) (-475.516) -- 0:00:52
244500 -- (-476.168) (-474.744) (-475.586) [-473.397] * [-474.787] (-475.224) (-475.346) (-474.446) -- 0:00:52
245000 -- [-473.941] (-475.376) (-477.432) (-472.986) * [-473.519] (-475.666) (-476.354) (-474.107) -- 0:00:52
Average standard deviation of split frequencies: 0.015330
245500 -- (-474.537) (-474.310) (-476.249) [-474.115] * (-475.209) [-475.798] (-478.101) (-476.263) -- 0:00:52
246000 -- [-475.839] (-477.397) (-474.530) (-477.091) * (-475.206) (-475.882) (-479.919) [-478.218] -- 0:00:52
246500 -- (-477.704) (-480.110) (-475.863) [-476.506] * (-475.217) (-475.212) [-474.153] (-476.916) -- 0:00:51
247000 -- (-476.866) (-475.318) [-472.933] (-480.469) * (-475.046) [-477.220] (-474.555) (-473.544) -- 0:00:51
247500 -- (-476.012) [-473.901] (-473.786) (-476.745) * (-474.521) (-477.084) (-475.076) [-474.358] -- 0:00:51
248000 -- (-476.282) (-473.154) (-473.575) [-475.590] * (-474.629) (-476.902) (-474.795) [-473.600] -- 0:00:51
248500 -- (-475.816) (-474.971) [-474.047] (-475.531) * (-482.125) [-476.270] (-479.431) (-474.891) -- 0:00:51
249000 -- (-474.866) (-474.678) (-474.755) [-475.330] * [-475.385] (-477.190) (-474.103) (-474.377) -- 0:00:51
249500 -- (-476.660) (-475.053) [-477.906] (-476.836) * (-474.888) (-478.305) [-474.310] (-475.622) -- 0:00:51
250000 -- (-475.145) (-475.632) (-476.421) [-474.773] * (-474.360) [-475.200] (-473.193) (-478.397) -- 0:00:51
Average standard deviation of split frequencies: 0.014627
250500 -- (-478.833) [-477.022] (-476.928) (-474.454) * [-472.998] (-477.166) (-474.287) (-473.565) -- 0:00:50
251000 -- (-475.758) (-475.625) [-476.388] (-474.236) * (-474.309) (-478.932) [-473.706] (-474.541) -- 0:00:50
251500 -- [-477.663] (-474.673) (-476.678) (-474.749) * [-473.957] (-476.097) (-482.470) (-474.836) -- 0:00:50
252000 -- (-477.608) (-477.354) (-477.998) [-476.287] * (-473.436) (-474.594) [-476.669] (-475.323) -- 0:00:50
252500 -- (-477.291) (-474.970) (-475.979) [-473.926] * (-474.173) (-476.728) [-474.072] (-474.682) -- 0:00:50
253000 -- (-475.392) [-474.814] (-475.140) (-475.496) * (-474.709) (-474.660) [-474.503] (-476.270) -- 0:00:50
253500 -- [-478.452] (-475.733) (-475.647) (-476.919) * (-473.720) [-474.063] (-475.085) (-475.108) -- 0:00:50
254000 -- (-474.932) (-474.236) (-474.426) [-473.207] * (-474.295) [-474.288] (-475.340) (-475.620) -- 0:00:49
254500 -- (-474.911) (-474.529) [-474.280] (-473.456) * (-476.136) [-474.789] (-474.220) (-474.811) -- 0:00:52
255000 -- (-474.181) (-474.286) (-476.086) [-473.977] * (-476.587) [-474.319] (-476.436) (-478.663) -- 0:00:52
Average standard deviation of split frequencies: 0.013865
255500 -- (-474.850) (-475.988) (-475.256) [-474.147] * (-478.270) (-474.238) [-474.359] (-474.234) -- 0:00:52
256000 -- (-476.185) [-474.539] (-476.249) (-475.627) * (-477.420) (-474.169) (-473.739) [-475.462] -- 0:00:52
256500 -- (-478.177) (-476.007) [-473.122] (-473.301) * (-474.509) (-474.703) [-479.055] (-476.568) -- 0:00:52
257000 -- (-474.636) (-476.310) [-475.294] (-475.284) * [-473.425] (-473.509) (-475.356) (-475.530) -- 0:00:52
257500 -- (-476.142) [-473.834] (-474.564) (-474.909) * (-474.286) (-473.554) (-474.136) [-473.735] -- 0:00:51
258000 -- (-476.676) (-477.121) [-474.840] (-474.364) * (-474.274) [-474.057] (-474.989) (-475.033) -- 0:00:51
258500 -- (-475.594) (-475.003) [-473.619] (-474.669) * (-474.467) (-476.133) [-473.751] (-477.890) -- 0:00:51
259000 -- [-475.488] (-474.873) (-473.321) (-477.022) * (-478.609) (-477.624) (-473.360) [-473.066] -- 0:00:51
259500 -- [-475.473] (-478.597) (-477.190) (-476.344) * (-477.076) [-475.651] (-473.436) (-475.657) -- 0:00:51
260000 -- [-474.172] (-475.250) (-474.633) (-475.184) * (-474.489) (-475.538) (-474.722) [-475.255] -- 0:00:51
Average standard deviation of split frequencies: 0.012659
260500 -- [-474.795] (-475.599) (-477.174) (-474.241) * (-477.485) (-477.633) (-475.011) [-474.960] -- 0:00:51
261000 -- [-475.761] (-475.352) (-474.709) (-476.122) * (-476.360) (-477.596) (-478.366) [-473.661] -- 0:00:50
261500 -- (-476.878) [-476.927] (-474.057) (-475.770) * (-476.318) [-475.111] (-475.697) (-474.156) -- 0:00:50
262000 -- (-476.667) (-473.040) (-473.945) [-475.559] * (-479.748) (-475.151) (-475.425) [-473.928] -- 0:00:50
262500 -- [-474.514] (-474.717) (-476.013) (-475.759) * (-474.739) (-477.418) (-473.313) [-472.917] -- 0:00:50
263000 -- (-475.298) (-474.440) [-477.527] (-476.534) * (-475.171) (-477.694) [-473.900] (-474.228) -- 0:00:50
263500 -- (-474.156) [-474.158] (-475.351) (-476.730) * (-474.147) [-475.902] (-473.737) (-476.730) -- 0:00:50
264000 -- [-473.682] (-476.051) (-476.309) (-473.505) * (-477.492) (-476.384) [-474.546] (-475.796) -- 0:00:50
264500 -- (-476.338) (-474.052) (-477.753) [-474.146] * (-473.003) (-474.227) [-476.515] (-474.912) -- 0:00:50
265000 -- (-474.495) (-474.586) [-473.633] (-475.455) * [-474.291] (-473.767) (-473.291) (-473.966) -- 0:00:49
Average standard deviation of split frequencies: 0.012093
265500 -- (-474.580) [-475.826] (-474.849) (-475.147) * [-474.927] (-475.348) (-473.553) (-476.018) -- 0:00:49
266000 -- (-473.810) (-476.148) (-475.447) [-474.161] * (-473.911) [-474.573] (-474.936) (-475.755) -- 0:00:49
266500 -- (-475.579) (-474.680) (-475.963) [-474.140] * (-474.247) (-474.722) [-474.945] (-474.217) -- 0:00:49
267000 -- (-477.659) (-473.467) (-480.108) [-474.829] * (-475.266) [-474.559] (-475.762) (-475.447) -- 0:00:49
267500 -- (-481.757) [-476.344] (-475.171) (-475.091) * (-476.242) (-473.157) (-480.345) [-473.862] -- 0:00:49
268000 -- (-473.532) (-473.434) [-473.595] (-474.798) * (-476.050) (-474.539) [-475.489] (-473.358) -- 0:00:49
268500 -- (-473.710) (-475.583) (-475.376) [-473.269] * [-473.864] (-475.858) (-477.232) (-474.227) -- 0:00:49
269000 -- (-476.576) [-475.771] (-474.070) (-480.305) * (-473.706) [-474.560] (-476.480) (-475.221) -- 0:00:48
269500 -- (-477.046) (-476.926) (-476.042) [-474.238] * (-473.739) (-475.232) [-475.613] (-477.433) -- 0:00:48
270000 -- [-476.692] (-477.061) (-474.971) (-473.024) * (-473.288) [-475.052] (-474.211) (-476.073) -- 0:00:51
Average standard deviation of split frequencies: 0.011884
270500 -- (-476.199) (-478.443) [-474.148] (-474.911) * (-474.826) (-474.019) (-475.721) [-473.864] -- 0:00:51
271000 -- (-474.220) (-477.079) (-475.919) [-474.670] * [-475.305] (-474.519) (-475.589) (-473.949) -- 0:00:51
271500 -- (-477.179) (-478.737) [-474.633] (-478.319) * (-474.447) (-473.524) (-474.769) [-475.428] -- 0:00:50
272000 -- (-474.422) [-473.854] (-473.909) (-483.159) * (-474.418) (-474.522) (-477.033) [-474.548] -- 0:00:50
272500 -- (-475.240) [-473.732] (-475.838) (-475.103) * (-473.957) (-477.487) [-477.342] (-476.555) -- 0:00:50
273000 -- [-475.210] (-475.664) (-475.682) (-474.960) * (-475.573) (-476.237) (-477.440) [-474.140] -- 0:00:50
273500 -- (-476.226) (-475.082) [-475.007] (-476.996) * (-474.362) (-476.208) [-476.245] (-474.083) -- 0:00:50
274000 -- (-477.008) (-474.123) [-475.259] (-475.471) * (-473.882) (-476.170) (-478.070) [-477.783] -- 0:00:50
274500 -- (-475.414) (-478.447) [-476.223] (-472.938) * [-473.762] (-474.946) (-475.304) (-474.846) -- 0:00:50
275000 -- (-475.174) [-475.410] (-473.650) (-474.427) * (-473.545) [-476.947] (-481.273) (-473.438) -- 0:00:50
Average standard deviation of split frequencies: 0.012860
275500 -- (-481.065) (-476.356) (-475.968) [-473.550] * (-474.135) (-477.622) [-475.065] (-473.275) -- 0:00:49
276000 -- (-475.994) [-474.034] (-475.119) (-474.984) * (-474.679) [-475.376] (-474.497) (-473.079) -- 0:00:49
276500 -- [-474.655] (-475.056) (-473.899) (-475.689) * (-474.055) (-475.916) (-475.026) [-475.134] -- 0:00:49
277000 -- (-475.259) (-474.640) (-475.241) [-473.653] * (-475.497) (-473.469) (-474.196) [-477.191] -- 0:00:49
277500 -- (-475.703) [-476.443] (-473.926) (-473.480) * [-478.319] (-473.193) (-475.085) (-479.181) -- 0:00:49
278000 -- (-472.963) (-478.848) (-476.592) [-474.423] * [-477.655] (-476.556) (-476.407) (-476.266) -- 0:00:49
278500 -- (-473.694) (-475.845) [-474.638] (-476.514) * [-476.911] (-476.411) (-473.941) (-476.345) -- 0:00:49
279000 -- (-476.390) [-479.433] (-479.674) (-476.249) * [-478.003] (-476.133) (-474.546) (-475.467) -- 0:00:49
279500 -- (-475.170) (-474.384) (-476.157) [-473.472] * (-479.187) (-474.920) [-473.804] (-474.987) -- 0:00:48
280000 -- (-478.891) [-473.043] (-477.382) (-475.117) * (-473.679) (-474.290) (-477.102) [-476.953] -- 0:00:48
Average standard deviation of split frequencies: 0.013623
280500 -- (-475.778) [-474.084] (-476.083) (-478.973) * [-479.564] (-475.068) (-474.788) (-477.707) -- 0:00:48
281000 -- [-473.718] (-473.542) (-474.667) (-473.968) * (-475.657) (-475.114) (-473.492) [-474.425] -- 0:00:48
281500 -- (-473.880) [-475.442] (-474.114) (-475.007) * (-474.379) (-473.931) [-473.424] (-475.326) -- 0:00:48
282000 -- (-473.641) (-474.152) (-475.789) [-474.103] * (-473.449) (-475.441) [-476.799] (-474.389) -- 0:00:48
282500 -- [-476.802] (-476.541) (-477.793) (-476.877) * [-473.696] (-475.091) (-475.779) (-474.485) -- 0:00:48
283000 -- (-477.659) [-475.766] (-478.604) (-478.098) * [-476.654] (-474.460) (-478.234) (-475.812) -- 0:00:48
283500 -- (-474.691) (-473.879) (-474.242) [-474.303] * [-476.924] (-474.113) (-473.257) (-474.907) -- 0:00:48
284000 -- (-472.926) (-476.354) (-479.964) [-478.018] * (-474.540) (-473.739) (-476.835) [-474.045] -- 0:00:47
284500 -- (-478.484) (-478.162) (-476.615) [-474.186] * (-473.985) (-476.019) [-476.934] (-476.773) -- 0:00:50
285000 -- (-478.087) [-476.655] (-475.637) (-474.105) * (-475.346) (-480.742) [-477.559] (-474.082) -- 0:00:50
Average standard deviation of split frequencies: 0.013461
285500 -- (-476.579) [-474.298] (-474.691) (-478.621) * [-474.218] (-477.009) (-474.401) (-476.928) -- 0:00:50
286000 -- (-476.314) (-477.816) [-474.115] (-477.889) * (-476.244) (-477.759) (-474.499) [-475.745] -- 0:00:49
286500 -- (-474.881) (-474.213) [-474.515] (-475.048) * (-478.310) (-474.897) [-476.486] (-475.759) -- 0:00:49
287000 -- [-475.474] (-476.379) (-476.471) (-478.485) * (-474.973) (-473.696) (-473.893) [-477.806] -- 0:00:49
287500 -- (-477.344) [-474.483] (-474.633) (-477.326) * (-477.223) [-476.181] (-473.309) (-475.732) -- 0:00:49
288000 -- (-474.163) (-479.385) (-477.481) [-476.835] * (-473.675) (-476.352) [-473.439] (-474.370) -- 0:00:49
288500 -- (-473.332) [-476.264] (-474.658) (-476.356) * [-474.116] (-474.520) (-474.566) (-474.074) -- 0:00:49
289000 -- [-474.043] (-476.854) (-473.525) (-474.186) * [-474.344] (-476.378) (-477.574) (-473.616) -- 0:00:49
289500 -- (-473.576) (-475.702) [-473.456] (-476.175) * (-474.529) [-476.616] (-474.283) (-474.726) -- 0:00:49
290000 -- (-477.419) (-475.561) (-474.638) [-474.859] * [-473.562] (-473.003) (-479.817) (-475.855) -- 0:00:48
Average standard deviation of split frequencies: 0.012434
290500 -- (-474.287) (-476.882) (-475.378) [-474.176] * (-473.791) [-473.106] (-475.202) (-473.882) -- 0:00:48
291000 -- [-473.643] (-480.055) (-476.566) (-477.364) * (-475.953) [-474.847] (-474.944) (-475.547) -- 0:00:48
291500 -- (-474.092) (-473.332) (-475.978) [-473.922] * (-474.021) (-473.149) [-473.668] (-476.729) -- 0:00:48
292000 -- (-474.157) (-473.974) [-474.074] (-474.398) * (-473.996) (-479.037) [-474.944] (-480.720) -- 0:00:48
292500 -- (-476.564) (-473.550) [-475.923] (-474.747) * (-473.122) [-478.864] (-474.782) (-478.121) -- 0:00:48
293000 -- (-477.721) (-483.074) (-474.070) [-478.039] * (-473.272) (-476.242) [-474.894] (-474.243) -- 0:00:48
293500 -- [-473.529] (-475.041) (-473.640) (-473.044) * (-475.449) (-475.830) (-477.471) [-474.738] -- 0:00:48
294000 -- (-475.556) [-475.414] (-483.246) (-473.598) * (-475.397) (-474.078) (-478.447) [-478.761] -- 0:00:48
294500 -- [-475.835] (-475.749) (-483.524) (-477.594) * (-475.025) (-473.183) (-473.529) [-476.146] -- 0:00:47
295000 -- (-476.894) [-473.580] (-475.521) (-475.821) * (-475.395) (-473.081) [-478.842] (-475.474) -- 0:00:47
Average standard deviation of split frequencies: 0.011856
295500 -- (-475.712) (-479.787) [-474.485] (-475.152) * (-475.663) [-473.252] (-476.926) (-477.296) -- 0:00:47
296000 -- (-474.790) [-476.197] (-478.803) (-473.435) * (-479.255) [-473.390] (-478.602) (-474.539) -- 0:00:47
296500 -- (-479.331) (-477.430) [-475.002] (-473.962) * (-479.565) (-477.906) [-476.739] (-477.556) -- 0:00:47
297000 -- (-475.875) (-475.670) (-476.056) [-473.663] * [-478.449] (-475.179) (-474.823) (-475.526) -- 0:00:47
297500 -- (-475.603) (-475.595) [-474.926] (-476.580) * [-476.189] (-475.373) (-474.645) (-474.223) -- 0:00:47
298000 -- (-475.911) (-477.866) [-475.060] (-476.123) * [-477.517] (-477.522) (-474.753) (-473.663) -- 0:00:47
298500 -- (-474.914) (-478.204) [-474.083] (-474.375) * (-474.217) [-474.069] (-474.994) (-477.388) -- 0:00:47
299000 -- (-474.057) (-476.079) (-475.351) [-477.341] * (-474.108) [-476.087] (-480.543) (-475.394) -- 0:00:46
299500 -- (-474.359) (-475.347) [-474.318] (-476.125) * (-479.613) (-475.975) [-474.855] (-475.397) -- 0:00:46
300000 -- (-475.593) (-475.533) [-475.362] (-475.456) * [-474.854] (-478.340) (-474.914) (-475.999) -- 0:00:46
Average standard deviation of split frequencies: 0.012630
300500 -- (-475.430) (-474.891) (-477.090) [-473.489] * [-475.204] (-476.167) (-474.020) (-477.398) -- 0:00:48
301000 -- (-478.185) [-473.151] (-476.732) (-473.614) * (-476.176) [-477.119] (-475.172) (-478.448) -- 0:00:48
301500 -- (-478.618) (-474.042) (-475.961) [-474.294] * (-476.404) [-477.066] (-476.154) (-475.464) -- 0:00:48
302000 -- (-480.195) (-473.671) (-478.448) [-476.997] * [-475.624] (-476.544) (-475.023) (-476.592) -- 0:00:48
302500 -- [-476.650] (-473.683) (-478.086) (-476.939) * (-477.991) (-475.965) [-478.790] (-476.300) -- 0:00:48
303000 -- (-473.695) (-473.250) [-474.524] (-474.006) * [-474.379] (-478.336) (-477.121) (-479.205) -- 0:00:48
303500 -- [-473.884] (-476.073) (-475.721) (-475.098) * [-473.948] (-473.928) (-476.700) (-473.882) -- 0:00:48
304000 -- (-473.456) (-474.468) (-474.079) [-473.314] * [-474.227] (-476.585) (-475.199) (-473.378) -- 0:00:48
304500 -- [-474.054] (-474.702) (-476.133) (-474.448) * (-477.170) (-473.933) (-475.491) [-475.668] -- 0:00:47
305000 -- [-473.876] (-475.650) (-474.967) (-480.180) * (-474.006) (-477.368) (-473.223) [-473.804] -- 0:00:47
Average standard deviation of split frequencies: 0.012068
305500 -- (-476.754) [-473.421] (-476.516) (-474.603) * (-473.951) (-476.083) [-473.157] (-473.941) -- 0:00:47
306000 -- (-475.923) (-474.203) [-476.550] (-474.189) * (-474.291) (-477.496) [-474.911] (-479.902) -- 0:00:47
306500 -- (-477.185) [-473.680] (-480.298) (-473.830) * (-475.084) [-475.854] (-475.967) (-474.293) -- 0:00:47
307000 -- (-473.871) (-475.552) [-474.093] (-481.244) * (-474.527) (-474.620) [-473.495] (-476.015) -- 0:00:47
307500 -- (-473.801) (-475.076) (-474.501) [-479.978] * (-473.751) (-478.099) (-473.645) [-476.283] -- 0:00:47
308000 -- (-477.383) (-475.489) (-480.978) [-473.987] * (-475.208) (-476.328) (-476.740) [-474.320] -- 0:00:47
308500 -- (-477.488) [-479.961] (-476.056) (-478.036) * (-475.982) (-474.593) [-473.213] (-475.378) -- 0:00:47
309000 -- [-474.503] (-477.679) (-473.440) (-481.218) * (-474.320) (-473.203) (-474.377) [-473.799] -- 0:00:46
309500 -- (-476.699) (-476.417) (-474.374) [-473.739] * (-474.371) (-475.462) [-475.754] (-475.195) -- 0:00:46
310000 -- (-474.627) (-474.518) [-474.079] (-473.957) * (-476.485) (-475.108) (-476.101) [-478.508] -- 0:00:46
Average standard deviation of split frequencies: 0.012476
310500 -- (-475.056) (-475.000) [-477.158] (-475.506) * [-475.256] (-474.913) (-477.531) (-475.151) -- 0:00:46
311000 -- (-476.430) (-477.051) [-474.735] (-473.673) * (-477.330) [-475.162] (-473.806) (-474.663) -- 0:00:46
311500 -- [-476.485] (-478.303) (-474.157) (-473.626) * (-473.911) (-474.701) [-478.336] (-474.609) -- 0:00:46
312000 -- (-475.769) [-478.991] (-474.168) (-477.443) * (-474.220) (-474.999) (-474.650) [-474.562] -- 0:00:46
312500 -- (-474.898) (-475.106) (-474.544) [-476.201] * (-473.435) [-474.771] (-475.384) (-477.817) -- 0:00:46
313000 -- [-475.678] (-475.694) (-474.523) (-474.604) * (-476.524) (-476.844) [-473.523] (-478.073) -- 0:00:46
313500 -- [-474.074] (-473.503) (-474.544) (-476.904) * (-476.636) [-473.396] (-474.624) (-476.792) -- 0:00:45
314000 -- (-476.367) (-475.269) [-474.712] (-480.631) * (-476.378) (-476.482) (-476.198) [-475.128] -- 0:00:45
314500 -- (-473.147) (-474.822) (-479.448) [-475.292] * (-476.042) [-476.062] (-474.920) (-474.780) -- 0:00:45
315000 -- (-473.444) (-477.399) (-475.974) [-476.157] * (-475.769) [-475.361] (-476.640) (-477.963) -- 0:00:45
Average standard deviation of split frequencies: 0.013343
315500 -- (-476.068) (-481.813) [-476.645] (-475.130) * (-474.953) (-473.912) [-475.100] (-475.847) -- 0:00:45
316000 -- (-479.563) (-476.832) [-477.028] (-475.784) * (-475.157) (-475.261) [-473.886] (-479.674) -- 0:00:45
316500 -- (-474.424) (-475.361) [-479.748] (-480.545) * (-480.804) (-476.143) [-476.852] (-479.400) -- 0:00:45
317000 -- [-473.562] (-474.772) (-473.815) (-480.447) * (-475.935) [-475.781] (-474.513) (-475.406) -- 0:00:45
317500 -- (-476.074) (-478.285) (-473.812) [-477.387] * (-476.044) [-472.998] (-475.471) (-473.439) -- 0:00:47
318000 -- [-475.279] (-474.799) (-475.335) (-473.533) * (-475.570) (-479.017) (-475.827) [-474.537] -- 0:00:47
318500 -- [-475.562] (-475.404) (-477.337) (-473.329) * (-477.000) [-475.876] (-475.268) (-476.286) -- 0:00:47
319000 -- (-475.442) [-475.844] (-475.687) (-474.024) * (-475.341) (-475.044) (-479.597) [-473.268] -- 0:00:46
319500 -- (-475.379) [-474.352] (-475.693) (-473.130) * (-475.962) (-474.328) [-474.858] (-480.229) -- 0:00:46
320000 -- (-479.826) (-476.017) [-476.817] (-479.609) * (-478.084) (-476.633) (-475.933) [-475.956] -- 0:00:46
Average standard deviation of split frequencies: 0.013884
320500 -- (-474.348) (-473.471) [-474.710] (-479.583) * (-480.814) (-474.575) (-474.051) [-475.487] -- 0:00:46
321000 -- (-476.222) (-475.343) [-476.249] (-476.938) * [-476.057] (-474.750) (-474.959) (-475.053) -- 0:00:46
321500 -- (-477.446) (-475.150) [-474.351] (-478.073) * [-477.287] (-475.504) (-473.931) (-474.621) -- 0:00:46
322000 -- (-482.993) (-475.282) (-473.505) [-474.408] * [-478.434] (-476.725) (-477.562) (-474.688) -- 0:00:46
322500 -- (-474.209) [-475.381] (-473.588) (-474.741) * (-475.801) (-476.932) (-479.472) [-475.181] -- 0:00:46
323000 -- (-475.339) (-474.174) [-474.052] (-477.381) * [-475.139] (-476.000) (-478.405) (-472.926) -- 0:00:46
323500 -- [-476.609] (-475.890) (-475.170) (-476.385) * [-475.113] (-477.680) (-474.605) (-477.782) -- 0:00:46
324000 -- [-475.695] (-480.600) (-474.178) (-475.857) * [-473.433] (-474.680) (-475.345) (-474.373) -- 0:00:45
324500 -- (-477.780) (-473.808) (-483.528) [-474.523] * (-476.134) (-476.546) [-473.259] (-474.949) -- 0:00:45
325000 -- (-476.655) (-481.138) [-477.456] (-474.483) * (-474.665) (-477.714) [-475.197] (-474.634) -- 0:00:45
Average standard deviation of split frequencies: 0.012710
325500 -- (-474.820) [-473.519] (-474.660) (-478.139) * (-474.848) (-478.562) [-476.656] (-476.511) -- 0:00:45
326000 -- (-476.268) (-475.888) (-475.262) [-478.774] * [-476.451] (-476.141) (-477.259) (-478.421) -- 0:00:45
326500 -- (-474.507) (-477.227) (-473.707) [-475.797] * (-473.344) (-476.856) [-474.404] (-474.315) -- 0:00:45
327000 -- [-474.123] (-473.515) (-477.840) (-477.709) * (-474.074) [-476.295] (-475.179) (-475.323) -- 0:00:45
327500 -- (-475.583) (-475.114) [-476.073] (-474.555) * (-474.550) [-478.292] (-473.558) (-477.247) -- 0:00:45
328000 -- (-473.717) [-477.741] (-475.749) (-474.798) * (-475.170) (-475.519) [-477.299] (-476.089) -- 0:00:45
328500 -- (-474.186) (-478.420) [-475.421] (-475.030) * (-474.946) [-474.832] (-477.491) (-475.674) -- 0:00:44
329000 -- (-484.498) (-473.996) (-477.004) [-476.863] * [-475.286] (-475.783) (-478.277) (-473.973) -- 0:00:44
329500 -- (-476.513) (-473.576) [-475.824] (-477.735) * (-474.187) (-474.543) (-476.785) [-475.829] -- 0:00:44
330000 -- (-475.609) (-475.817) (-477.618) [-478.164] * (-474.857) [-477.693] (-476.777) (-473.690) -- 0:00:44
Average standard deviation of split frequencies: 0.014731
330500 -- (-475.724) [-473.933] (-476.056) (-473.562) * (-475.136) [-476.547] (-475.012) (-476.974) -- 0:00:44
331000 -- (-476.739) [-476.458] (-473.904) (-473.309) * (-474.794) (-478.919) [-475.985] (-474.124) -- 0:00:44
331500 -- (-476.396) (-476.251) [-474.212] (-476.645) * (-473.822) [-476.577] (-474.272) (-479.125) -- 0:00:44
332000 -- (-476.017) (-473.428) [-474.621] (-478.996) * (-474.758) (-473.996) [-474.334] (-479.762) -- 0:00:44
332500 -- (-475.465) [-474.807] (-474.371) (-476.944) * (-474.896) [-473.388] (-474.811) (-479.452) -- 0:00:44
333000 -- (-479.922) (-476.420) [-475.891] (-474.612) * (-477.037) (-473.300) [-477.701] (-478.851) -- 0:00:44
333500 -- [-475.611] (-475.344) (-474.461) (-476.795) * (-476.247) (-474.260) [-473.800] (-477.077) -- 0:00:45
334000 -- (-478.213) (-477.047) (-475.536) [-473.312] * (-476.980) (-474.010) [-473.894] (-474.644) -- 0:00:45
334500 -- [-477.790] (-477.759) (-475.308) (-476.634) * (-475.452) (-475.017) [-474.164] (-477.595) -- 0:00:45
335000 -- [-473.778] (-474.278) (-474.731) (-475.939) * (-476.720) [-475.724] (-476.662) (-475.657) -- 0:00:45
Average standard deviation of split frequencies: 0.014653
335500 -- (-473.574) (-475.158) [-474.905] (-474.416) * (-480.093) [-476.713] (-474.871) (-474.763) -- 0:00:45
336000 -- [-473.363] (-477.348) (-478.165) (-474.077) * [-475.721] (-475.107) (-479.568) (-476.958) -- 0:00:45
336500 -- [-473.729] (-473.777) (-479.207) (-474.731) * (-476.463) [-474.970] (-474.874) (-473.874) -- 0:00:45
337000 -- [-473.447] (-478.667) (-481.077) (-474.271) * (-476.161) [-475.103] (-475.914) (-475.797) -- 0:00:45
337500 -- (-474.886) [-477.385] (-476.506) (-474.283) * (-474.790) (-474.915) (-474.880) [-474.820] -- 0:00:45
338000 -- (-475.855) (-474.876) (-477.533) [-477.015] * (-479.778) (-476.166) [-478.055] (-478.082) -- 0:00:45
338500 -- (-475.047) (-477.362) [-476.493] (-476.002) * (-473.588) (-475.466) [-478.707] (-476.546) -- 0:00:44
339000 -- (-478.126) [-474.048] (-475.402) (-478.247) * (-478.455) [-473.789] (-474.358) (-474.092) -- 0:00:44
339500 -- (-473.752) (-474.561) [-474.262] (-474.045) * (-474.904) [-475.807] (-477.483) (-473.788) -- 0:00:44
340000 -- (-476.952) (-475.266) (-473.164) [-473.631] * (-474.820) (-474.005) (-474.640) [-475.399] -- 0:00:44
Average standard deviation of split frequencies: 0.014914
340500 -- (-475.037) (-474.121) (-475.260) [-475.218] * [-478.573] (-474.648) (-476.982) (-475.803) -- 0:00:44
341000 -- (-474.238) [-476.951] (-475.122) (-478.057) * (-474.838) (-475.114) (-477.976) [-475.682] -- 0:00:44
341500 -- [-476.372] (-476.449) (-477.969) (-478.458) * (-473.767) [-475.968] (-475.163) (-473.396) -- 0:00:44
342000 -- [-477.256] (-473.852) (-477.700) (-475.950) * (-474.815) [-476.115] (-475.229) (-475.638) -- 0:00:44
342500 -- (-473.879) (-474.767) [-475.332] (-473.756) * (-477.227) [-475.643] (-476.971) (-477.201) -- 0:00:44
343000 -- [-474.162] (-474.579) (-478.353) (-476.925) * (-475.930) (-481.508) (-474.434) [-474.739] -- 0:00:44
343500 -- (-480.645) [-476.723] (-473.171) (-475.708) * (-479.519) [-476.976] (-475.387) (-475.441) -- 0:00:43
344000 -- (-477.405) (-475.718) [-475.883] (-474.041) * (-477.041) [-473.745] (-474.781) (-475.035) -- 0:00:43
344500 -- (-477.534) (-475.339) [-480.913] (-476.475) * (-475.066) [-473.755] (-479.013) (-474.236) -- 0:00:43
345000 -- (-474.136) (-475.549) (-476.020) [-474.608] * (-474.741) [-481.040] (-475.846) (-477.736) -- 0:00:43
Average standard deviation of split frequencies: 0.014154
345500 -- (-476.177) (-474.497) (-473.714) [-480.979] * (-476.148) (-476.366) (-476.375) [-474.670] -- 0:00:43
346000 -- (-474.581) (-473.038) (-473.242) [-474.903] * [-475.207] (-477.645) (-475.173) (-476.027) -- 0:00:43
346500 -- [-475.444] (-474.489) (-478.874) (-474.263) * [-475.106] (-478.616) (-474.167) (-477.614) -- 0:00:43
347000 -- [-475.637] (-475.189) (-475.119) (-480.020) * (-476.131) [-474.777] (-475.311) (-473.976) -- 0:00:43
347500 -- (-476.419) [-474.019] (-475.251) (-476.232) * (-478.606) [-474.295] (-475.288) (-473.873) -- 0:00:43
348000 -- (-474.627) [-473.907] (-482.091) (-473.863) * (-479.138) (-476.709) (-474.779) [-475.327] -- 0:00:43
348500 -- (-475.568) (-473.836) [-475.191] (-475.226) * (-476.284) (-476.063) [-475.536] (-477.526) -- 0:00:42
349000 -- (-476.028) (-477.354) (-477.620) [-475.646] * (-475.103) [-476.693] (-474.648) (-479.721) -- 0:00:42
349500 -- (-475.119) (-477.960) [-474.571] (-474.129) * (-475.425) (-475.087) [-475.130] (-476.551) -- 0:00:42
350000 -- [-476.444] (-479.599) (-475.179) (-473.587) * [-473.271] (-473.997) (-475.685) (-476.601) -- 0:00:42
Average standard deviation of split frequencies: 0.013667
350500 -- (-475.617) (-476.693) [-474.407] (-476.422) * (-478.531) [-474.461] (-476.172) (-477.588) -- 0:00:44
351000 -- [-482.344] (-478.801) (-475.489) (-475.834) * (-478.148) (-474.094) [-474.444] (-475.077) -- 0:00:44
351500 -- (-478.971) (-474.966) (-474.111) [-477.491] * (-474.717) (-474.115) [-474.536] (-477.259) -- 0:00:44
352000 -- (-480.861) [-474.786] (-478.141) (-474.333) * (-475.493) (-475.461) [-475.325] (-477.084) -- 0:00:44
352500 -- (-477.438) [-473.932] (-478.609) (-476.534) * (-473.331) [-479.147] (-474.551) (-474.881) -- 0:00:44
353000 -- (-474.798) [-479.213] (-473.868) (-475.168) * (-477.513) [-477.131] (-473.960) (-474.336) -- 0:00:43
353500 -- (-476.696) [-474.712] (-473.750) (-474.065) * (-477.336) (-476.750) (-473.662) [-473.317] -- 0:00:43
354000 -- [-473.631] (-474.440) (-474.294) (-474.050) * (-473.538) (-475.536) [-474.635] (-475.534) -- 0:00:43
354500 -- (-475.490) (-474.902) (-480.073) [-475.220] * [-473.616] (-475.164) (-476.546) (-475.491) -- 0:00:43
355000 -- (-476.065) (-473.679) [-479.165] (-479.367) * (-474.721) [-475.146] (-479.010) (-479.925) -- 0:00:43
Average standard deviation of split frequencies: 0.013904
355500 -- (-475.999) [-474.780] (-473.704) (-477.474) * (-475.948) (-474.469) [-475.408] (-474.407) -- 0:00:43
356000 -- [-475.539] (-475.891) (-473.438) (-473.673) * (-474.655) [-474.209] (-478.920) (-476.516) -- 0:00:43
356500 -- (-474.597) (-477.008) [-476.340] (-473.912) * (-474.436) [-475.371] (-475.215) (-473.468) -- 0:00:43
357000 -- (-475.817) (-481.520) (-476.118) [-475.251] * (-474.804) (-474.519) [-475.587] (-478.253) -- 0:00:43
357500 -- (-475.443) (-480.318) (-474.503) [-478.347] * (-475.628) [-475.460] (-475.564) (-475.341) -- 0:00:43
358000 -- [-476.048] (-477.171) (-473.721) (-476.166) * (-478.073) [-473.466] (-478.206) (-475.430) -- 0:00:43
358500 -- (-474.238) [-474.268] (-474.955) (-474.248) * (-477.539) [-473.836] (-477.362) (-475.196) -- 0:00:42
359000 -- (-475.359) (-477.810) [-474.445] (-475.839) * (-475.049) [-476.186] (-475.153) (-473.737) -- 0:00:42
359500 -- [-473.168] (-476.400) (-477.658) (-474.778) * (-477.264) (-476.796) (-473.888) [-474.904] -- 0:00:42
360000 -- [-474.911] (-475.754) (-476.725) (-475.654) * [-476.082] (-479.011) (-473.746) (-473.247) -- 0:00:42
Average standard deviation of split frequencies: 0.013506
360500 -- (-475.120) (-475.085) (-475.593) [-474.276] * (-476.559) (-474.158) [-476.015] (-473.855) -- 0:00:42
361000 -- (-476.344) (-475.759) [-475.550] (-475.103) * (-475.107) [-477.216] (-478.443) (-478.821) -- 0:00:42
361500 -- [-477.799] (-477.496) (-479.502) (-473.022) * (-476.987) (-477.057) (-475.864) [-473.481] -- 0:00:42
362000 -- [-478.374] (-478.128) (-474.235) (-473.454) * [-478.162] (-474.282) (-476.401) (-473.912) -- 0:00:42
362500 -- [-474.611] (-476.173) (-475.195) (-473.147) * [-473.160] (-475.559) (-475.728) (-475.814) -- 0:00:42
363000 -- (-473.474) (-475.244) (-474.976) [-473.799] * (-475.729) (-475.765) (-481.550) [-474.626] -- 0:00:42
363500 -- [-473.143] (-480.198) (-475.805) (-475.698) * (-477.395) [-474.896] (-480.641) (-475.890) -- 0:00:42
364000 -- (-473.557) (-474.740) (-473.646) [-473.965] * (-474.718) [-473.888] (-478.273) (-480.124) -- 0:00:41
364500 -- [-474.732] (-475.414) (-473.982) (-479.680) * (-473.973) [-477.053] (-474.613) (-473.217) -- 0:00:41
365000 -- (-474.775) (-473.719) (-476.158) [-475.850] * (-476.215) (-475.161) (-474.448) [-478.764] -- 0:00:41
Average standard deviation of split frequencies: 0.012880
365500 -- (-476.391) (-477.042) (-474.272) [-474.464] * (-480.058) (-477.696) (-476.123) [-477.373] -- 0:00:41
366000 -- (-476.750) (-478.294) [-477.094] (-475.776) * (-475.868) (-475.489) (-474.044) [-475.708] -- 0:00:41
366500 -- [-476.594] (-477.289) (-475.514) (-473.719) * [-474.479] (-474.305) (-476.366) (-474.114) -- 0:00:41
367000 -- (-478.652) [-475.859] (-476.272) (-474.608) * [-476.510] (-475.889) (-474.017) (-474.022) -- 0:00:41
367500 -- (-476.776) [-477.080] (-474.716) (-477.900) * (-475.054) (-476.841) (-473.167) [-475.879] -- 0:00:43
368000 -- (-475.066) (-474.140) (-473.787) [-474.799] * (-480.474) (-477.991) [-473.397] (-476.842) -- 0:00:42
368500 -- [-476.308] (-474.735) (-473.860) (-477.962) * (-477.185) (-476.098) (-474.894) [-473.192] -- 0:00:42
369000 -- (-475.429) (-474.548) (-474.663) [-476.869] * (-474.310) [-480.267] (-475.062) (-473.840) -- 0:00:42
369500 -- (-474.568) (-473.883) (-474.854) [-475.428] * (-474.970) (-474.850) [-476.098] (-475.587) -- 0:00:42
370000 -- [-474.380] (-475.994) (-474.684) (-474.407) * (-473.375) (-474.877) (-476.352) [-475.849] -- 0:00:42
Average standard deviation of split frequencies: 0.013354
370500 -- (-474.206) (-474.023) [-474.305] (-473.775) * (-473.964) (-475.447) (-477.084) [-473.339] -- 0:00:42
371000 -- (-475.475) (-475.224) [-473.083] (-474.261) * (-477.721) (-475.143) [-479.986] (-474.065) -- 0:00:42
371500 -- [-474.863] (-474.906) (-474.970) (-474.071) * (-474.873) [-474.988] (-476.069) (-475.039) -- 0:00:42
372000 -- (-473.932) (-476.279) [-473.926] (-476.156) * (-474.818) (-479.027) (-475.913) [-473.891] -- 0:00:42
372500 -- (-474.451) [-473.656] (-473.562) (-475.090) * [-473.880] (-475.396) (-478.802) (-478.201) -- 0:00:42
373000 -- (-477.756) (-476.858) (-473.553) [-473.901] * (-474.366) (-477.768) [-477.269] (-474.536) -- 0:00:42
373500 -- (-474.916) (-476.816) [-473.442] (-476.217) * (-475.038) [-473.989] (-481.450) (-475.043) -- 0:00:41
374000 -- (-475.341) (-474.151) [-474.176] (-476.244) * (-476.317) [-475.185] (-479.324) (-475.118) -- 0:00:41
374500 -- [-473.289] (-473.528) (-473.483) (-474.189) * (-477.414) (-474.125) [-477.585] (-476.931) -- 0:00:41
375000 -- (-476.577) (-473.769) (-475.467) [-477.893] * [-475.119] (-476.190) (-477.493) (-477.685) -- 0:00:41
Average standard deviation of split frequencies: 0.013304
375500 -- (-474.154) [-474.957] (-475.091) (-473.609) * [-477.031] (-473.636) (-474.570) (-477.250) -- 0:00:41
376000 -- (-476.760) [-475.514] (-475.562) (-473.121) * (-475.188) (-475.062) [-475.409] (-476.905) -- 0:00:41
376500 -- [-474.148] (-474.249) (-476.498) (-476.192) * (-476.559) [-473.507] (-474.909) (-476.895) -- 0:00:41
377000 -- (-474.301) (-473.517) (-473.544) [-474.585] * (-477.458) (-477.490) [-477.177] (-474.287) -- 0:00:41
377500 -- (-473.649) (-474.458) (-474.054) [-476.397] * [-478.687] (-472.906) (-477.921) (-474.374) -- 0:00:41
378000 -- (-475.757) (-476.337) [-477.295] (-476.112) * (-479.808) [-473.764] (-477.644) (-481.777) -- 0:00:41
378500 -- (-474.632) (-474.238) [-475.659] (-480.907) * [-477.230] (-474.736) (-479.397) (-475.098) -- 0:00:41
379000 -- (-475.812) (-473.519) (-479.397) [-474.817] * (-475.392) (-480.031) [-478.770] (-478.355) -- 0:00:40
379500 -- [-475.745] (-475.056) (-477.330) (-475.290) * (-473.397) [-476.163] (-475.824) (-477.861) -- 0:00:40
380000 -- (-473.295) [-474.517] (-479.049) (-479.829) * (-476.843) (-475.813) [-475.606] (-474.981) -- 0:00:40
Average standard deviation of split frequencies: 0.014172
380500 -- (-481.962) (-474.638) (-476.604) [-476.203] * (-475.378) [-477.161] (-476.850) (-475.923) -- 0:00:40
381000 -- (-474.896) (-474.308) (-476.197) [-475.568] * (-479.414) (-475.651) (-478.154) [-477.097] -- 0:00:40
381500 -- (-475.086) [-474.979] (-478.104) (-475.685) * [-473.833] (-475.659) (-479.807) (-475.367) -- 0:00:40
382000 -- [-475.980] (-474.335) (-476.479) (-476.135) * [-475.844] (-474.297) (-476.169) (-475.400) -- 0:00:40
382500 -- (-475.865) (-475.666) (-474.951) [-473.677] * (-475.631) (-479.342) (-475.274) [-476.416] -- 0:00:40
383000 -- (-473.889) (-475.174) [-477.355] (-476.288) * (-476.194) (-478.505) [-474.979] (-478.494) -- 0:00:40
383500 -- (-474.053) (-476.167) [-473.563] (-479.215) * [-475.079] (-473.151) (-475.452) (-475.442) -- 0:00:40
384000 -- (-480.149) (-478.507) [-473.336] (-474.554) * (-477.751) (-475.573) (-475.059) [-476.591] -- 0:00:40
384500 -- (-476.913) (-479.141) [-474.107] (-476.194) * (-478.179) (-481.454) [-475.114] (-476.995) -- 0:00:41
385000 -- [-474.697] (-474.430) (-474.859) (-474.942) * [-474.657] (-474.559) (-475.860) (-476.959) -- 0:00:41
Average standard deviation of split frequencies: 0.014591
385500 -- [-476.316] (-479.561) (-473.704) (-474.409) * (-476.436) [-474.562] (-476.500) (-475.262) -- 0:00:41
386000 -- (-481.002) [-475.570] (-474.301) (-475.391) * [-476.449] (-473.242) (-478.479) (-474.011) -- 0:00:41
386500 -- (-480.315) [-473.745] (-476.412) (-475.658) * (-477.355) (-476.805) [-476.445] (-473.488) -- 0:00:41
387000 -- (-474.666) [-475.565] (-473.929) (-473.679) * (-476.544) (-475.877) [-474.103] (-474.464) -- 0:00:41
387500 -- (-473.988) (-479.380) (-474.812) [-473.568] * (-476.179) (-473.760) (-474.967) [-473.335] -- 0:00:41
388000 -- (-473.320) (-479.062) (-474.223) [-473.973] * (-474.430) (-473.230) (-475.826) [-479.013] -- 0:00:41
388500 -- (-476.782) [-478.084] (-474.683) (-474.742) * [-475.822] (-475.996) (-475.096) (-477.822) -- 0:00:40
389000 -- (-474.797) [-474.751] (-474.074) (-479.966) * [-474.928] (-475.157) (-475.721) (-475.658) -- 0:00:40
389500 -- (-475.027) (-475.748) [-475.612] (-479.582) * [-474.327] (-478.093) (-474.490) (-475.942) -- 0:00:40
390000 -- [-474.192] (-474.579) (-475.108) (-475.356) * (-476.297) (-477.227) (-474.626) [-475.570] -- 0:00:40
Average standard deviation of split frequencies: 0.013527
390500 -- [-475.893] (-474.576) (-475.717) (-476.245) * (-476.825) (-473.521) [-475.444] (-476.197) -- 0:00:40
391000 -- (-477.928) [-474.206] (-474.159) (-475.142) * (-477.006) (-473.635) (-473.354) [-475.492] -- 0:00:40
391500 -- (-476.837) (-476.436) (-477.293) [-474.911] * (-474.192) (-476.930) [-475.803] (-473.840) -- 0:00:40
392000 -- (-473.589) (-476.154) (-475.084) [-473.025] * (-473.330) (-473.131) (-473.915) [-474.682] -- 0:00:40
392500 -- (-477.241) [-475.326] (-477.345) (-478.570) * (-473.728) [-473.151] (-474.508) (-474.873) -- 0:00:40
393000 -- (-477.656) (-474.709) [-473.138] (-476.140) * [-473.854] (-476.789) (-474.258) (-475.451) -- 0:00:40
393500 -- (-474.164) (-475.435) [-474.789] (-477.529) * (-473.659) (-478.278) (-475.486) [-474.008] -- 0:00:40
394000 -- (-474.433) [-474.907] (-477.741) (-475.476) * [-474.160] (-476.611) (-476.830) (-475.839) -- 0:00:39
394500 -- (-475.470) (-476.387) (-476.491) [-476.142] * (-474.077) (-476.732) [-475.047] (-474.329) -- 0:00:39
395000 -- [-479.519] (-479.895) (-475.408) (-482.753) * (-478.963) [-477.522] (-478.935) (-476.285) -- 0:00:39
Average standard deviation of split frequencies: 0.013470
395500 -- (-477.990) (-476.818) (-474.813) [-473.192] * (-475.239) [-473.689] (-473.717) (-480.036) -- 0:00:39
396000 -- (-475.965) (-478.941) [-474.914] (-474.384) * [-476.326] (-478.382) (-474.577) (-479.245) -- 0:00:39
396500 -- (-475.397) (-478.194) (-476.474) [-474.565] * (-477.261) [-475.250] (-473.739) (-474.153) -- 0:00:39
397000 -- [-474.687] (-473.169) (-474.680) (-479.003) * (-478.810) [-474.737] (-473.533) (-475.511) -- 0:00:39
397500 -- (-476.860) [-474.457] (-473.353) (-477.960) * [-473.153] (-482.573) (-476.418) (-477.735) -- 0:00:39
398000 -- (-475.603) (-474.396) (-473.459) [-475.833] * (-474.441) (-474.995) (-477.979) [-473.905] -- 0:00:39
398500 -- (-474.107) [-477.548] (-473.444) (-475.531) * [-474.768] (-473.875) (-475.969) (-474.451) -- 0:00:39
399000 -- (-474.175) [-477.266] (-477.756) (-474.526) * (-474.653) [-475.574] (-477.016) (-475.045) -- 0:00:39
399500 -- (-475.816) [-474.426] (-481.092) (-474.568) * [-475.265] (-478.021) (-478.750) (-475.842) -- 0:00:39
400000 -- (-475.251) (-477.226) (-479.497) [-475.666] * (-474.148) [-474.316] (-478.445) (-475.241) -- 0:00:39
Average standard deviation of split frequencies: 0.013066
400500 -- [-474.536] (-477.221) (-480.185) (-473.622) * [-477.873] (-475.339) (-473.589) (-476.307) -- 0:00:38
401000 -- (-475.205) (-475.837) [-476.826] (-473.513) * (-475.531) (-476.287) (-474.479) [-474.486] -- 0:00:38
401500 -- (-475.211) (-475.635) [-475.421] (-475.262) * (-473.135) (-474.183) (-473.768) [-473.546] -- 0:00:40
402000 -- [-474.512] (-477.214) (-475.346) (-476.656) * (-475.826) (-475.578) [-475.371] (-474.987) -- 0:00:40
402500 -- (-474.661) (-474.607) (-475.419) [-472.940] * (-474.912) (-475.910) (-475.931) [-476.278] -- 0:00:40
403000 -- [-474.018] (-474.069) (-476.103) (-473.698) * (-475.364) [-475.135] (-475.366) (-476.151) -- 0:00:39
403500 -- [-476.734] (-473.737) (-476.226) (-473.652) * (-473.948) (-474.611) [-478.898] (-475.129) -- 0:00:39
404000 -- (-476.533) [-474.178] (-475.458) (-473.683) * (-474.853) (-474.104) (-482.181) [-474.154] -- 0:00:39
404500 -- (-475.412) (-478.760) (-474.018) [-474.399] * (-474.624) (-474.917) (-474.441) [-474.882] -- 0:00:39
405000 -- (-474.151) (-474.174) (-475.909) [-475.296] * [-477.859] (-474.160) (-474.417) (-477.666) -- 0:00:39
Average standard deviation of split frequencies: 0.012466
405500 -- [-476.555] (-474.347) (-474.760) (-475.417) * (-480.443) [-474.599] (-475.199) (-477.423) -- 0:00:39
406000 -- (-473.665) [-480.443] (-475.830) (-474.672) * [-474.223] (-475.111) (-475.977) (-474.121) -- 0:00:39
406500 -- (-474.593) (-473.300) (-473.961) [-473.296] * (-475.527) (-478.034) [-475.959] (-478.417) -- 0:00:39
407000 -- (-474.337) (-477.168) (-474.281) [-475.550] * [-476.490] (-476.179) (-474.857) (-475.805) -- 0:00:39
407500 -- (-475.139) (-476.201) [-474.597] (-476.039) * [-476.834] (-474.677) (-473.664) (-476.732) -- 0:00:39
408000 -- (-474.080) [-473.095] (-476.450) (-474.890) * [-476.074] (-475.059) (-473.650) (-475.612) -- 0:00:39
408500 -- [-478.761] (-476.672) (-474.717) (-476.763) * [-474.997] (-473.395) (-476.166) (-475.705) -- 0:00:39
409000 -- (-480.116) (-475.118) (-474.505) [-476.959] * (-474.223) (-476.638) [-473.470] (-473.902) -- 0:00:39
409500 -- (-475.455) (-473.388) [-473.898] (-477.253) * (-476.586) [-474.392] (-474.584) (-475.334) -- 0:00:38
410000 -- (-483.490) (-476.253) (-473.972) [-474.900] * [-473.558] (-474.765) (-473.926) (-475.528) -- 0:00:38
Average standard deviation of split frequencies: 0.012687
410500 -- (-476.708) (-474.832) [-474.705] (-475.105) * (-474.102) (-474.330) (-473.392) [-473.124] -- 0:00:38
411000 -- (-475.327) (-474.896) [-476.952] (-476.725) * (-473.711) (-473.745) [-474.566] (-474.054) -- 0:00:38
411500 -- (-474.918) (-474.493) [-476.453] (-475.177) * (-475.747) (-476.302) [-473.596] (-473.064) -- 0:00:38
412000 -- [-474.618] (-479.675) (-475.628) (-476.316) * (-474.105) (-477.991) [-476.607] (-473.537) -- 0:00:38
412500 -- (-475.094) (-481.597) [-475.264] (-474.828) * [-477.307] (-476.320) (-474.966) (-475.866) -- 0:00:38
413000 -- (-474.696) [-477.712] (-475.054) (-475.168) * [-475.352] (-474.223) (-474.610) (-473.828) -- 0:00:38
413500 -- [-474.077] (-474.321) (-475.835) (-476.915) * (-474.240) (-474.301) [-477.028] (-475.318) -- 0:00:38
414000 -- (-476.979) (-473.583) (-478.062) [-475.853] * (-475.494) (-473.924) [-476.249] (-476.111) -- 0:00:38
414500 -- (-476.272) [-473.559] (-473.471) (-473.736) * (-474.106) (-475.474) (-474.694) [-474.829] -- 0:00:38
415000 -- (-475.165) [-475.438] (-474.919) (-475.986) * (-475.234) (-473.850) (-476.063) [-475.340] -- 0:00:38
Average standard deviation of split frequencies: 0.012465
415500 -- (-474.766) (-474.816) (-476.596) [-476.727] * (-474.920) [-478.426] (-475.256) (-473.823) -- 0:00:37
416000 -- (-475.501) [-474.817] (-475.714) (-477.415) * (-477.487) (-474.240) [-474.770] (-474.566) -- 0:00:37
416500 -- (-475.519) [-476.131] (-475.256) (-474.506) * (-477.694) (-475.735) [-474.637] (-476.665) -- 0:00:37
417000 -- (-475.148) (-478.311) (-475.142) [-475.578] * (-477.346) (-475.199) [-473.697] (-477.346) -- 0:00:37
417500 -- (-476.523) (-476.095) [-475.681] (-475.684) * (-475.317) (-475.430) [-475.561] (-476.129) -- 0:00:37
418000 -- (-475.431) [-478.879] (-473.458) (-476.681) * (-479.296) (-475.534) (-474.705) [-475.359] -- 0:00:38
418500 -- [-474.047] (-480.139) (-482.516) (-476.898) * (-475.108) (-476.601) (-474.153) [-478.100] -- 0:00:38
419000 -- (-473.484) (-475.822) [-480.217] (-475.062) * (-475.435) (-474.592) [-477.368] (-474.755) -- 0:00:38
419500 -- (-474.107) (-480.410) (-476.038) [-477.509] * (-474.193) (-474.106) (-483.012) [-474.452] -- 0:00:38
420000 -- [-475.196] (-485.807) (-475.531) (-476.995) * [-475.960] (-479.325) (-479.659) (-474.784) -- 0:00:38
Average standard deviation of split frequencies: 0.012078
420500 -- (-475.652) (-480.291) [-475.708] (-477.979) * (-475.264) [-478.446] (-476.024) (-474.993) -- 0:00:38
421000 -- [-473.467] (-475.684) (-479.176) (-479.146) * (-479.356) [-479.401] (-474.279) (-476.177) -- 0:00:38
421500 -- (-475.840) (-474.690) [-476.324] (-478.686) * [-476.630] (-474.687) (-478.387) (-474.379) -- 0:00:38
422000 -- (-477.869) (-482.260) [-475.236] (-476.996) * (-474.148) (-473.179) [-475.232] (-474.356) -- 0:00:38
422500 -- (-474.767) (-477.228) (-474.943) [-474.901] * (-473.407) (-475.748) [-473.802] (-475.283) -- 0:00:38
423000 -- (-474.284) [-474.262] (-475.368) (-477.781) * (-475.833) [-475.698] (-476.993) (-474.737) -- 0:00:38
423500 -- (-474.136) (-475.305) [-477.373] (-479.433) * (-477.866) (-476.083) (-478.431) [-480.173] -- 0:00:38
424000 -- (-475.368) (-474.882) (-477.648) [-473.759] * (-475.242) (-475.337) (-477.928) [-474.585] -- 0:00:38
424500 -- (-473.074) (-474.746) (-474.871) [-475.940] * (-474.294) [-473.287] (-478.872) (-474.507) -- 0:00:37
425000 -- (-473.948) (-475.365) (-474.881) [-473.632] * [-477.092] (-475.015) (-478.684) (-475.903) -- 0:00:37
Average standard deviation of split frequencies: 0.011435
425500 -- (-473.291) [-474.514] (-473.495) (-473.783) * [-475.968] (-476.822) (-474.011) (-474.506) -- 0:00:37
426000 -- (-475.924) [-474.126] (-474.027) (-475.282) * (-475.398) (-474.738) (-474.970) [-473.604] -- 0:00:37
426500 -- (-479.687) (-474.543) [-473.311] (-475.000) * (-475.178) (-479.355) [-476.888] (-475.392) -- 0:00:37
427000 -- (-478.056) (-477.116) [-474.557] (-474.168) * [-479.749] (-474.883) (-478.030) (-473.878) -- 0:00:37
427500 -- (-473.871) (-475.950) [-476.392] (-478.226) * (-478.580) (-479.757) (-476.474) [-477.028] -- 0:00:37
428000 -- (-479.321) (-474.664) (-475.004) [-476.690] * (-476.353) (-474.536) [-474.409] (-476.689) -- 0:00:37
428500 -- [-475.463] (-474.427) (-473.726) (-474.765) * (-476.825) [-472.980] (-475.173) (-473.399) -- 0:00:37
429000 -- (-482.472) (-474.182) [-473.153] (-473.622) * (-473.475) (-473.730) [-476.113] (-473.532) -- 0:00:37
429500 -- [-476.899] (-474.740) (-474.115) (-478.453) * (-477.026) [-476.525] (-478.869) (-478.046) -- 0:00:37
430000 -- (-477.799) [-476.574] (-479.878) (-475.510) * (-481.363) (-475.726) [-478.712] (-474.688) -- 0:00:37
Average standard deviation of split frequencies: 0.011432
430500 -- (-473.533) (-479.434) [-478.209] (-474.808) * (-477.994) (-476.121) [-475.472] (-474.778) -- 0:00:37
431000 -- (-474.898) (-473.892) (-478.097) [-478.963] * [-474.790] (-479.513) (-475.954) (-477.396) -- 0:00:36
431500 -- [-473.683] (-473.691) (-476.397) (-478.562) * (-475.312) (-476.028) [-477.066] (-477.711) -- 0:00:36
432000 -- (-474.194) (-474.202) [-475.617] (-476.672) * (-484.297) (-477.260) [-474.651] (-477.271) -- 0:00:36
432500 -- (-473.740) (-474.343) (-476.673) [-475.209] * (-474.800) [-475.125] (-475.603) (-475.302) -- 0:00:36
433000 -- (-477.089) (-475.945) (-478.634) [-478.158] * (-473.962) [-474.977] (-474.259) (-478.992) -- 0:00:36
433500 -- [-474.219] (-474.821) (-473.695) (-478.619) * [-476.197] (-475.583) (-474.405) (-473.456) -- 0:00:36
434000 -- (-474.653) [-474.574] (-473.876) (-476.089) * (-474.582) (-477.231) (-473.936) [-473.102] -- 0:00:36
434500 -- (-478.094) (-476.135) [-477.228] (-480.873) * (-475.038) [-473.239] (-473.861) (-474.317) -- 0:00:37
435000 -- (-479.112) [-477.195] (-473.558) (-473.962) * (-474.492) [-475.425] (-474.617) (-474.872) -- 0:00:37
Average standard deviation of split frequencies: 0.012013
435500 -- [-475.179] (-476.920) (-476.968) (-474.560) * [-476.280] (-477.417) (-475.115) (-475.516) -- 0:00:37
436000 -- (-474.734) (-476.547) (-475.471) [-474.681] * [-474.305] (-477.078) (-475.318) (-474.355) -- 0:00:37
436500 -- [-475.376] (-476.403) (-476.884) (-475.582) * (-476.548) [-475.025] (-475.024) (-472.863) -- 0:00:37
437000 -- [-475.381] (-477.165) (-475.932) (-473.516) * (-474.554) [-474.087] (-476.493) (-475.632) -- 0:00:37
437500 -- (-476.121) (-477.941) [-474.808] (-473.399) * [-476.001] (-476.187) (-474.624) (-476.756) -- 0:00:37
438000 -- (-478.312) (-479.307) (-473.418) [-476.092] * [-475.150] (-476.641) (-475.975) (-476.479) -- 0:00:37
438500 -- (-477.410) (-475.086) (-473.984) [-477.254] * (-473.129) (-474.806) [-475.351] (-474.433) -- 0:00:37
439000 -- (-476.958) (-473.241) [-474.669] (-473.976) * (-473.518) (-473.986) (-475.691) [-474.648] -- 0:00:37
439500 -- (-475.676) (-482.105) [-473.223] (-475.514) * [-474.352] (-474.453) (-475.701) (-476.868) -- 0:00:36
440000 -- (-475.825) [-474.486] (-474.674) (-476.361) * (-476.427) (-474.699) (-475.041) [-477.497] -- 0:00:36
Average standard deviation of split frequencies: 0.012480
440500 -- (-475.511) [-475.932] (-474.969) (-480.810) * (-477.133) (-474.869) [-479.530] (-474.146) -- 0:00:36
441000 -- [-477.793] (-476.730) (-475.243) (-474.582) * (-476.526) [-472.977] (-476.450) (-473.357) -- 0:00:36
441500 -- (-475.199) [-474.208] (-474.247) (-474.978) * (-476.870) (-474.724) [-475.445] (-473.956) -- 0:00:36
442000 -- (-476.522) (-473.635) (-473.934) [-479.000] * [-476.494] (-478.592) (-478.633) (-473.386) -- 0:00:36
442500 -- (-477.090) (-479.502) (-473.472) [-478.032] * (-473.498) (-474.746) (-475.364) [-474.606] -- 0:00:36
443000 -- [-476.365] (-473.873) (-476.138) (-473.939) * (-473.645) (-475.823) (-474.624) [-475.577] -- 0:00:36
443500 -- (-473.142) [-478.269] (-475.534) (-475.094) * (-477.255) [-475.250] (-473.344) (-479.675) -- 0:00:36
444000 -- (-473.293) (-474.979) (-475.313) [-475.295] * [-475.224] (-475.844) (-477.535) (-474.553) -- 0:00:36
444500 -- (-474.409) (-479.356) [-475.273] (-476.124) * (-473.695) [-475.478] (-477.747) (-475.403) -- 0:00:36
445000 -- (-475.437) (-478.346) (-475.311) [-473.982] * [-473.793] (-477.404) (-475.189) (-474.419) -- 0:00:36
Average standard deviation of split frequencies: 0.012625
445500 -- (-474.669) (-474.519) (-476.461) [-475.840] * (-475.972) [-474.708] (-473.929) (-475.973) -- 0:00:36
446000 -- (-475.474) [-473.820] (-475.743) (-473.432) * (-478.263) (-475.164) [-476.121] (-476.773) -- 0:00:36
446500 -- (-479.052) (-476.953) [-475.180] (-479.775) * (-475.209) (-473.376) (-478.570) [-476.604] -- 0:00:35
447000 -- (-477.454) (-480.165) [-473.531] (-475.880) * [-474.095] (-475.288) (-475.846) (-474.601) -- 0:00:35
447500 -- (-476.113) (-475.530) (-477.365) [-474.343] * (-478.144) (-474.273) [-474.705] (-473.887) -- 0:00:35
448000 -- (-477.642) [-475.937] (-477.559) (-474.614) * (-474.928) (-480.709) [-477.552] (-474.909) -- 0:00:35
448500 -- (-473.892) (-477.487) (-479.741) [-473.120] * (-476.204) (-475.359) (-475.231) [-475.524] -- 0:00:35
449000 -- (-473.556) (-473.922) (-475.480) [-475.280] * (-474.073) (-476.982) (-474.514) [-474.014] -- 0:00:35
449500 -- (-480.488) (-477.160) (-477.115) [-476.947] * (-477.299) (-477.380) (-473.868) [-474.186] -- 0:00:35
450000 -- (-475.531) (-474.369) (-474.242) [-479.752] * (-475.343) [-474.289] (-473.688) (-476.847) -- 0:00:35
Average standard deviation of split frequencies: 0.012494
450500 -- (-473.520) (-476.988) [-473.447] (-477.510) * [-480.139] (-476.911) (-476.300) (-476.667) -- 0:00:35
451000 -- (-473.340) [-477.091] (-477.060) (-476.117) * [-475.069] (-474.129) (-475.451) (-475.874) -- 0:00:36
451500 -- [-474.530] (-474.516) (-477.446) (-474.188) * [-474.953] (-474.299) (-477.225) (-474.562) -- 0:00:36
452000 -- [-474.761] (-476.621) (-475.260) (-478.542) * (-475.660) [-475.322] (-475.354) (-474.954) -- 0:00:36
452500 -- [-475.773] (-475.632) (-474.042) (-477.254) * (-473.791) [-475.621] (-476.679) (-473.551) -- 0:00:36
453000 -- (-476.193) (-473.883) [-479.693] (-475.646) * (-477.247) (-476.173) [-474.766] (-476.276) -- 0:00:36
453500 -- (-478.125) (-476.735) (-473.731) [-476.257] * (-474.574) (-473.801) [-477.197] (-476.135) -- 0:00:36
454000 -- (-476.296) (-475.635) [-473.605] (-475.454) * (-478.150) (-473.658) [-474.978] (-475.147) -- 0:00:36
454500 -- (-476.556) [-475.298] (-476.134) (-473.576) * (-476.970) (-473.722) (-476.569) [-475.905] -- 0:00:36
455000 -- (-475.802) [-478.071] (-473.580) (-473.809) * (-474.485) [-474.232] (-475.058) (-474.129) -- 0:00:35
Average standard deviation of split frequencies: 0.011601
455500 -- (-475.465) [-478.134] (-475.083) (-476.429) * (-478.116) (-478.957) [-473.434] (-474.504) -- 0:00:35
456000 -- (-474.598) (-475.715) [-476.633] (-473.483) * [-475.198] (-480.792) (-473.656) (-474.383) -- 0:00:35
456500 -- [-474.744] (-476.322) (-474.020) (-481.393) * (-478.414) (-473.421) [-474.501] (-475.287) -- 0:00:35
457000 -- (-475.735) [-474.212] (-477.334) (-477.874) * (-478.075) (-474.711) (-474.346) [-477.469] -- 0:00:35
457500 -- (-475.422) (-474.701) [-475.554] (-477.572) * (-473.048) (-475.770) (-478.390) [-477.104] -- 0:00:35
458000 -- [-479.931] (-475.049) (-473.060) (-478.864) * [-476.227] (-475.633) (-476.521) (-476.783) -- 0:00:35
458500 -- (-478.108) [-476.619] (-477.092) (-482.406) * (-474.970) [-474.663] (-478.890) (-474.138) -- 0:00:35
459000 -- (-478.205) [-473.785] (-480.334) (-475.632) * (-474.030) [-475.710] (-474.693) (-474.649) -- 0:00:35
459500 -- [-476.550] (-474.977) (-479.473) (-474.648) * (-474.401) (-479.571) (-474.418) [-473.987] -- 0:00:35
460000 -- (-478.074) [-474.102] (-478.165) (-474.651) * (-474.750) [-475.137] (-478.110) (-474.301) -- 0:00:35
Average standard deviation of split frequencies: 0.012507
460500 -- (-477.918) (-474.628) (-474.705) [-475.008] * [-476.100] (-476.099) (-476.460) (-475.035) -- 0:00:35
461000 -- (-474.300) [-474.749] (-476.582) (-477.441) * (-475.720) (-480.983) (-476.286) [-479.743] -- 0:00:35
461500 -- (-474.823) (-474.274) [-473.352] (-477.761) * [-476.745] (-477.007) (-473.555) (-475.688) -- 0:00:35
462000 -- (-477.082) (-477.205) [-476.619] (-474.151) * (-475.589) [-475.870] (-474.389) (-474.486) -- 0:00:34
462500 -- [-474.088] (-474.992) (-476.012) (-475.979) * (-474.624) (-473.598) [-477.791] (-477.329) -- 0:00:34
463000 -- (-475.113) [-477.771] (-477.088) (-473.621) * (-475.493) (-473.627) (-477.022) [-474.968] -- 0:00:34
463500 -- (-478.533) [-477.380] (-475.603) (-475.150) * (-480.246) (-474.342) (-474.317) [-474.990] -- 0:00:34
464000 -- (-476.034) (-473.251) (-474.154) [-475.362] * (-477.662) (-474.097) [-477.059] (-477.717) -- 0:00:34
464500 -- (-473.397) [-473.502] (-477.951) (-475.588) * (-477.015) (-473.819) [-474.785] (-480.330) -- 0:00:34
465000 -- [-474.814] (-473.502) (-476.005) (-475.229) * (-475.171) (-474.353) (-474.825) [-477.008] -- 0:00:34
Average standard deviation of split frequencies: 0.012870
465500 -- (-475.805) (-473.035) [-474.345] (-477.467) * [-473.072] (-474.688) (-475.990) (-479.223) -- 0:00:34
466000 -- (-476.063) (-473.997) [-475.428] (-480.431) * (-474.658) (-477.326) [-476.394] (-475.626) -- 0:00:34
466500 -- (-477.814) [-475.970] (-473.286) (-479.080) * (-476.305) (-480.065) (-475.947) [-474.019] -- 0:00:34
467000 -- (-475.525) [-475.864] (-473.823) (-476.330) * [-474.949] (-480.449) (-478.144) (-474.745) -- 0:00:34
467500 -- (-477.953) [-478.135] (-477.521) (-473.357) * (-475.470) (-478.846) [-476.241] (-475.829) -- 0:00:34
468000 -- (-480.025) [-478.054] (-475.195) (-477.403) * (-474.755) (-473.465) (-476.757) [-475.721] -- 0:00:35
468500 -- [-474.988] (-477.950) (-477.023) (-473.929) * (-478.611) (-474.676) (-473.626) [-475.829] -- 0:00:35
469000 -- [-476.666] (-474.854) (-478.046) (-475.331) * [-474.618] (-476.280) (-476.767) (-478.439) -- 0:00:35
469500 -- (-475.978) (-476.751) [-476.785] (-475.521) * (-474.999) [-474.100] (-481.494) (-478.103) -- 0:00:35
470000 -- (-476.451) [-473.721] (-473.505) (-475.579) * (-475.076) [-474.245] (-476.882) (-478.095) -- 0:00:34
Average standard deviation of split frequencies: 0.012078
470500 -- (-477.885) (-476.628) [-474.179] (-473.139) * [-475.190] (-473.831) (-482.300) (-475.784) -- 0:00:34
471000 -- [-474.792] (-476.352) (-474.274) (-474.264) * [-474.459] (-476.702) (-473.978) (-478.753) -- 0:00:34
471500 -- (-476.028) [-472.960] (-475.910) (-474.695) * [-479.851] (-475.900) (-475.446) (-479.197) -- 0:00:34
472000 -- (-474.545) [-475.229] (-477.811) (-480.867) * [-475.643] (-474.960) (-474.187) (-474.716) -- 0:00:34
472500 -- (-475.020) [-474.343] (-474.233) (-477.502) * (-481.629) (-474.862) (-477.655) [-475.106] -- 0:00:34
473000 -- [-475.056] (-473.810) (-474.738) (-480.575) * (-476.834) [-473.866] (-476.728) (-475.644) -- 0:00:34
473500 -- [-476.993] (-474.910) (-474.276) (-476.114) * (-476.013) (-475.703) [-474.650] (-478.661) -- 0:00:34
474000 -- (-474.357) (-477.295) (-476.123) [-476.315] * (-474.024) (-477.444) (-480.556) [-475.490] -- 0:00:34
474500 -- (-475.576) [-476.597] (-475.105) (-477.489) * [-474.935] (-477.711) (-476.076) (-474.241) -- 0:00:34
475000 -- (-474.074) (-474.195) [-475.738] (-477.456) * (-475.293) [-474.824] (-474.343) (-475.019) -- 0:00:34
Average standard deviation of split frequencies: 0.011651
475500 -- (-474.371) (-477.729) [-475.000] (-476.078) * [-478.843] (-475.413) (-478.627) (-473.653) -- 0:00:34
476000 -- [-477.207] (-482.397) (-475.212) (-478.143) * [-476.450] (-483.375) (-479.268) (-476.427) -- 0:00:34
476500 -- [-475.408] (-473.630) (-474.798) (-474.821) * (-477.158) (-473.785) (-475.643) [-475.098] -- 0:00:34
477000 -- (-478.595) [-474.290] (-477.047) (-477.361) * [-476.355] (-473.689) (-476.646) (-476.867) -- 0:00:33
477500 -- (-478.221) (-473.387) [-479.897] (-477.837) * (-473.874) (-476.210) [-473.539] (-477.948) -- 0:00:33
478000 -- (-476.070) (-476.247) [-473.624] (-473.843) * (-475.029) [-477.664] (-478.502) (-473.860) -- 0:00:33
478500 -- [-478.940] (-476.624) (-474.322) (-474.973) * (-474.802) (-475.540) (-474.518) [-473.955] -- 0:00:33
479000 -- (-477.939) (-474.745) (-476.029) [-478.614] * (-475.470) (-475.816) [-474.893] (-474.327) -- 0:00:33
479500 -- (-482.603) [-473.428] (-473.458) (-478.770) * (-475.588) (-480.996) (-476.201) [-474.605] -- 0:00:33
480000 -- (-480.479) (-476.125) (-474.601) [-475.784] * (-473.627) (-479.346) [-474.905] (-479.876) -- 0:00:33
Average standard deviation of split frequencies: 0.011019
480500 -- (-476.627) (-477.526) [-473.855] (-475.920) * (-480.777) (-475.419) [-474.052] (-478.675) -- 0:00:33
481000 -- (-475.700) (-473.755) (-477.226) [-474.157] * [-476.449] (-474.080) (-475.904) (-476.906) -- 0:00:33
481500 -- (-479.422) (-474.993) (-473.456) [-474.487] * (-474.387) (-474.148) (-473.702) [-474.463] -- 0:00:33
482000 -- (-477.720) (-475.848) (-473.548) [-474.267] * (-475.330) [-474.768] (-476.327) (-479.543) -- 0:00:33
482500 -- (-477.798) [-476.564] (-474.248) (-473.303) * (-473.135) (-476.144) (-480.986) [-477.180] -- 0:00:33
483000 -- (-477.726) [-474.115] (-477.832) (-473.558) * (-481.705) (-476.037) (-477.487) [-475.172] -- 0:00:33
483500 -- (-475.079) [-473.707] (-474.233) (-475.287) * (-475.831) (-474.590) [-474.160] (-477.940) -- 0:00:33
484000 -- (-473.387) (-476.031) (-475.773) [-476.793] * [-474.273] (-475.419) (-474.537) (-474.669) -- 0:00:33
484500 -- (-475.974) (-478.140) (-476.758) [-477.041] * [-473.227] (-475.351) (-474.331) (-474.126) -- 0:00:32
485000 -- [-473.561] (-474.701) (-477.263) (-475.321) * (-474.740) (-474.613) [-474.683] (-474.279) -- 0:00:33
Average standard deviation of split frequencies: 0.011126
485500 -- (-473.885) [-474.592] (-473.634) (-476.590) * (-474.038) [-475.663] (-476.556) (-476.504) -- 0:00:33
486000 -- [-474.424] (-473.493) (-474.122) (-476.409) * (-475.430) (-477.131) [-474.151] (-476.030) -- 0:00:33
486500 -- [-473.111] (-475.733) (-475.237) (-474.698) * (-475.528) (-474.768) [-473.977] (-474.998) -- 0:00:33
487000 -- (-474.333) [-474.631] (-476.979) (-474.110) * [-474.979] (-477.793) (-476.214) (-476.003) -- 0:00:33
487500 -- (-473.122) [-473.701] (-475.577) (-477.247) * (-474.147) [-476.496] (-474.478) (-474.943) -- 0:00:33
488000 -- (-474.350) (-476.680) [-474.218] (-475.218) * (-487.155) [-474.489] (-473.573) (-473.297) -- 0:00:33
488500 -- (-478.959) (-475.088) (-475.623) [-476.391] * (-477.356) [-474.674] (-477.763) (-474.529) -- 0:00:33
489000 -- (-478.165) [-474.792] (-474.331) (-478.545) * (-480.730) (-474.875) (-475.848) [-475.587] -- 0:00:33
489500 -- (-478.755) [-475.027] (-475.644) (-479.027) * (-478.666) [-475.168] (-476.761) (-475.786) -- 0:00:33
490000 -- (-477.199) [-475.940] (-474.570) (-473.160) * (-479.519) (-476.147) (-477.202) [-475.065] -- 0:00:33
Average standard deviation of split frequencies: 0.011303
490500 -- (-477.422) [-474.639] (-473.889) (-481.418) * (-473.596) [-474.990] (-478.548) (-478.308) -- 0:00:33
491000 -- [-475.803] (-475.498) (-473.682) (-475.444) * (-474.414) (-474.014) (-473.881) [-476.424] -- 0:00:33
491500 -- [-474.648] (-475.666) (-476.565) (-477.122) * (-475.736) [-475.612] (-478.492) (-486.904) -- 0:00:33
492000 -- (-474.829) (-477.938) (-474.690) [-474.510] * (-476.001) [-473.616] (-475.252) (-475.762) -- 0:00:33
492500 -- (-474.746) (-474.094) (-475.976) [-474.816] * (-474.613) (-473.961) [-476.069] (-473.636) -- 0:00:32
493000 -- (-474.188) [-473.658] (-476.354) (-476.488) * [-474.302] (-473.653) (-473.449) (-474.524) -- 0:00:32
493500 -- [-474.733] (-473.490) (-477.269) (-475.784) * (-474.811) (-476.694) [-474.739] (-474.665) -- 0:00:32
494000 -- (-474.277) (-475.209) (-474.545) [-473.177] * [-474.285] (-477.005) (-477.157) (-477.839) -- 0:00:32
494500 -- (-474.174) [-482.652] (-476.579) (-475.809) * (-477.110) (-479.879) [-475.262] (-475.390) -- 0:00:32
495000 -- (-475.890) (-478.568) (-475.170) [-475.209] * (-474.913) [-476.254] (-480.960) (-477.425) -- 0:00:32
Average standard deviation of split frequencies: 0.011237
495500 -- (-475.165) (-478.881) (-475.326) [-475.437] * [-474.537] (-475.008) (-476.701) (-476.303) -- 0:00:32
496000 -- (-475.349) [-475.495] (-475.464) (-474.802) * (-474.595) (-484.173) [-476.105] (-474.945) -- 0:00:32
496500 -- (-474.713) (-474.305) (-474.035) [-475.177] * (-473.599) (-477.522) (-477.312) [-477.673] -- 0:00:32
497000 -- (-476.218) (-478.896) (-474.431) [-474.248] * [-476.094] (-479.536) (-476.282) (-477.950) -- 0:00:32
497500 -- [-480.221] (-476.747) (-477.157) (-479.771) * [-474.295] (-481.816) (-476.084) (-476.160) -- 0:00:32
498000 -- (-482.912) (-474.482) (-475.139) [-478.823] * (-472.996) (-474.076) (-475.217) [-475.134] -- 0:00:32
498500 -- (-473.919) (-478.463) [-475.513] (-473.742) * [-473.351] (-473.780) (-475.830) (-477.194) -- 0:00:32
499000 -- (-474.216) (-476.868) (-473.807) [-474.586] * (-473.397) (-474.162) (-477.573) [-474.455] -- 0:00:32
499500 -- [-474.812] (-475.431) (-475.148) (-476.429) * (-473.650) (-474.277) [-474.098] (-476.236) -- 0:00:32
500000 -- (-474.476) [-474.469] (-477.652) (-474.038) * (-473.147) [-474.914] (-473.031) (-477.546) -- 0:00:32
Average standard deviation of split frequencies: 0.011077
500500 -- (-475.804) (-475.337) [-479.128] (-473.443) * [-474.630] (-474.686) (-478.964) (-473.607) -- 0:00:31
501000 -- (-479.990) (-474.393) (-474.392) [-475.534] * (-475.530) [-475.429] (-475.033) (-475.163) -- 0:00:31
501500 -- (-480.043) (-474.142) [-475.209] (-476.280) * [-477.727] (-474.349) (-473.363) (-475.578) -- 0:00:31
502000 -- [-478.505] (-473.428) (-477.677) (-476.802) * (-475.178) (-474.919) (-472.993) [-474.512] -- 0:00:32
502500 -- (-476.432) [-475.108] (-476.159) (-477.351) * (-479.395) [-474.764] (-473.543) (-474.123) -- 0:00:32
503000 -- (-478.291) (-476.253) [-475.949] (-475.726) * (-476.680) (-474.439) (-474.432) [-474.315] -- 0:00:32
503500 -- (-476.590) [-474.865] (-475.962) (-473.688) * (-476.091) (-474.632) [-474.960] (-477.184) -- 0:00:32
504000 -- [-475.115] (-476.770) (-473.419) (-473.571) * (-476.569) (-473.977) [-475.195] (-474.163) -- 0:00:32
504500 -- (-479.332) [-477.554] (-477.932) (-474.000) * (-476.272) [-475.987] (-475.148) (-474.431) -- 0:00:32
505000 -- (-476.360) [-475.753] (-476.753) (-475.282) * (-473.540) [-473.741] (-473.838) (-478.423) -- 0:00:32
Average standard deviation of split frequencies: 0.010851
505500 -- [-475.460] (-475.565) (-476.317) (-473.549) * [-473.599] (-474.927) (-475.940) (-475.198) -- 0:00:32
506000 -- (-475.087) (-479.461) [-476.562] (-474.086) * (-476.149) (-477.060) (-474.851) [-474.627] -- 0:00:32
506500 -- (-475.327) (-475.663) [-476.438] (-473.764) * (-477.492) (-476.632) [-474.236] (-479.716) -- 0:00:32
507000 -- (-477.074) (-478.740) [-474.347] (-476.000) * [-474.750] (-473.729) (-475.962) (-477.006) -- 0:00:32
507500 -- [-474.995] (-475.908) (-473.659) (-476.779) * (-477.907) (-477.478) (-476.357) [-476.401] -- 0:00:32
508000 -- [-475.864] (-478.024) (-474.115) (-474.936) * (-479.875) [-473.298] (-475.708) (-473.539) -- 0:00:31
508500 -- (-474.843) (-474.787) [-474.197] (-474.874) * (-476.503) (-475.290) [-473.453] (-478.075) -- 0:00:31
509000 -- [-474.268] (-473.823) (-474.516) (-473.705) * (-476.151) [-473.973] (-478.501) (-477.462) -- 0:00:31
509500 -- (-475.585) (-474.187) (-476.442) [-476.841] * (-474.768) [-474.250] (-476.318) (-477.294) -- 0:00:31
510000 -- (-475.474) [-477.615] (-475.335) (-473.365) * (-474.603) (-485.243) (-475.063) [-475.071] -- 0:00:31
Average standard deviation of split frequencies: 0.010317
510500 -- (-473.605) [-474.209] (-474.138) (-473.218) * (-475.117) [-476.649] (-475.776) (-475.888) -- 0:00:31
511000 -- (-473.664) (-475.033) (-475.111) [-475.141] * [-475.749] (-473.509) (-480.066) (-477.111) -- 0:00:31
511500 -- [-475.849] (-473.128) (-476.327) (-476.742) * (-476.609) (-476.895) (-476.170) [-475.312] -- 0:00:31
512000 -- (-475.191) (-473.296) [-474.918] (-474.421) * [-473.758] (-477.197) (-474.200) (-477.185) -- 0:00:31
512500 -- (-476.155) (-474.469) (-477.590) [-474.576] * (-474.499) (-477.611) (-474.587) [-474.457] -- 0:00:31
513000 -- [-474.226] (-475.846) (-477.566) (-473.926) * (-474.771) [-477.640] (-473.618) (-474.954) -- 0:00:31
513500 -- (-476.861) (-474.252) [-480.441] (-474.470) * (-474.938) (-476.830) (-474.871) [-474.124] -- 0:00:31
514000 -- [-474.197] (-478.565) (-476.431) (-478.255) * (-473.943) (-475.524) [-473.897] (-481.290) -- 0:00:31
514500 -- (-474.623) (-475.883) (-476.307) [-474.899] * (-476.850) (-476.849) [-473.983] (-475.446) -- 0:00:31
515000 -- [-473.548] (-473.743) (-477.280) (-475.136) * [-476.977] (-473.807) (-476.813) (-476.339) -- 0:00:31
Average standard deviation of split frequencies: 0.009996
515500 -- (-476.757) (-473.715) (-477.680) [-474.792] * (-475.856) [-480.344] (-477.326) (-476.857) -- 0:00:31
516000 -- (-475.070) (-473.222) (-474.975) [-475.658] * (-475.214) (-476.488) [-474.941] (-476.107) -- 0:00:30
516500 -- [-473.557] (-475.926) (-476.153) (-474.055) * (-475.797) [-477.251] (-475.349) (-474.567) -- 0:00:30
517000 -- (-475.048) (-479.145) (-473.559) [-473.847] * (-476.151) [-478.986] (-476.811) (-474.660) -- 0:00:30
517500 -- [-477.410] (-473.939) (-474.447) (-474.654) * [-476.245] (-473.929) (-474.074) (-477.371) -- 0:00:30
518000 -- (-473.485) (-475.251) (-474.909) [-474.706] * (-476.964) (-474.366) [-474.775] (-474.726) -- 0:00:30
518500 -- [-474.374] (-473.942) (-474.335) (-474.255) * (-474.451) (-476.269) (-474.989) [-474.709] -- 0:00:31
519000 -- (-473.998) (-478.012) (-474.526) [-474.264] * (-476.261) [-474.734] (-476.049) (-475.887) -- 0:00:31
519500 -- (-475.112) [-475.495] (-473.786) (-473.692) * (-477.031) (-474.335) (-474.256) [-474.635] -- 0:00:31
520000 -- (-474.669) [-481.416] (-473.674) (-476.781) * (-476.390) (-474.426) (-478.286) [-476.114] -- 0:00:31
Average standard deviation of split frequencies: 0.010439
520500 -- [-474.219] (-478.475) (-476.366) (-475.253) * [-475.590] (-473.973) (-477.947) (-475.866) -- 0:00:31
521000 -- (-475.559) (-473.738) (-474.045) [-474.217] * (-477.080) (-474.548) (-475.720) [-474.611] -- 0:00:31
521500 -- (-475.334) [-476.499] (-476.029) (-476.020) * [-474.404] (-474.691) (-480.295) (-473.331) -- 0:00:31
522000 -- (-474.194) (-474.644) (-478.371) [-475.681] * (-475.657) (-474.816) (-476.159) [-473.926] -- 0:00:31
522500 -- [-480.559] (-475.448) (-477.430) (-474.484) * (-477.942) (-476.890) [-476.172] (-476.044) -- 0:00:31
523000 -- (-476.991) (-482.083) [-477.627] (-477.204) * (-474.474) (-475.479) [-473.625] (-475.208) -- 0:00:31
523500 -- [-475.653] (-476.204) (-478.193) (-480.886) * (-474.380) (-476.382) (-474.835) [-474.182] -- 0:00:30
524000 -- (-473.653) (-473.718) [-475.378] (-480.034) * (-478.318) (-475.544) [-474.507] (-475.235) -- 0:00:30
524500 -- (-473.142) (-474.349) [-476.623] (-479.133) * (-474.850) (-477.592) (-479.566) [-476.233] -- 0:00:30
525000 -- (-473.550) (-475.050) [-473.311] (-481.265) * (-476.569) (-473.719) [-473.561] (-475.048) -- 0:00:30
Average standard deviation of split frequencies: 0.010069
525500 -- (-479.075) (-474.553) (-474.467) [-474.714] * (-477.014) (-477.410) [-474.034] (-476.214) -- 0:00:30
526000 -- [-475.653] (-473.247) (-475.326) (-475.438) * (-475.188) (-478.507) [-476.764] (-474.864) -- 0:00:30
526500 -- (-480.756) (-474.024) (-474.757) [-475.769] * (-475.995) [-475.200] (-473.936) (-476.010) -- 0:00:30
527000 -- (-479.865) (-475.582) (-476.104) [-474.606] * (-474.558) [-474.027] (-474.777) (-476.131) -- 0:00:30
527500 -- [-477.196] (-475.934) (-473.817) (-474.131) * (-475.377) (-473.660) (-474.932) [-475.560] -- 0:00:30
528000 -- [-475.167] (-474.625) (-475.988) (-475.321) * [-474.787] (-473.774) (-473.955) (-476.613) -- 0:00:30
528500 -- (-474.852) [-473.420] (-479.670) (-474.825) * [-477.283] (-476.369) (-477.968) (-477.181) -- 0:00:30
529000 -- [-475.063] (-474.367) (-479.809) (-475.008) * (-478.352) [-475.083] (-477.929) (-475.116) -- 0:00:30
529500 -- (-473.339) (-475.928) (-476.112) [-474.304] * (-476.200) (-476.255) (-481.359) [-476.293] -- 0:00:30
530000 -- (-473.263) [-473.186] (-475.364) (-474.461) * (-473.593) [-474.668] (-480.088) (-476.720) -- 0:00:30
Average standard deviation of split frequencies: 0.010826
530500 -- (-474.706) (-475.604) (-478.177) [-474.391] * (-473.941) (-476.457) [-473.673] (-480.045) -- 0:00:30
531000 -- (-477.584) (-474.174) (-478.601) [-477.193] * (-473.103) [-477.447] (-477.856) (-476.897) -- 0:00:30
531500 -- (-477.920) [-473.872] (-476.755) (-474.611) * (-477.666) [-475.069] (-473.977) (-476.154) -- 0:00:29
532000 -- (-474.004) (-475.185) [-475.675] (-473.290) * (-474.983) [-473.692] (-473.774) (-474.227) -- 0:00:29
532500 -- [-473.675] (-475.763) (-475.550) (-473.796) * (-475.653) [-475.516] (-475.509) (-474.390) -- 0:00:29
533000 -- (-475.072) (-477.487) (-475.895) [-473.943] * (-475.006) (-475.542) [-477.078] (-473.933) -- 0:00:29
533500 -- (-474.071) [-474.335] (-477.054) (-474.997) * (-475.465) (-478.792) (-474.504) [-474.739] -- 0:00:29
534000 -- [-474.198] (-475.152) (-474.633) (-473.413) * (-475.928) (-480.413) [-473.353] (-474.066) -- 0:00:29
534500 -- (-473.108) (-473.788) [-474.240] (-479.995) * (-475.370) (-473.928) (-478.334) [-474.765] -- 0:00:29
535000 -- (-473.385) [-473.680] (-473.201) (-476.126) * (-475.823) (-480.335) (-475.986) [-476.498] -- 0:00:29
Average standard deviation of split frequencies: 0.010554
535500 -- [-474.563] (-474.013) (-474.087) (-476.899) * (-475.800) [-473.901] (-473.492) (-473.520) -- 0:00:30
536000 -- (-476.045) (-474.327) (-476.839) [-475.585] * (-479.591) [-473.841] (-476.879) (-476.807) -- 0:00:30
536500 -- (-474.140) [-474.691] (-475.645) (-476.635) * (-476.781) [-473.457] (-474.940) (-475.573) -- 0:00:30
537000 -- [-475.566] (-477.430) (-474.634) (-482.052) * (-475.949) (-476.725) (-475.043) [-473.492] -- 0:00:30
537500 -- [-473.523] (-477.570) (-474.581) (-476.141) * (-478.659) (-473.819) [-475.729] (-474.261) -- 0:00:30
538000 -- (-475.572) (-475.459) [-475.221] (-479.722) * (-475.631) (-475.181) [-475.726] (-474.947) -- 0:00:30
538500 -- (-474.441) [-475.090] (-478.227) (-475.596) * (-473.728) (-473.901) (-473.753) [-476.519] -- 0:00:29
539000 -- (-479.510) (-476.756) [-473.575] (-475.633) * (-473.049) [-474.446] (-475.038) (-474.561) -- 0:00:29
539500 -- [-475.364] (-474.333) (-474.812) (-478.294) * (-473.049) (-474.047) (-473.181) [-477.447] -- 0:00:29
540000 -- (-477.865) (-476.956) (-474.563) [-474.593] * [-474.707] (-475.399) (-475.868) (-477.183) -- 0:00:29
Average standard deviation of split frequencies: 0.010408
540500 -- (-474.187) (-477.606) [-473.337] (-477.499) * [-474.556] (-474.073) (-476.403) (-474.320) -- 0:00:29
541000 -- (-474.669) (-474.446) [-474.833] (-474.986) * (-474.631) (-476.154) [-476.429] (-475.319) -- 0:00:29
541500 -- (-474.467) [-474.794] (-476.143) (-479.212) * (-475.163) (-473.078) (-476.936) [-477.427] -- 0:00:29
542000 -- (-475.296) (-474.150) (-474.971) [-475.035] * (-475.294) (-475.499) (-473.221) [-473.757] -- 0:00:29
542500 -- (-475.141) (-474.254) (-473.171) [-474.421] * (-474.249) (-473.805) [-476.067] (-475.170) -- 0:00:29
543000 -- (-477.029) (-477.203) [-475.930] (-475.808) * [-474.307] (-473.706) (-479.105) (-473.653) -- 0:00:29
543500 -- (-473.424) (-473.880) [-474.359] (-475.915) * (-474.414) (-473.920) [-476.272] (-474.678) -- 0:00:29
544000 -- (-473.433) (-474.836) (-474.299) [-476.449] * [-474.686] (-475.510) (-473.988) (-474.816) -- 0:00:29
544500 -- (-476.544) (-477.132) (-475.292) [-473.419] * (-475.963) (-475.546) (-476.820) [-473.278] -- 0:00:29
545000 -- [-473.601] (-475.064) (-474.830) (-473.375) * (-476.827) (-475.731) [-476.063] (-474.879) -- 0:00:29
Average standard deviation of split frequencies: 0.010145
545500 -- (-474.269) (-476.275) [-476.108] (-481.371) * (-476.728) [-476.307] (-474.829) (-473.603) -- 0:00:29
546000 -- (-477.418) [-473.416] (-477.005) (-474.487) * (-474.550) (-476.452) (-475.047) [-474.257] -- 0:00:29
546500 -- (-478.162) (-473.938) [-477.493] (-476.304) * (-474.903) (-479.633) (-475.369) [-474.783] -- 0:00:29
547000 -- [-474.592] (-475.441) (-476.052) (-477.708) * (-474.683) (-477.101) (-473.777) [-475.108] -- 0:00:28
547500 -- (-475.310) [-475.777] (-475.863) (-476.128) * (-474.230) (-476.035) [-474.935] (-474.281) -- 0:00:28
548000 -- (-475.062) (-475.357) (-477.132) [-473.192] * (-474.560) (-475.548) (-475.711) [-475.371] -- 0:00:28
548500 -- [-473.463] (-476.347) (-475.521) (-474.574) * (-475.175) [-475.259] (-477.587) (-475.384) -- 0:00:28
549000 -- (-473.243) (-481.475) [-474.648] (-474.114) * (-477.153) [-473.351] (-475.881) (-473.877) -- 0:00:28
549500 -- (-473.805) (-476.435) [-474.765] (-478.984) * [-476.515] (-475.683) (-474.059) (-476.244) -- 0:00:28
550000 -- [-474.383] (-476.175) (-474.838) (-477.216) * (-477.884) (-476.985) (-476.643) [-475.044] -- 0:00:28
Average standard deviation of split frequencies: 0.009517
550500 -- (-474.578) (-475.030) (-476.173) [-476.249] * (-475.207) (-479.136) [-476.423] (-474.867) -- 0:00:28
551000 -- (-477.339) [-474.526] (-473.290) (-475.876) * (-474.178) [-475.999] (-478.860) (-474.163) -- 0:00:28
551500 -- [-475.011] (-473.564) (-473.846) (-474.256) * (-477.127) [-475.228] (-474.130) (-475.092) -- 0:00:28
552000 -- (-478.220) (-475.576) (-475.533) [-475.560] * (-479.018) [-473.314] (-475.606) (-476.557) -- 0:00:28
552500 -- (-474.678) (-476.021) (-476.100) [-473.770] * (-474.900) [-474.184] (-475.507) (-473.738) -- 0:00:29
553000 -- (-473.959) [-474.223] (-477.905) (-479.836) * (-476.435) (-473.345) (-473.278) [-475.952] -- 0:00:29
553500 -- (-479.014) (-473.325) (-477.816) [-473.934] * (-476.059) (-474.617) [-474.251] (-477.614) -- 0:00:29
554000 -- [-473.247] (-475.176) (-477.686) (-477.895) * (-474.292) (-474.015) (-473.694) [-474.982] -- 0:00:28
554500 -- (-476.055) (-476.065) (-475.300) [-474.476] * [-474.896] (-473.276) (-474.366) (-475.568) -- 0:00:28
555000 -- [-476.506] (-476.477) (-477.211) (-473.375) * (-475.436) [-475.923] (-477.202) (-475.774) -- 0:00:28
Average standard deviation of split frequencies: 0.009703
555500 -- [-473.671] (-475.509) (-475.508) (-473.618) * (-476.446) [-475.388] (-473.712) (-479.118) -- 0:00:28
556000 -- [-477.511] (-477.527) (-474.113) (-475.704) * (-475.432) (-474.200) (-478.375) [-476.617] -- 0:00:28
556500 -- (-474.365) (-477.128) (-476.268) [-475.335] * (-473.862) (-474.326) (-474.500) [-473.821] -- 0:00:28
557000 -- (-474.365) (-475.613) [-473.750] (-474.147) * (-480.402) (-477.852) [-474.625] (-476.230) -- 0:00:28
557500 -- (-473.261) (-479.407) [-476.786] (-475.173) * (-474.962) (-477.727) (-474.409) [-476.000] -- 0:00:28
558000 -- (-474.336) (-473.998) [-475.925] (-480.822) * [-475.332] (-474.866) (-478.695) (-474.170) -- 0:00:28
558500 -- (-476.941) (-476.108) [-473.022] (-475.949) * (-475.243) (-474.699) (-473.632) [-473.644] -- 0:00:28
559000 -- (-476.020) (-473.736) (-475.813) [-473.638] * [-474.622] (-474.398) (-473.948) (-479.041) -- 0:00:28
559500 -- [-474.023] (-475.122) (-477.178) (-476.266) * (-477.395) (-475.614) (-475.512) [-473.425] -- 0:00:28
560000 -- (-475.322) [-478.167] (-476.295) (-473.753) * [-479.179] (-473.870) (-474.940) (-475.388) -- 0:00:28
Average standard deviation of split frequencies: 0.009617
560500 -- (-480.316) [-477.555] (-477.999) (-475.480) * (-476.975) (-474.188) [-475.318] (-475.265) -- 0:00:28
561000 -- (-476.976) (-473.774) (-476.219) [-476.213] * (-473.614) [-475.160] (-476.661) (-473.215) -- 0:00:28
561500 -- [-475.474] (-474.994) (-478.708) (-479.781) * (-475.347) (-475.509) (-476.692) [-473.240] -- 0:00:28
562000 -- (-473.904) (-476.882) (-477.260) [-477.489] * (-474.041) (-476.280) [-473.581] (-475.651) -- 0:00:28
562500 -- (-480.313) [-475.801] (-474.141) (-475.156) * [-474.251] (-474.251) (-483.426) (-477.129) -- 0:00:28
563000 -- (-473.881) [-475.179] (-477.926) (-473.320) * [-475.243] (-479.007) (-483.235) (-474.098) -- 0:00:27
563500 -- (-474.005) [-476.105] (-476.632) (-474.628) * (-474.467) [-474.818] (-477.195) (-474.046) -- 0:00:27
564000 -- (-473.471) (-473.927) (-474.898) [-475.239] * (-474.340) (-475.671) [-475.736] (-476.108) -- 0:00:27
564500 -- (-473.622) [-473.973] (-475.002) (-476.091) * (-473.536) (-477.461) (-474.153) [-476.182] -- 0:00:27
565000 -- (-474.515) (-475.484) [-474.354] (-476.473) * (-476.245) (-477.666) [-473.387] (-476.261) -- 0:00:27
Average standard deviation of split frequencies: 0.008560
565500 -- (-475.468) (-474.882) [-474.540] (-479.297) * [-478.664] (-474.603) (-473.943) (-475.024) -- 0:00:27
566000 -- (-476.475) [-475.553] (-477.011) (-474.312) * (-477.717) (-476.806) [-473.881] (-475.113) -- 0:00:27
566500 -- (-474.482) [-473.331] (-473.141) (-475.032) * (-479.323) (-476.472) (-475.338) [-475.043] -- 0:00:27
567000 -- (-477.918) (-473.548) (-473.224) [-475.104] * (-476.739) (-478.552) (-475.326) [-474.534] -- 0:00:27
567500 -- (-475.150) (-474.512) (-473.779) [-475.082] * (-477.914) [-473.463] (-479.463) (-477.711) -- 0:00:27
568000 -- (-476.495) (-474.984) [-474.084] (-473.163) * (-478.576) [-473.386] (-474.330) (-474.796) -- 0:00:27
568500 -- (-475.004) (-476.831) [-473.266] (-474.827) * [-475.198] (-474.286) (-473.671) (-476.180) -- 0:00:27
569000 -- (-478.087) [-473.398] (-473.750) (-476.625) * [-474.680] (-474.737) (-474.985) (-476.823) -- 0:00:27
569500 -- (-477.821) (-475.723) (-476.135) [-474.143] * (-476.072) (-478.419) [-475.887] (-477.361) -- 0:00:27
570000 -- (-473.589) (-476.037) [-476.174] (-476.640) * (-475.814) [-474.540] (-479.157) (-474.914) -- 0:00:27
Average standard deviation of split frequencies: 0.009135
570500 -- (-473.601) [-478.163] (-474.345) (-476.761) * [-474.606] (-474.103) (-476.458) (-475.360) -- 0:00:27
571000 -- (-475.470) (-473.346) (-473.321) [-474.289] * (-474.453) (-480.606) [-473.873] (-476.300) -- 0:00:27
571500 -- (-474.427) [-477.083] (-475.049) (-473.933) * (-477.032) [-474.208] (-479.477) (-479.781) -- 0:00:27
572000 -- (-474.831) (-476.054) [-474.147] (-475.620) * (-481.382) (-475.627) [-473.500] (-477.742) -- 0:00:27
572500 -- (-476.209) (-475.045) [-475.798] (-478.693) * (-473.204) [-476.351] (-473.161) (-473.976) -- 0:00:27
573000 -- (-475.526) [-474.938] (-474.181) (-474.679) * (-476.652) [-475.824] (-475.286) (-474.927) -- 0:00:27
573500 -- (-473.590) (-475.507) [-474.567] (-474.296) * (-477.727) (-479.734) [-475.148] (-477.113) -- 0:00:27
574000 -- (-474.430) [-476.106] (-474.690) (-474.906) * (-476.840) (-476.432) [-473.953] (-477.352) -- 0:00:27
574500 -- (-474.166) (-477.684) (-474.974) [-474.438] * (-474.082) (-475.482) [-473.170] (-476.851) -- 0:00:27
575000 -- (-475.861) [-476.254] (-475.680) (-474.615) * (-474.714) (-474.555) [-478.415] (-475.786) -- 0:00:27
Average standard deviation of split frequencies: 0.008457
575500 -- (-474.426) (-476.126) [-473.875] (-474.728) * (-477.872) (-473.310) [-476.816] (-473.387) -- 0:00:27
576000 -- [-474.172] (-474.417) (-484.112) (-473.548) * (-474.546) [-474.560] (-473.656) (-474.787) -- 0:00:27
576500 -- (-474.247) [-474.523] (-480.343) (-473.916) * (-474.715) (-474.163) (-475.384) [-476.481] -- 0:00:27
577000 -- [-473.825] (-475.896) (-474.636) (-476.203) * (-473.442) [-475.281] (-476.282) (-475.181) -- 0:00:27
577500 -- (-477.165) (-476.842) (-475.853) [-473.070] * (-473.277) (-474.256) (-475.463) [-476.148] -- 0:00:27
578000 -- (-477.623) (-476.733) [-476.963] (-475.286) * [-474.320] (-473.992) (-479.467) (-475.806) -- 0:00:27
578500 -- [-474.870] (-477.086) (-475.446) (-473.430) * (-476.663) (-474.097) (-473.869) [-475.549] -- 0:00:26
579000 -- (-474.498) [-473.998] (-477.179) (-474.113) * (-475.367) [-474.912] (-475.444) (-476.885) -- 0:00:26
579500 -- [-474.422] (-475.897) (-475.134) (-473.222) * (-475.888) (-473.871) [-474.217] (-475.249) -- 0:00:26
580000 -- (-473.143) (-474.172) (-479.067) [-473.257] * (-473.853) (-475.704) [-475.444] (-474.092) -- 0:00:26
Average standard deviation of split frequencies: 0.008262
580500 -- (-474.138) (-478.859) [-476.801] (-478.162) * (-480.089) [-475.082] (-477.275) (-475.836) -- 0:00:26
581000 -- [-473.905] (-476.697) (-477.635) (-473.506) * (-473.705) [-473.499] (-478.168) (-477.139) -- 0:00:26
581500 -- [-474.414] (-474.219) (-477.630) (-474.543) * (-477.678) (-474.746) (-474.961) [-478.057] -- 0:00:26
582000 -- (-477.330) (-477.445) (-477.396) [-474.672] * (-475.964) (-474.846) [-474.589] (-473.539) -- 0:00:26
582500 -- (-476.483) [-474.627] (-475.415) (-475.568) * (-475.764) (-477.512) [-476.146] (-475.454) -- 0:00:26
583000 -- [-475.091] (-475.484) (-476.778) (-475.839) * (-479.587) (-476.047) [-473.946] (-475.741) -- 0:00:26
583500 -- [-473.938] (-478.491) (-476.767) (-473.711) * [-476.039] (-477.762) (-476.385) (-473.822) -- 0:00:26
584000 -- (-475.098) (-475.831) (-479.008) [-474.252] * (-475.955) (-476.021) (-477.399) [-476.403] -- 0:00:26
584500 -- [-477.619] (-475.026) (-477.770) (-475.471) * (-473.629) (-473.424) [-477.266] (-474.493) -- 0:00:26
585000 -- (-474.192) (-479.665) [-475.854] (-474.754) * (-473.519) [-474.713] (-474.828) (-479.976) -- 0:00:26
Average standard deviation of split frequencies: 0.008423
585500 -- [-473.226] (-474.479) (-476.591) (-477.417) * [-473.291] (-474.261) (-475.165) (-473.654) -- 0:00:26
586000 -- [-474.159] (-474.561) (-474.390) (-479.017) * (-481.922) [-476.461] (-473.763) (-475.571) -- 0:00:26
586500 -- (-476.347) [-476.973] (-474.051) (-476.042) * (-476.190) [-473.179] (-474.908) (-474.498) -- 0:00:26
587000 -- (-475.808) [-475.912] (-475.905) (-473.573) * (-476.197) (-475.125) [-474.886] (-475.721) -- 0:00:26
587500 -- [-473.951] (-474.934) (-474.830) (-474.475) * (-474.846) (-478.273) (-477.464) [-474.023] -- 0:00:26
588000 -- (-479.269) [-474.978] (-474.801) (-478.557) * (-473.341) (-474.341) (-473.853) [-474.369] -- 0:00:26
588500 -- (-480.901) (-478.703) [-474.187] (-477.006) * (-476.844) (-473.829) [-478.414] (-476.444) -- 0:00:26
589000 -- (-478.073) (-475.756) [-474.284] (-479.074) * [-476.049] (-474.015) (-475.357) (-475.666) -- 0:00:26
589500 -- [-474.631] (-475.841) (-475.128) (-472.936) * (-473.722) [-474.962] (-477.189) (-474.701) -- 0:00:26
590000 -- (-474.139) (-474.940) [-474.572] (-475.433) * (-474.980) [-474.271] (-477.440) (-474.421) -- 0:00:26
Average standard deviation of split frequencies: 0.008735
590500 -- (-474.915) (-477.465) [-474.080] (-473.222) * (-473.228) [-476.498] (-476.166) (-474.633) -- 0:00:26
591000 -- (-477.022) (-474.004) [-477.224] (-474.355) * (-475.515) (-476.735) (-482.715) [-473.639] -- 0:00:26
591500 -- (-478.226) (-475.548) [-476.684] (-473.907) * (-479.206) (-478.921) (-474.708) [-474.102] -- 0:00:26
592000 -- (-475.287) [-475.822] (-473.418) (-474.150) * [-474.939] (-479.994) (-474.470) (-473.531) -- 0:00:26
592500 -- (-475.681) (-476.108) (-475.350) [-473.564] * (-476.731) [-476.026] (-474.885) (-476.471) -- 0:00:26
593000 -- (-476.082) [-475.162] (-478.666) (-473.966) * (-478.353) (-474.539) (-475.596) [-474.027] -- 0:00:26
593500 -- (-475.523) [-476.183] (-480.013) (-476.828) * (-475.344) (-474.419) [-476.047] (-474.789) -- 0:00:26
594000 -- (-477.458) (-476.477) (-474.850) [-474.845] * (-474.847) (-473.924) [-474.297] (-475.535) -- 0:00:25
594500 -- (-476.652) [-478.730] (-474.159) (-478.625) * (-476.799) (-473.857) (-473.207) [-476.521] -- 0:00:25
595000 -- (-480.274) [-473.639] (-474.955) (-478.284) * (-474.512) (-473.667) [-480.427] (-475.107) -- 0:00:25
Average standard deviation of split frequencies: 0.008876
595500 -- (-473.479) [-473.697] (-478.376) (-474.693) * (-476.124) (-475.496) (-477.703) [-474.125] -- 0:00:25
596000 -- [-474.382] (-478.793) (-477.619) (-473.821) * (-478.249) (-476.760) [-476.139] (-475.304) -- 0:00:25
596500 -- (-475.343) (-477.572) (-475.216) [-473.532] * (-473.765) [-475.182] (-473.700) (-475.657) -- 0:00:25
597000 -- (-476.292) (-474.055) (-475.163) [-474.974] * [-474.693] (-475.058) (-475.335) (-474.910) -- 0:00:25
597500 -- (-478.739) (-477.772) [-477.308] (-476.302) * (-475.713) [-476.661] (-473.624) (-475.615) -- 0:00:25
598000 -- (-475.612) (-475.845) (-477.401) [-474.724] * (-474.773) (-474.492) [-474.289] (-474.223) -- 0:00:25
598500 -- (-476.991) [-476.428] (-479.623) (-474.343) * (-474.256) (-476.207) [-473.672] (-480.376) -- 0:00:25
599000 -- [-474.962] (-477.340) (-476.218) (-477.003) * (-475.907) (-477.129) (-474.323) [-476.559] -- 0:00:25
599500 -- (-477.296) (-476.342) (-481.175) [-476.322] * (-474.707) (-475.146) [-475.863] (-475.232) -- 0:00:25
600000 -- (-479.140) [-474.972] (-475.384) (-476.911) * (-478.564) [-477.299] (-473.573) (-475.227) -- 0:00:25
Average standard deviation of split frequencies: 0.009418
600500 -- (-478.118) (-480.442) (-474.443) [-474.420] * (-475.398) (-476.471) (-473.877) [-475.575] -- 0:00:25
601000 -- (-477.394) (-476.365) (-475.798) [-476.076] * [-473.429] (-475.268) (-475.434) (-474.674) -- 0:00:25
601500 -- (-479.028) (-477.274) (-477.666) [-476.359] * (-476.708) [-474.294] (-479.925) (-479.744) -- 0:00:25
602000 -- [-474.878] (-474.590) (-474.225) (-476.115) * [-474.071] (-476.645) (-479.105) (-475.285) -- 0:00:25
602500 -- (-475.926) (-475.962) [-474.900] (-474.218) * [-474.588] (-475.504) (-477.208) (-474.787) -- 0:00:25
603000 -- (-476.414) (-473.569) [-474.523] (-474.739) * (-476.658) (-476.594) [-476.214] (-475.562) -- 0:00:25
603500 -- (-474.225) (-474.559) [-475.264] (-476.217) * (-478.145) (-475.377) [-476.082] (-477.198) -- 0:00:25
604000 -- (-476.104) (-475.180) [-477.470] (-474.517) * [-474.501] (-473.798) (-476.962) (-474.341) -- 0:00:25
604500 -- (-475.453) [-477.061] (-474.387) (-473.865) * [-477.280] (-473.781) (-477.247) (-473.696) -- 0:00:25
605000 -- [-472.985] (-473.435) (-478.174) (-474.018) * (-474.682) [-473.657] (-475.160) (-473.836) -- 0:00:25
Average standard deviation of split frequencies: 0.009680
605500 -- (-476.274) (-473.746) (-473.839) [-474.647] * (-474.177) (-475.440) [-482.261] (-476.668) -- 0:00:25
606000 -- (-473.275) [-474.009] (-476.419) (-478.010) * (-474.997) (-477.101) (-477.418) [-476.158] -- 0:00:25
606500 -- (-474.913) [-475.671] (-476.420) (-475.170) * (-478.221) (-473.942) (-475.103) [-474.892] -- 0:00:25
607000 -- (-476.532) [-476.730] (-474.977) (-473.899) * [-476.053] (-478.831) (-473.912) (-473.986) -- 0:00:25
607500 -- (-474.751) [-474.709] (-474.132) (-474.656) * [-473.085] (-475.015) (-476.239) (-474.530) -- 0:00:25
608000 -- (-474.756) (-473.545) (-476.555) [-473.623] * (-473.828) [-476.502] (-475.544) (-475.191) -- 0:00:25
608500 -- (-473.253) (-478.302) [-477.043] (-477.724) * [-473.973] (-476.497) (-476.227) (-480.657) -- 0:00:25
609000 -- (-473.242) (-473.304) [-479.629] (-473.915) * [-474.172] (-474.766) (-476.511) (-477.362) -- 0:00:25
609500 -- [-473.507] (-475.708) (-477.897) (-474.404) * (-473.270) [-473.859] (-473.944) (-474.507) -- 0:00:24
610000 -- [-474.380] (-478.404) (-476.201) (-475.550) * (-474.103) [-473.901] (-477.054) (-473.725) -- 0:00:24
Average standard deviation of split frequencies: 0.009049
610500 -- (-478.838) [-473.487] (-475.035) (-475.139) * (-477.528) (-478.578) (-477.863) [-474.268] -- 0:00:24
611000 -- (-474.989) [-479.809] (-478.796) (-474.520) * (-476.969) (-482.039) [-474.985] (-474.089) -- 0:00:24
611500 -- (-477.449) [-477.064] (-489.158) (-474.530) * (-474.250) (-481.325) (-477.562) [-478.753] -- 0:00:24
612000 -- (-476.334) (-474.917) (-489.405) [-474.249] * [-474.248] (-475.439) (-475.796) (-481.773) -- 0:00:24
612500 -- [-481.098] (-473.272) (-479.721) (-473.233) * [-475.384] (-475.684) (-475.353) (-477.567) -- 0:00:24
613000 -- [-475.336] (-474.747) (-477.978) (-475.252) * (-475.257) (-476.710) [-475.488] (-475.857) -- 0:00:24
613500 -- (-476.472) [-473.710] (-480.277) (-473.109) * [-474.395] (-488.196) (-473.579) (-478.595) -- 0:00:24
614000 -- (-478.619) (-477.024) (-474.564) [-473.487] * (-473.656) (-478.575) (-474.277) [-475.244] -- 0:00:24
614500 -- (-477.447) (-478.763) (-477.496) [-473.502] * (-473.811) (-476.276) (-474.055) [-473.573] -- 0:00:24
615000 -- [-476.407] (-475.416) (-474.484) (-478.837) * (-475.444) [-476.614] (-474.138) (-474.151) -- 0:00:24
Average standard deviation of split frequencies: 0.008631
615500 -- (-476.248) (-475.555) [-474.753] (-475.995) * (-476.959) (-474.991) [-474.291] (-476.738) -- 0:00:24
616000 -- (-477.630) [-475.734] (-479.054) (-479.286) * (-474.105) (-473.157) [-474.288] (-476.006) -- 0:00:24
616500 -- [-475.034] (-476.282) (-477.127) (-478.997) * (-475.359) [-474.779] (-477.191) (-474.504) -- 0:00:24
617000 -- [-475.377] (-475.195) (-475.184) (-473.536) * (-475.204) (-476.028) (-474.269) [-475.592] -- 0:00:24
617500 -- [-477.969] (-475.598) (-476.725) (-473.536) * (-475.544) (-477.431) [-473.939] (-475.721) -- 0:00:24
618000 -- (-474.958) (-476.179) [-475.140] (-477.448) * (-478.780) (-478.274) [-473.866] (-475.658) -- 0:00:24
618500 -- (-475.517) (-475.272) [-476.563] (-479.663) * (-476.376) (-474.125) [-474.013] (-474.986) -- 0:00:24
619000 -- (-474.658) (-474.898) (-478.481) [-474.574] * (-479.237) (-474.932) (-481.046) [-474.072] -- 0:00:24
619500 -- [-475.171] (-475.493) (-473.477) (-474.350) * (-474.823) [-474.958] (-479.196) (-475.500) -- 0:00:23
620000 -- (-480.097) (-474.037) [-475.087] (-473.867) * [-474.480] (-477.323) (-477.535) (-474.337) -- 0:00:23
Average standard deviation of split frequencies: 0.009072
620500 -- (-476.209) [-475.368] (-473.371) (-475.109) * (-475.130) [-474.117] (-475.020) (-474.556) -- 0:00:24
621000 -- [-474.906] (-476.577) (-476.625) (-477.477) * (-475.826) (-475.900) [-476.477] (-476.681) -- 0:00:24
621500 -- (-473.924) (-474.101) [-476.533] (-475.814) * [-473.983] (-474.256) (-474.849) (-475.685) -- 0:00:24
622000 -- (-475.240) (-476.206) (-474.596) [-475.416] * [-473.647] (-474.574) (-474.338) (-476.758) -- 0:00:24
622500 -- (-473.766) [-475.715] (-474.195) (-477.532) * (-476.927) (-483.115) [-475.300] (-477.691) -- 0:00:24
623000 -- (-475.984) [-473.181] (-474.592) (-473.986) * (-475.332) [-476.679] (-477.115) (-480.745) -- 0:00:24
623500 -- (-477.609) [-473.755] (-473.285) (-477.848) * (-475.012) (-475.819) (-476.099) [-474.422] -- 0:00:24
624000 -- (-474.312) [-474.008] (-474.320) (-474.859) * [-473.253] (-475.111) (-476.255) (-479.541) -- 0:00:24
624500 -- (-478.724) [-473.874] (-475.541) (-477.019) * (-478.737) (-475.928) [-474.721] (-475.805) -- 0:00:24
625000 -- [-477.485] (-477.582) (-480.201) (-474.705) * (-478.199) [-474.949] (-477.774) (-473.905) -- 0:00:24
Average standard deviation of split frequencies: 0.009037
625500 -- (-475.747) [-473.012] (-477.236) (-474.547) * (-476.736) (-475.030) [-473.179] (-473.366) -- 0:00:23
626000 -- (-473.874) [-473.334] (-473.876) (-473.731) * (-477.198) (-475.035) (-474.005) [-473.819] -- 0:00:23
626500 -- (-474.322) (-476.511) (-474.229) [-478.752] * (-478.557) (-476.450) [-474.969] (-474.863) -- 0:00:23
627000 -- (-476.581) [-479.075] (-479.512) (-478.454) * (-476.369) (-476.154) [-475.707] (-474.879) -- 0:00:23
627500 -- (-473.960) [-476.014] (-476.458) (-474.020) * (-477.485) [-473.959] (-473.199) (-476.826) -- 0:00:23
628000 -- (-476.991) [-477.265] (-475.858) (-477.855) * [-474.009] (-473.717) (-474.261) (-474.124) -- 0:00:23
628500 -- (-475.304) [-475.031] (-477.938) (-473.661) * [-475.459] (-477.360) (-477.603) (-474.987) -- 0:00:23
629000 -- (-473.940) (-473.851) [-473.383] (-474.294) * [-474.362] (-479.688) (-475.121) (-473.350) -- 0:00:23
629500 -- (-475.705) [-475.403] (-478.365) (-473.236) * (-473.911) (-476.960) (-476.908) [-474.037] -- 0:00:23
630000 -- (-474.550) [-474.489] (-475.461) (-475.895) * [-475.081] (-474.539) (-478.204) (-473.571) -- 0:00:23
Average standard deviation of split frequencies: 0.009673
630500 -- [-479.530] (-474.794) (-479.942) (-477.566) * [-474.849] (-481.514) (-474.856) (-475.959) -- 0:00:23
631000 -- (-476.475) [-474.603] (-479.259) (-475.518) * [-476.090] (-475.454) (-475.975) (-473.974) -- 0:00:23
631500 -- (-475.394) (-476.613) (-475.969) [-474.628] * (-475.505) [-478.950] (-478.949) (-473.405) -- 0:00:23
632000 -- (-474.219) [-474.712] (-474.039) (-474.157) * (-475.823) (-477.819) (-476.737) [-474.829] -- 0:00:23
632500 -- (-475.308) (-475.203) [-473.918] (-476.214) * (-474.295) (-474.289) [-473.919] (-475.050) -- 0:00:23
633000 -- (-474.403) [-474.502] (-474.880) (-474.647) * [-475.252] (-475.579) (-474.967) (-474.559) -- 0:00:23
633500 -- (-473.430) (-476.441) [-475.065] (-476.711) * [-473.547] (-475.722) (-474.955) (-474.303) -- 0:00:23
634000 -- [-476.014] (-473.736) (-476.883) (-474.966) * [-474.365] (-477.199) (-479.944) (-473.826) -- 0:00:23
634500 -- [-473.797] (-477.185) (-485.878) (-474.277) * (-476.708) (-475.062) [-476.253] (-474.155) -- 0:00:23
635000 -- [-474.262] (-477.679) (-475.908) (-475.219) * [-474.176] (-475.038) (-474.353) (-474.907) -- 0:00:22
Average standard deviation of split frequencies: 0.009033
635500 -- (-473.353) [-476.576] (-475.645) (-477.897) * [-475.116] (-477.744) (-478.790) (-477.076) -- 0:00:22
636000 -- (-474.143) [-475.942] (-475.252) (-473.468) * (-476.004) [-477.171] (-481.643) (-475.493) -- 0:00:22
636500 -- (-474.473) (-474.938) [-473.117] (-473.648) * (-480.078) [-475.958] (-478.486) (-473.968) -- 0:00:22
637000 -- (-474.388) (-476.242) (-478.039) [-476.542] * (-482.687) [-476.868] (-474.798) (-473.490) -- 0:00:23
637500 -- [-475.024] (-474.416) (-475.435) (-480.122) * [-476.848] (-474.463) (-473.901) (-474.282) -- 0:00:23
638000 -- (-475.640) (-473.563) [-474.812] (-473.998) * (-477.636) (-477.158) (-478.137) [-477.446] -- 0:00:23
638500 -- (-477.636) (-475.720) [-474.195] (-479.412) * [-478.515] (-473.741) (-475.347) (-477.386) -- 0:00:23
639000 -- (-473.630) (-474.505) [-475.521] (-474.660) * [-476.837] (-475.519) (-475.217) (-476.688) -- 0:00:23
639500 -- (-474.572) [-476.628] (-475.919) (-476.444) * (-476.659) [-473.268] (-473.955) (-476.067) -- 0:00:23
640000 -- (-476.024) (-476.030) (-473.470) [-474.789] * (-474.426) (-474.563) (-474.441) [-476.999] -- 0:00:23
Average standard deviation of split frequencies: 0.008968
640500 -- (-476.607) (-476.168) [-473.572] (-476.226) * [-477.753] (-474.564) (-474.277) (-478.494) -- 0:00:23
641000 -- (-475.187) (-475.731) (-475.918) [-477.504] * (-474.424) [-473.462] (-473.556) (-479.187) -- 0:00:22
641500 -- (-476.145) (-475.654) [-476.874] (-480.533) * (-477.067) [-473.858] (-475.062) (-476.361) -- 0:00:22
642000 -- [-477.800] (-473.479) (-475.980) (-477.312) * (-475.186) (-480.742) [-474.447] (-475.971) -- 0:00:22
642500 -- (-475.724) [-474.255] (-474.467) (-478.614) * (-476.537) [-478.562] (-474.386) (-475.825) -- 0:00:22
643000 -- (-475.922) (-476.179) [-475.392] (-476.643) * (-476.321) (-473.968) (-475.581) [-476.165] -- 0:00:22
643500 -- (-477.392) (-476.130) (-476.272) [-474.148] * [-477.823] (-474.278) (-477.028) (-473.273) -- 0:00:22
644000 -- [-475.362] (-475.932) (-474.877) (-476.677) * (-479.277) [-473.557] (-478.946) (-474.246) -- 0:00:22
644500 -- [-474.824] (-473.721) (-475.392) (-477.389) * (-475.844) [-473.080] (-477.761) (-473.540) -- 0:00:22
645000 -- (-473.770) (-475.233) (-474.328) [-475.530] * [-473.727] (-477.243) (-477.135) (-473.672) -- 0:00:22
Average standard deviation of split frequencies: 0.008939
645500 -- (-476.197) (-474.501) [-474.354] (-475.787) * (-476.933) (-478.229) (-473.610) [-476.621] -- 0:00:22
646000 -- [-475.311] (-481.335) (-477.354) (-473.776) * (-474.693) (-474.522) (-473.419) [-474.224] -- 0:00:22
646500 -- (-475.493) (-476.343) (-475.710) [-473.699] * (-474.287) (-475.180) [-480.149] (-473.292) -- 0:00:22
647000 -- [-474.465] (-475.773) (-474.450) (-472.959) * (-474.228) (-477.825) (-478.248) [-474.527] -- 0:00:22
647500 -- (-476.947) (-477.728) (-478.358) [-476.849] * (-475.473) (-475.565) [-474.357] (-474.271) -- 0:00:22
648000 -- (-474.027) (-475.106) (-474.233) [-475.072] * (-474.771) (-475.236) (-474.327) [-474.729] -- 0:00:22
648500 -- [-472.898] (-474.253) (-474.639) (-475.786) * [-473.586] (-473.336) (-475.211) (-477.497) -- 0:00:22
649000 -- (-475.217) (-474.106) [-474.497] (-474.224) * (-474.330) [-474.886] (-477.487) (-479.390) -- 0:00:22
649500 -- (-475.328) (-475.910) (-476.691) [-476.147] * [-475.825] (-473.808) (-475.659) (-476.119) -- 0:00:22
650000 -- (-473.370) (-475.990) (-477.118) [-475.883] * (-476.680) (-476.286) (-473.868) [-474.968] -- 0:00:22
Average standard deviation of split frequencies: 0.010271
650500 -- (-474.733) (-475.424) [-474.243] (-475.518) * [-475.456] (-478.536) (-474.072) (-477.856) -- 0:00:22
651000 -- (-476.228) (-474.542) (-477.084) [-474.775] * (-475.353) [-475.953] (-475.213) (-474.379) -- 0:00:21
651500 -- [-475.179] (-476.042) (-475.444) (-477.633) * (-473.601) [-475.178] (-473.808) (-474.480) -- 0:00:21
652000 -- (-474.517) (-473.627) [-473.220] (-473.864) * (-474.432) (-479.385) [-474.336] (-473.837) -- 0:00:21
652500 -- (-474.098) (-475.189) [-474.745] (-473.852) * [-473.732] (-477.592) (-477.079) (-474.790) -- 0:00:21
653000 -- [-473.013] (-475.949) (-474.818) (-473.776) * (-482.516) [-473.213] (-475.465) (-474.925) -- 0:00:22
653500 -- (-473.890) (-475.989) (-476.558) [-477.434] * (-476.639) (-473.049) (-477.491) [-474.026] -- 0:00:22
654000 -- (-476.012) [-476.690] (-476.139) (-477.678) * (-473.665) [-474.412] (-474.379) (-473.768) -- 0:00:22
654500 -- [-475.902] (-476.072) (-473.855) (-473.416) * (-473.809) [-473.229] (-476.692) (-475.187) -- 0:00:22
655000 -- (-474.284) (-473.365) (-475.565) [-474.510] * (-473.883) (-475.228) (-476.686) [-477.527] -- 0:00:22
Average standard deviation of split frequencies: 0.009553
655500 -- (-474.646) [-475.853] (-473.197) (-475.311) * (-476.712) [-475.131] (-477.584) (-476.147) -- 0:00:22
656000 -- (-475.955) (-472.940) [-474.683] (-479.310) * (-476.240) [-474.379] (-476.393) (-477.476) -- 0:00:22
656500 -- (-477.074) (-475.085) [-473.410] (-475.155) * [-477.708] (-476.338) (-474.908) (-478.460) -- 0:00:21
657000 -- (-473.630) (-473.811) (-474.199) [-475.321] * [-480.152] (-476.186) (-475.259) (-474.527) -- 0:00:21
657500 -- [-474.382] (-475.444) (-475.064) (-475.118) * (-473.046) [-474.376] (-475.528) (-474.651) -- 0:00:21
658000 -- (-474.095) [-473.806] (-475.068) (-475.318) * (-476.145) (-474.252) (-475.115) [-474.496] -- 0:00:21
658500 -- [-475.272] (-478.118) (-473.634) (-478.221) * [-479.125] (-473.126) (-473.233) (-474.185) -- 0:00:21
659000 -- [-477.457] (-474.413) (-479.011) (-474.683) * (-481.485) [-475.478] (-473.679) (-474.498) -- 0:00:21
659500 -- [-476.112] (-474.021) (-477.261) (-478.178) * (-476.443) (-474.905) [-473.515] (-474.908) -- 0:00:21
660000 -- [-475.853] (-478.543) (-475.541) (-474.103) * (-481.657) (-474.341) [-474.630] (-475.584) -- 0:00:21
Average standard deviation of split frequencies: 0.008429
660500 -- (-480.196) (-474.652) [-477.492] (-475.012) * [-473.783] (-474.743) (-474.549) (-475.186) -- 0:00:21
661000 -- [-474.281] (-476.321) (-479.191) (-478.481) * [-473.648] (-475.408) (-477.183) (-476.324) -- 0:00:21
661500 -- (-473.158) (-477.020) (-477.008) [-473.457] * (-474.677) (-474.743) (-474.892) [-476.479] -- 0:00:21
662000 -- [-475.063] (-474.129) (-481.938) (-473.294) * (-473.574) (-474.414) (-476.530) [-475.349] -- 0:00:21
662500 -- [-475.338] (-476.313) (-477.548) (-474.915) * (-473.266) (-476.089) (-476.177) [-475.794] -- 0:00:21
663000 -- [-474.977] (-480.319) (-474.144) (-475.657) * [-473.161] (-479.009) (-480.775) (-473.682) -- 0:00:21
663500 -- (-473.288) (-474.598) (-476.958) [-474.455] * [-474.778] (-477.876) (-479.574) (-474.324) -- 0:00:21
664000 -- (-474.388) [-476.231] (-476.765) (-477.206) * (-474.815) (-476.302) [-475.765] (-475.000) -- 0:00:21
664500 -- [-475.932] (-475.825) (-480.068) (-474.257) * [-476.861] (-477.607) (-475.241) (-477.873) -- 0:00:21
665000 -- (-475.791) [-475.165] (-475.192) (-473.610) * (-476.713) (-475.389) [-476.758] (-476.142) -- 0:00:21
Average standard deviation of split frequencies: 0.008184
665500 -- (-474.125) (-474.448) (-473.313) [-474.617] * (-475.643) [-475.021] (-474.190) (-477.233) -- 0:00:21
666000 -- (-474.040) (-475.934) [-477.793] (-474.423) * (-474.000) (-476.498) [-473.498] (-475.848) -- 0:00:21
666500 -- (-475.948) (-473.994) (-479.328) [-474.549] * (-475.705) [-474.361] (-474.887) (-479.550) -- 0:00:21
667000 -- [-477.740] (-473.328) (-477.839) (-473.324) * (-476.477) (-474.091) (-473.780) [-477.325] -- 0:00:20
667500 -- (-474.758) (-473.328) [-478.682] (-473.838) * (-475.700) (-474.015) (-474.485) [-474.805] -- 0:00:20
668000 -- (-476.130) (-474.442) (-477.581) [-475.296] * (-477.821) (-476.302) (-478.452) [-473.215] -- 0:00:20
668500 -- (-480.155) [-474.421] (-473.424) (-475.034) * (-474.765) [-476.956] (-476.392) (-474.379) -- 0:00:20
669000 -- (-475.481) (-478.153) [-476.132] (-474.443) * (-474.902) (-477.317) (-476.797) [-474.508] -- 0:00:20
669500 -- (-475.589) [-474.253] (-477.983) (-477.640) * (-475.660) (-483.568) (-475.686) [-476.055] -- 0:00:21
670000 -- (-476.550) (-476.198) (-476.274) [-475.172] * (-476.908) (-478.484) (-476.653) [-476.437] -- 0:00:21
Average standard deviation of split frequencies: 0.008039
670500 -- [-476.028] (-474.648) (-474.568) (-480.564) * (-476.806) [-477.301] (-475.623) (-476.059) -- 0:00:21
671000 -- [-475.415] (-474.887) (-475.644) (-476.905) * (-477.356) (-479.072) (-474.433) [-475.170] -- 0:00:21
671500 -- (-474.932) [-474.970] (-474.757) (-476.125) * (-476.159) (-476.629) [-474.139] (-474.005) -- 0:00:21
672000 -- (-474.643) (-475.819) [-475.537] (-473.323) * (-475.544) (-476.758) [-473.837] (-479.116) -- 0:00:20
672500 -- (-474.824) (-475.190) (-474.795) [-477.229] * (-475.841) (-476.505) [-475.048] (-478.504) -- 0:00:20
673000 -- (-473.205) (-473.781) (-479.210) [-473.766] * (-477.827) (-478.416) [-476.155] (-475.741) -- 0:00:20
673500 -- (-474.045) (-474.918) [-477.973] (-476.867) * (-479.146) [-478.587] (-474.466) (-473.643) -- 0:00:20
674000 -- (-474.111) [-474.441] (-477.949) (-479.464) * (-478.345) (-479.294) [-474.174] (-477.735) -- 0:00:20
674500 -- (-479.159) [-474.747] (-478.516) (-478.415) * (-481.977) (-475.257) (-477.878) [-477.238] -- 0:00:20
675000 -- (-478.215) [-472.960] (-476.349) (-474.289) * [-475.765] (-478.650) (-474.839) (-476.933) -- 0:00:20
Average standard deviation of split frequencies: 0.007584
675500 -- (-476.204) [-472.983] (-479.590) (-473.932) * (-474.672) (-476.698) (-477.936) [-474.991] -- 0:00:20
676000 -- (-473.932) (-474.400) [-477.747] (-475.508) * (-474.385) [-479.242] (-475.527) (-474.314) -- 0:00:20
676500 -- [-475.888] (-474.354) (-481.375) (-476.722) * (-481.415) [-473.756] (-475.010) (-473.589) -- 0:00:20
677000 -- (-474.399) (-474.693) (-476.048) [-473.799] * (-478.643) (-474.149) [-474.485] (-479.200) -- 0:00:20
677500 -- (-475.874) (-476.381) [-474.905] (-477.184) * (-476.936) (-475.455) [-474.475] (-474.853) -- 0:00:20
678000 -- [-473.830] (-474.507) (-474.300) (-473.707) * [-476.237] (-474.336) (-474.443) (-475.025) -- 0:00:20
678500 -- [-477.614] (-474.316) (-478.537) (-476.787) * [-475.110] (-473.972) (-473.837) (-477.350) -- 0:00:20
679000 -- (-476.736) (-474.088) (-476.648) [-473.737] * (-479.604) (-473.501) (-475.817) [-475.125] -- 0:00:20
679500 -- (-476.010) (-480.738) [-474.861] (-475.099) * (-474.430) (-479.038) (-476.623) [-474.749] -- 0:00:20
680000 -- (-475.206) [-482.217] (-480.041) (-477.678) * (-474.142) (-478.937) (-474.676) [-474.448] -- 0:00:20
Average standard deviation of split frequencies: 0.007358
680500 -- [-473.801] (-474.918) (-475.129) (-475.560) * (-473.386) (-477.736) (-475.016) [-473.498] -- 0:00:20
681000 -- (-473.281) (-473.397) (-476.737) [-475.529] * (-478.921) (-480.476) [-474.441] (-473.746) -- 0:00:20
681500 -- [-478.023] (-473.534) (-474.989) (-474.475) * [-476.944] (-478.505) (-474.364) (-474.779) -- 0:00:20
682000 -- (-474.797) (-474.032) [-475.844] (-474.905) * (-475.092) (-477.189) (-476.101) [-474.150] -- 0:00:20
682500 -- (-475.463) (-474.812) (-473.612) [-474.889] * (-474.554) [-478.394] (-473.651) (-474.797) -- 0:00:20
683000 -- [-476.799] (-473.369) (-475.884) (-475.267) * (-476.232) [-474.966] (-473.969) (-476.495) -- 0:00:19
683500 -- (-477.088) (-474.427) [-474.279] (-478.035) * (-477.020) (-477.237) (-473.307) [-479.190] -- 0:00:19
684000 -- (-476.548) (-476.623) (-475.122) [-474.571] * (-477.319) [-473.992] (-476.060) (-474.677) -- 0:00:19
684500 -- [-477.245] (-476.626) (-475.556) (-474.686) * (-478.172) [-475.129] (-478.393) (-475.371) -- 0:00:19
685000 -- (-476.467) [-476.875] (-474.029) (-475.084) * (-476.647) (-474.443) (-478.488) [-476.677] -- 0:00:19
Average standard deviation of split frequencies: 0.008772
685500 -- [-476.395] (-476.686) (-473.826) (-476.307) * [-475.248] (-477.579) (-475.322) (-484.950) -- 0:00:19
686000 -- (-473.818) (-478.188) (-475.482) [-473.636] * (-476.227) (-473.786) (-474.213) [-477.159] -- 0:00:20
686500 -- [-476.390] (-474.474) (-474.318) (-473.673) * (-477.146) (-476.752) (-476.927) [-474.792] -- 0:00:20
687000 -- (-474.831) (-473.661) [-474.113] (-475.066) * (-474.697) [-478.057] (-474.440) (-475.455) -- 0:00:20
687500 -- [-475.287] (-476.699) (-476.647) (-473.812) * [-475.519] (-476.062) (-473.908) (-474.717) -- 0:00:20
688000 -- (-475.310) [-476.146] (-475.885) (-475.291) * (-478.665) [-473.943] (-474.589) (-478.308) -- 0:00:19
688500 -- (-474.451) (-474.068) (-475.928) [-476.143] * (-475.457) (-476.894) [-474.184] (-474.680) -- 0:00:19
689000 -- [-476.400] (-475.147) (-477.064) (-475.234) * [-475.205] (-474.482) (-476.981) (-476.692) -- 0:00:19
689500 -- (-473.262) (-474.970) (-479.760) [-474.997] * (-475.968) (-474.072) [-475.089] (-474.071) -- 0:00:19
690000 -- (-473.677) (-474.263) (-480.450) [-479.238] * (-473.753) (-474.888) (-474.421) [-475.902] -- 0:00:19
Average standard deviation of split frequencies: 0.008702
690500 -- [-478.331] (-476.728) (-475.737) (-474.370) * (-473.932) [-474.117] (-475.135) (-476.399) -- 0:00:19
691000 -- [-479.115] (-473.927) (-477.785) (-474.335) * (-476.313) [-474.302] (-476.512) (-474.488) -- 0:00:19
691500 -- (-479.885) [-478.437] (-474.087) (-474.606) * (-473.036) (-474.857) [-475.431] (-474.226) -- 0:00:19
692000 -- [-474.774] (-485.367) (-474.737) (-473.727) * (-474.617) [-474.221] (-475.358) (-473.901) -- 0:00:19
692500 -- (-477.021) [-481.795] (-474.988) (-473.373) * (-474.329) [-475.264] (-475.905) (-474.456) -- 0:00:19
693000 -- (-473.889) (-476.113) [-478.061] (-474.044) * (-475.065) (-474.190) [-473.531] (-475.739) -- 0:00:19
693500 -- (-473.782) (-478.162) [-477.919] (-478.223) * (-473.791) (-476.426) (-474.366) [-475.564] -- 0:00:19
694000 -- [-473.663] (-474.673) (-476.350) (-473.724) * (-475.028) (-475.224) [-476.613] (-475.584) -- 0:00:19
694500 -- (-474.992) [-474.633] (-478.293) (-476.120) * [-474.812] (-476.877) (-477.307) (-477.612) -- 0:00:19
695000 -- (-474.379) (-475.831) (-478.841) [-473.542] * (-475.345) (-475.214) (-475.394) [-474.282] -- 0:00:19
Average standard deviation of split frequencies: 0.008720
695500 -- (-474.318) (-478.064) [-478.386] (-476.411) * (-476.584) [-475.591] (-473.367) (-476.089) -- 0:00:19
696000 -- (-474.490) [-475.165] (-476.779) (-476.543) * (-475.585) [-475.803] (-477.636) (-476.315) -- 0:00:19
696500 -- (-477.546) [-473.966] (-476.856) (-475.848) * [-476.017] (-474.811) (-473.468) (-474.494) -- 0:00:19
697000 -- (-475.922) (-474.913) (-474.888) [-474.836] * [-474.543] (-475.073) (-473.830) (-474.319) -- 0:00:19
697500 -- (-476.007) (-475.135) [-473.716] (-474.679) * (-479.820) [-474.285] (-475.092) (-472.993) -- 0:00:19
698000 -- (-474.353) (-475.074) [-477.079] (-475.052) * (-474.332) (-483.899) (-475.096) [-474.486] -- 0:00:19
698500 -- [-473.363] (-474.283) (-478.291) (-475.191) * (-477.153) (-476.196) [-478.634] (-475.843) -- 0:00:18
699000 -- (-473.392) [-473.594] (-474.384) (-480.354) * (-474.111) (-476.310) [-475.163] (-477.013) -- 0:00:18
699500 -- (-475.814) (-473.394) [-475.878] (-485.230) * (-476.232) (-475.230) (-476.537) [-476.363] -- 0:00:18
700000 -- [-479.783] (-475.199) (-472.994) (-478.672) * (-478.317) (-474.859) [-474.115] (-475.598) -- 0:00:18
Average standard deviation of split frequencies: 0.008494
700500 -- (-477.750) [-475.013] (-476.623) (-475.671) * (-476.015) (-479.969) (-476.928) [-475.769] -- 0:00:18
701000 -- (-475.764) (-478.131) [-474.110] (-478.441) * (-473.975) (-476.133) (-475.993) [-474.923] -- 0:00:18
701500 -- (-476.090) (-478.933) [-474.333] (-477.366) * (-473.951) (-475.108) [-476.871] (-475.495) -- 0:00:18
702000 -- (-475.273) (-476.521) (-475.129) [-474.471] * (-475.334) (-477.510) (-474.915) [-474.913] -- 0:00:18
702500 -- [-475.550] (-475.541) (-477.600) (-477.535) * [-474.367] (-475.637) (-473.070) (-479.003) -- 0:00:18
703000 -- (-475.578) [-476.868] (-475.256) (-477.408) * [-476.788] (-477.546) (-478.314) (-474.652) -- 0:00:19
703500 -- (-474.266) (-474.016) (-478.151) [-475.893] * [-479.847] (-479.321) (-475.378) (-478.661) -- 0:00:18
704000 -- (-474.755) (-474.197) (-474.254) [-475.665] * (-476.159) (-476.653) (-477.992) [-476.877] -- 0:00:18
704500 -- [-475.998] (-475.656) (-477.923) (-474.264) * (-474.696) (-475.117) [-475.001] (-474.431) -- 0:00:18
705000 -- (-476.434) (-475.104) (-477.334) [-476.267] * [-473.579] (-475.101) (-474.254) (-475.505) -- 0:00:18
Average standard deviation of split frequencies: 0.008805
705500 -- (-473.724) [-473.779] (-477.758) (-476.473) * (-473.938) (-474.208) [-474.657] (-475.514) -- 0:00:18
706000 -- [-474.230] (-473.751) (-480.987) (-476.343) * [-473.535] (-476.340) (-478.345) (-475.130) -- 0:00:18
706500 -- [-477.291] (-474.351) (-481.384) (-475.154) * (-476.734) (-476.533) (-475.710) [-474.198] -- 0:00:18
707000 -- [-473.718] (-473.261) (-476.670) (-480.124) * (-477.069) (-478.254) (-474.786) [-474.184] -- 0:00:18
707500 -- (-476.103) (-473.957) [-474.502] (-474.654) * [-474.137] (-473.753) (-475.962) (-473.245) -- 0:00:18
708000 -- (-476.475) (-474.353) (-477.364) [-474.164] * [-474.071] (-474.061) (-474.740) (-475.772) -- 0:00:18
708500 -- (-477.119) [-473.426] (-478.259) (-477.400) * (-474.965) (-477.038) [-473.213] (-476.349) -- 0:00:18
709000 -- (-473.331) (-476.919) [-473.276] (-478.476) * [-476.950] (-476.320) (-473.804) (-476.439) -- 0:00:18
709500 -- (-475.429) (-475.989) [-473.127] (-477.530) * [-474.136] (-478.304) (-473.906) (-477.123) -- 0:00:18
710000 -- (-476.386) [-475.193] (-474.907) (-473.964) * (-474.899) [-475.526] (-473.161) (-475.643) -- 0:00:18
Average standard deviation of split frequencies: 0.008831
710500 -- (-478.276) (-478.737) [-475.626] (-476.440) * (-477.419) (-476.616) [-474.477] (-473.864) -- 0:00:18
711000 -- (-480.249) (-475.343) (-476.837) [-476.296] * (-473.953) [-478.138] (-476.244) (-474.360) -- 0:00:18
711500 -- [-473.834] (-481.960) (-476.947) (-475.723) * [-475.258] (-476.879) (-475.266) (-474.913) -- 0:00:18
712000 -- (-473.499) (-474.938) (-473.526) [-473.506] * (-475.613) (-478.294) (-475.260) [-476.125] -- 0:00:18
712500 -- (-474.129) (-478.181) [-474.752] (-474.326) * [-476.064] (-474.660) (-480.828) (-474.105) -- 0:00:18
713000 -- [-474.268] (-476.315) (-476.573) (-476.979) * (-474.934) (-474.190) [-473.453] (-473.689) -- 0:00:18
713500 -- (-477.159) (-476.263) (-475.049) [-475.695] * [-476.198] (-474.080) (-474.287) (-475.825) -- 0:00:18
714000 -- (-476.305) (-474.003) (-476.099) [-476.210] * (-474.510) (-474.496) (-474.445) [-476.372] -- 0:00:18
714500 -- (-474.734) (-473.828) [-475.447] (-473.411) * [-473.956] (-473.250) (-474.461) (-475.948) -- 0:00:17
715000 -- (-477.098) [-474.784] (-473.592) (-473.635) * (-474.134) (-478.824) [-479.600] (-475.843) -- 0:00:17
Average standard deviation of split frequencies: 0.007901
715500 -- (-474.591) (-477.206) (-474.575) [-474.654] * [-477.230] (-478.663) (-474.710) (-475.225) -- 0:00:17
716000 -- (-475.502) (-474.186) [-479.179] (-476.517) * [-473.368] (-476.319) (-474.319) (-474.353) -- 0:00:17
716500 -- (-473.922) [-475.185] (-479.074) (-474.527) * (-476.742) (-474.665) (-475.317) [-475.978] -- 0:00:17
717000 -- (-474.904) (-475.123) [-479.265] (-474.247) * [-475.866] (-481.892) (-474.690) (-475.394) -- 0:00:17
717500 -- (-476.855) (-474.060) (-477.537) [-475.142] * (-473.781) (-479.506) (-473.561) [-474.014] -- 0:00:17
718000 -- [-474.211] (-475.139) (-477.046) (-473.226) * (-478.916) [-474.442] (-474.311) (-473.700) -- 0:00:17
718500 -- (-473.134) (-476.024) [-477.675] (-474.390) * (-476.345) (-473.240) (-481.967) [-474.991] -- 0:00:17
719000 -- (-476.239) [-475.147] (-480.589) (-476.345) * (-474.540) (-474.557) [-478.005] (-476.927) -- 0:00:17
719500 -- [-474.133] (-473.230) (-476.661) (-473.199) * (-474.971) [-475.263] (-475.665) (-476.253) -- 0:00:17
720000 -- (-478.670) (-473.920) (-475.846) [-476.632] * (-476.693) [-476.730] (-473.482) (-473.722) -- 0:00:17
Average standard deviation of split frequencies: 0.007762
720500 -- [-477.171] (-474.175) (-474.536) (-475.139) * (-476.812) (-476.647) (-474.568) [-473.685] -- 0:00:17
721000 -- (-475.093) (-478.626) [-477.042] (-476.951) * [-473.828] (-476.429) (-473.212) (-475.773) -- 0:00:17
721500 -- [-474.789] (-476.493) (-473.587) (-479.531) * (-473.749) (-476.627) (-479.346) [-474.820] -- 0:00:17
722000 -- (-474.639) [-474.876] (-475.265) (-477.422) * (-473.168) (-478.321) [-478.505] (-473.945) -- 0:00:17
722500 -- (-474.531) [-474.469] (-475.744) (-474.507) * (-477.320) [-474.771] (-477.690) (-474.483) -- 0:00:17
723000 -- (-474.758) (-474.643) (-473.459) [-475.294] * (-474.842) [-474.040] (-478.431) (-474.325) -- 0:00:17
723500 -- [-474.534] (-475.709) (-480.036) (-479.020) * [-475.297] (-474.266) (-476.481) (-475.229) -- 0:00:17
724000 -- (-474.600) [-475.079] (-479.172) (-473.305) * (-474.829) (-475.079) (-474.066) [-473.395] -- 0:00:17
724500 -- [-474.035] (-477.997) (-479.154) (-474.761) * (-476.424) [-474.912] (-473.441) (-479.642) -- 0:00:17
725000 -- (-474.171) (-473.458) [-476.196] (-475.654) * [-477.602] (-475.232) (-474.407) (-475.930) -- 0:00:17
Average standard deviation of split frequencies: 0.008888
725500 -- (-474.430) (-488.536) (-474.602) [-475.157] * (-474.134) (-476.801) [-474.621] (-475.563) -- 0:00:17
726000 -- (-474.882) (-475.176) [-474.445] (-480.314) * (-475.787) (-474.907) (-478.106) [-477.039] -- 0:00:17
726500 -- (-475.254) [-473.850] (-476.865) (-475.015) * [-475.205] (-474.230) (-475.147) (-475.367) -- 0:00:17
727000 -- [-474.469] (-475.041) (-475.109) (-478.490) * (-474.910) (-478.785) [-473.948] (-473.214) -- 0:00:17
727500 -- (-477.270) [-474.294] (-474.560) (-475.661) * (-481.104) [-474.795] (-474.201) (-473.705) -- 0:00:17
728000 -- [-473.650] (-474.238) (-474.953) (-475.133) * (-476.148) (-474.301) (-475.552) [-473.301] -- 0:00:17
728500 -- [-476.043] (-476.866) (-474.764) (-475.455) * (-474.328) (-476.548) (-476.308) [-472.933] -- 0:00:17
729000 -- (-477.100) (-476.857) (-476.087) [-473.974] * (-477.765) (-474.406) [-473.485] (-481.947) -- 0:00:17
729500 -- (-474.446) [-477.880] (-473.304) (-481.345) * (-476.251) [-474.449] (-475.331) (-473.850) -- 0:00:17
730000 -- (-474.584) (-474.440) [-474.146] (-477.706) * (-474.765) (-475.547) (-477.392) [-476.285] -- 0:00:17
Average standard deviation of split frequencies: 0.009315
730500 -- (-478.592) (-473.411) (-475.479) [-474.215] * (-474.784) (-478.335) [-474.850] (-473.693) -- 0:00:16
731000 -- (-479.146) [-474.015] (-473.616) (-476.176) * (-475.418) (-476.613) [-475.365] (-474.325) -- 0:00:16
731500 -- (-477.391) (-473.874) (-473.247) [-476.981] * (-476.182) (-475.126) [-475.650] (-474.408) -- 0:00:16
732000 -- (-473.926) (-475.329) (-476.889) [-474.639] * (-474.810) (-475.685) (-474.343) [-473.847] -- 0:00:16
732500 -- (-475.283) [-473.755] (-477.602) (-476.172) * [-475.884] (-474.026) (-473.361) (-474.937) -- 0:00:16
733000 -- (-474.636) [-475.896] (-476.526) (-475.972) * (-475.685) (-474.814) (-475.436) [-474.829] -- 0:00:16
733500 -- (-473.898) (-475.045) [-480.008] (-482.078) * (-477.377) [-476.652] (-476.236) (-473.920) -- 0:00:16
734000 -- (-474.720) (-473.316) (-475.690) [-478.353] * [-477.718] (-476.396) (-476.748) (-473.282) -- 0:00:16
734500 -- (-475.438) (-476.759) [-474.056] (-476.603) * (-474.854) [-474.619] (-474.531) (-477.242) -- 0:00:16
735000 -- (-473.650) (-475.720) [-476.047] (-480.135) * (-475.973) (-480.681) (-478.024) [-473.457] -- 0:00:16
Average standard deviation of split frequencies: 0.008028
735500 -- [-473.632] (-478.245) (-475.664) (-476.018) * (-475.261) [-483.170] (-476.613) (-474.110) -- 0:00:16
736000 -- [-476.366] (-474.259) (-474.077) (-473.992) * [-475.194] (-474.541) (-475.133) (-473.836) -- 0:00:16
736500 -- (-476.687) (-474.744) (-476.843) [-474.858] * (-478.504) [-477.553] (-477.987) (-475.380) -- 0:00:16
737000 -- (-477.831) [-474.274] (-473.796) (-475.242) * (-475.588) (-475.604) (-485.670) [-475.412] -- 0:00:16
737500 -- (-476.307) (-473.463) [-474.234] (-477.160) * [-477.311] (-475.926) (-474.764) (-476.158) -- 0:00:16
738000 -- (-480.424) (-473.675) (-474.645) [-475.561] * (-475.449) (-474.292) [-474.037] (-477.312) -- 0:00:16
738500 -- [-475.444] (-473.370) (-476.391) (-477.008) * (-473.678) [-473.366] (-474.522) (-476.847) -- 0:00:16
739000 -- (-476.417) (-473.691) (-475.880) [-480.619] * [-477.933] (-478.331) (-474.386) (-475.352) -- 0:00:16
739500 -- [-476.518] (-476.733) (-478.918) (-476.368) * (-477.007) (-475.105) [-474.192] (-474.253) -- 0:00:16
740000 -- (-475.460) (-476.916) [-473.782] (-478.419) * (-474.468) (-473.630) (-474.155) [-473.097] -- 0:00:16
Average standard deviation of split frequencies: 0.009746
740500 -- (-475.839) (-474.209) [-475.908] (-475.621) * [-474.434] (-478.188) (-478.241) (-478.242) -- 0:00:16
741000 -- [-474.320] (-474.014) (-476.846) (-474.690) * (-480.527) (-476.295) [-474.005] (-476.893) -- 0:00:16
741500 -- (-475.595) [-479.470] (-474.434) (-474.915) * (-473.414) [-475.828] (-475.176) (-478.421) -- 0:00:16
742000 -- (-478.242) [-477.665] (-473.550) (-475.022) * (-473.767) [-478.481] (-473.074) (-475.124) -- 0:00:16
742500 -- [-475.521] (-480.573) (-474.037) (-476.599) * (-477.126) (-475.667) [-472.993] (-475.438) -- 0:00:16
743000 -- (-474.164) [-477.476] (-477.175) (-477.071) * (-475.463) [-474.501] (-474.354) (-476.828) -- 0:00:16
743500 -- [-474.046] (-474.445) (-477.254) (-476.774) * (-475.848) (-474.294) [-476.597] (-474.153) -- 0:00:16
744000 -- (-474.050) (-474.375) [-473.978] (-478.481) * [-477.130] (-477.146) (-475.082) (-474.050) -- 0:00:16
744500 -- (-474.182) [-473.876] (-476.312) (-478.143) * (-474.275) [-476.686] (-476.317) (-473.825) -- 0:00:16
745000 -- (-476.237) (-474.263) (-475.241) [-474.819] * (-476.027) (-475.862) [-476.025] (-474.472) -- 0:00:16
Average standard deviation of split frequencies: 0.009874
745500 -- (-474.362) (-477.030) [-474.450] (-474.899) * (-474.133) [-475.317] (-475.738) (-474.691) -- 0:00:16
746000 -- (-476.032) [-474.635] (-475.462) (-473.680) * [-475.394] (-477.301) (-475.501) (-481.246) -- 0:00:16
746500 -- [-477.702] (-475.219) (-478.758) (-474.650) * [-478.412] (-477.033) (-475.733) (-478.444) -- 0:00:15
747000 -- (-474.518) (-474.789) [-474.706] (-476.885) * (-476.560) [-474.701] (-475.465) (-476.256) -- 0:00:15
747500 -- (-477.856) (-473.425) [-476.672] (-480.135) * (-474.255) [-475.695] (-473.628) (-473.929) -- 0:00:15
748000 -- (-476.500) [-473.963] (-477.074) (-481.702) * [-474.118] (-475.844) (-474.336) (-474.723) -- 0:00:15
748500 -- (-476.400) (-475.006) [-475.300] (-474.440) * [-477.516] (-475.236) (-474.728) (-474.134) -- 0:00:15
749000 -- (-475.697) (-475.215) (-475.312) [-475.223] * [-476.660] (-475.249) (-474.167) (-476.656) -- 0:00:15
749500 -- (-476.780) (-474.775) (-474.895) [-476.058] * (-475.899) [-477.965] (-476.411) (-474.100) -- 0:00:15
750000 -- (-475.421) (-477.721) [-475.378] (-477.458) * (-474.813) (-476.120) (-479.206) [-474.221] -- 0:00:15
Average standard deviation of split frequencies: 0.009616
750500 -- (-481.570) (-476.814) (-474.803) [-476.724] * [-473.238] (-473.501) (-477.038) (-476.616) -- 0:00:15
751000 -- [-479.739] (-476.972) (-475.247) (-476.284) * (-475.026) (-476.857) (-475.644) [-475.230] -- 0:00:15
751500 -- (-476.253) (-475.258) (-474.494) [-476.181] * (-476.186) (-475.269) [-473.982] (-474.039) -- 0:00:15
752000 -- (-477.421) (-473.603) (-474.422) [-477.525] * [-477.074] (-473.973) (-477.359) (-475.705) -- 0:00:15
752500 -- (-473.836) (-481.645) [-476.296] (-478.519) * [-476.341] (-475.045) (-474.125) (-476.971) -- 0:00:15
753000 -- (-474.896) (-473.162) (-475.272) [-475.202] * (-473.396) (-474.942) [-473.626] (-475.074) -- 0:00:15
753500 -- (-475.226) (-476.011) (-474.837) [-478.313] * (-476.814) [-476.725] (-476.537) (-473.893) -- 0:00:15
754000 -- (-474.294) (-478.225) (-479.467) [-475.695] * (-478.350) [-473.396] (-477.318) (-474.300) -- 0:00:15
754500 -- (-475.370) [-476.098] (-478.118) (-480.784) * (-475.879) [-477.888] (-473.988) (-475.562) -- 0:00:15
755000 -- (-479.340) [-475.132] (-474.819) (-474.697) * (-474.155) (-478.486) [-475.449] (-478.648) -- 0:00:15
Average standard deviation of split frequencies: 0.009119
755500 -- (-479.095) [-476.200] (-475.021) (-474.966) * (-475.015) [-476.007] (-476.577) (-475.536) -- 0:00:15
756000 -- [-474.222] (-476.796) (-475.776) (-476.744) * (-473.704) (-476.454) (-475.545) [-474.845] -- 0:00:15
756500 -- (-474.944) (-473.189) (-477.515) [-474.247] * (-474.481) (-475.277) (-475.205) [-476.569] -- 0:00:15
757000 -- (-475.698) (-474.029) [-474.670] (-476.900) * (-473.888) (-479.111) (-475.235) [-478.657] -- 0:00:15
757500 -- [-476.995] (-477.079) (-476.584) (-480.882) * (-477.971) [-476.084] (-474.735) (-476.871) -- 0:00:15
758000 -- (-477.550) (-475.416) (-474.979) [-477.379] * (-477.791) (-473.916) (-475.818) [-474.239] -- 0:00:15
758500 -- (-474.602) [-477.672] (-474.874) (-475.069) * (-476.323) [-474.693] (-474.249) (-473.829) -- 0:00:15
759000 -- (-473.933) (-487.168) (-475.951) [-475.238] * (-475.762) (-483.834) (-474.404) [-479.388] -- 0:00:15
759500 -- (-476.817) (-478.208) [-475.762] (-476.787) * (-475.187) (-474.845) [-479.195] (-480.436) -- 0:00:15
760000 -- (-476.920) [-474.099] (-476.029) (-474.743) * (-480.453) [-474.966] (-474.591) (-476.711) -- 0:00:15
Average standard deviation of split frequencies: 0.009141
760500 -- (-476.990) (-475.870) [-474.570] (-477.902) * [-477.369] (-473.676) (-473.311) (-480.649) -- 0:00:15
761000 -- (-476.059) [-475.492] (-474.874) (-475.294) * (-474.242) (-477.237) [-475.906] (-480.715) -- 0:00:15
761500 -- (-475.390) (-473.475) [-475.131] (-479.132) * (-474.855) [-475.234] (-476.304) (-476.525) -- 0:00:15
762000 -- (-474.958) (-473.417) [-475.416] (-475.731) * (-474.676) [-477.574] (-475.833) (-476.381) -- 0:00:14
762500 -- (-475.259) [-474.871] (-477.456) (-479.168) * [-473.969] (-475.460) (-475.577) (-477.367) -- 0:00:14
763000 -- (-475.500) (-477.230) (-473.885) [-473.459] * (-473.465) (-474.360) [-473.967] (-474.162) -- 0:00:14
763500 -- (-474.211) (-475.031) (-473.463) [-474.116] * (-475.259) (-477.097) (-475.517) [-476.327] -- 0:00:14
764000 -- (-476.532) (-475.696) (-474.575) [-475.169] * [-476.723] (-480.150) (-476.508) (-476.172) -- 0:00:14
764500 -- (-475.140) [-477.812] (-474.915) (-475.251) * (-473.374) (-475.253) (-474.975) [-473.102] -- 0:00:14
765000 -- (-474.400) (-474.443) (-475.969) [-475.294] * [-474.689] (-474.445) (-475.546) (-473.996) -- 0:00:14
Average standard deviation of split frequencies: 0.009577
765500 -- [-477.234] (-475.702) (-479.925) (-474.049) * (-475.617) [-474.609] (-474.503) (-473.412) -- 0:00:14
766000 -- (-473.261) (-474.933) (-476.298) [-475.377] * (-474.666) (-474.591) (-474.929) [-473.628] -- 0:00:14
766500 -- [-474.841] (-475.915) (-475.962) (-473.859) * (-477.290) [-474.472] (-479.255) (-475.036) -- 0:00:14
767000 -- (-477.206) [-475.246] (-478.258) (-476.762) * [-475.039] (-473.811) (-481.639) (-477.932) -- 0:00:14
767500 -- (-481.857) [-476.744] (-476.278) (-478.682) * [-474.540] (-474.654) (-477.245) (-475.329) -- 0:00:14
768000 -- [-474.806] (-473.788) (-475.751) (-476.945) * (-473.433) (-473.070) [-483.481] (-476.291) -- 0:00:14
768500 -- (-473.214) [-475.263] (-476.588) (-474.249) * [-476.028] (-474.110) (-479.112) (-474.689) -- 0:00:14
769000 -- [-474.419] (-475.506) (-473.251) (-474.495) * (-476.415) [-478.486] (-475.768) (-475.562) -- 0:00:14
769500 -- (-473.816) (-474.826) [-474.931] (-478.287) * (-474.679) (-475.557) [-475.541] (-473.071) -- 0:00:14
770000 -- (-475.082) (-477.677) [-474.834] (-479.024) * (-474.631) [-473.545] (-474.618) (-474.658) -- 0:00:14
Average standard deviation of split frequencies: 0.009481
770500 -- (-474.681) (-479.283) (-476.479) [-475.085] * (-475.656) (-475.605) [-474.685] (-477.988) -- 0:00:14
771000 -- [-474.882] (-480.182) (-475.578) (-479.353) * [-476.319] (-473.605) (-473.398) (-473.536) -- 0:00:14
771500 -- [-475.167] (-476.252) (-475.299) (-477.975) * (-473.691) (-476.343) [-473.396] (-472.961) -- 0:00:14
772000 -- (-476.708) (-475.967) (-474.910) [-475.742] * [-473.021] (-476.177) (-475.032) (-475.400) -- 0:00:14
772500 -- (-477.641) [-473.885] (-475.849) (-476.483) * [-474.575] (-475.339) (-479.781) (-475.443) -- 0:00:14
773000 -- (-478.126) (-475.160) [-478.228] (-475.867) * [-474.557] (-473.948) (-473.991) (-475.621) -- 0:00:14
773500 -- (-475.651) (-475.073) [-476.426] (-476.390) * (-475.484) [-474.321] (-473.659) (-475.706) -- 0:00:14
774000 -- (-474.383) (-477.396) (-477.604) [-474.090] * (-476.311) (-474.495) (-479.269) [-475.834] -- 0:00:14
774500 -- [-476.316] (-476.551) (-479.702) (-478.764) * (-477.426) [-477.185] (-474.348) (-474.463) -- 0:00:14
775000 -- (-476.039) (-477.098) [-476.315] (-474.973) * [-477.036] (-474.196) (-474.383) (-475.314) -- 0:00:14
Average standard deviation of split frequencies: 0.009378
775500 -- [-476.216] (-476.957) (-474.795) (-474.954) * [-476.462] (-478.596) (-474.342) (-475.716) -- 0:00:14
776000 -- (-476.068) [-475.738] (-473.987) (-473.986) * [-475.400] (-474.945) (-476.494) (-474.135) -- 0:00:14
776500 -- (-479.486) (-477.799) (-473.803) [-473.979] * (-475.695) [-481.105] (-475.574) (-473.712) -- 0:00:14
777000 -- [-476.883] (-474.197) (-475.627) (-473.682) * [-473.695] (-477.385) (-474.311) (-475.927) -- 0:00:14
777500 -- (-476.012) (-476.442) [-473.080] (-475.100) * (-473.475) (-477.941) (-473.365) [-477.985] -- 0:00:14
778000 -- [-474.386] (-477.136) (-475.799) (-473.362) * (-477.440) (-475.044) [-473.207] (-477.037) -- 0:00:13
778500 -- (-474.153) (-478.151) (-479.826) [-474.445] * (-474.188) [-473.505] (-475.456) (-473.174) -- 0:00:13
779000 -- (-476.433) (-475.122) [-474.399] (-473.571) * (-476.651) (-474.096) [-476.661] (-474.700) -- 0:00:13
779500 -- (-483.307) (-478.569) [-475.569] (-476.741) * (-482.175) (-478.407) (-476.563) [-474.438] -- 0:00:13
780000 -- (-474.931) (-479.389) (-475.549) [-474.227] * (-474.527) (-475.466) (-473.067) [-477.341] -- 0:00:13
Average standard deviation of split frequencies: 0.009964
780500 -- [-474.224] (-474.194) (-474.387) (-475.391) * (-474.790) [-474.061] (-474.572) (-474.649) -- 0:00:13
781000 -- (-474.536) [-474.539] (-476.026) (-476.393) * (-475.817) (-479.451) (-473.856) [-473.883] -- 0:00:13
781500 -- (-473.850) (-475.906) (-473.955) [-476.725] * (-473.505) (-478.062) (-473.975) [-474.875] -- 0:00:13
782000 -- (-473.924) [-476.101] (-474.695) (-474.315) * (-475.378) [-476.670] (-474.536) (-474.021) -- 0:00:13
782500 -- [-475.841] (-478.916) (-473.225) (-479.288) * (-474.550) [-474.009] (-474.739) (-473.951) -- 0:00:13
783000 -- (-474.678) (-476.702) [-476.280] (-474.116) * (-478.771) [-474.710] (-477.738) (-475.916) -- 0:00:13
783500 -- (-478.815) [-473.373] (-477.465) (-473.512) * (-476.476) (-479.999) (-477.381) [-474.748] -- 0:00:13
784000 -- (-473.711) (-473.147) (-475.318) [-477.295] * [-473.446] (-479.924) (-475.363) (-476.840) -- 0:00:13
784500 -- (-478.587) (-474.498) [-473.266] (-475.636) * (-474.403) (-473.598) [-475.823] (-475.928) -- 0:00:13
785000 -- (-475.008) (-473.666) [-478.052] (-475.938) * (-475.199) [-476.644] (-475.513) (-473.366) -- 0:00:13
Average standard deviation of split frequencies: 0.010271
785500 -- (-474.679) (-475.619) (-474.480) [-475.404] * [-473.559] (-475.547) (-474.739) (-473.300) -- 0:00:13
786000 -- (-476.346) [-474.424] (-477.343) (-476.343) * (-473.483) [-475.616] (-475.025) (-475.980) -- 0:00:13
786500 -- (-473.748) (-478.097) (-475.032) [-474.326] * (-478.616) (-480.663) (-475.593) [-476.012] -- 0:00:13
787000 -- (-476.603) (-474.034) [-474.790] (-479.050) * [-475.828] (-475.170) (-477.514) (-476.978) -- 0:00:13
787500 -- (-474.966) [-472.974] (-476.520) (-473.355) * [-474.742] (-478.397) (-473.658) (-474.412) -- 0:00:13
788000 -- (-474.899) (-475.173) (-475.390) [-473.355] * [-473.064] (-481.397) (-474.545) (-476.429) -- 0:00:13
788500 -- (-473.208) [-474.453] (-476.501) (-476.112) * (-473.372) (-479.067) (-474.068) [-475.238] -- 0:00:13
789000 -- (-473.944) (-474.879) [-473.712] (-476.039) * [-473.289] (-479.311) (-480.458) (-474.926) -- 0:00:13
789500 -- (-473.901) (-477.793) [-474.402] (-477.816) * (-474.138) [-476.607] (-477.360) (-476.016) -- 0:00:13
790000 -- (-473.745) (-474.450) (-476.313) [-474.953] * (-479.887) (-475.635) [-477.699] (-477.110) -- 0:00:13
Average standard deviation of split frequencies: 0.009837
790500 -- [-474.166] (-474.333) (-475.759) (-474.772) * (-475.705) (-477.648) [-474.261] (-476.166) -- 0:00:13
791000 -- (-476.904) (-477.051) [-478.914] (-474.018) * (-473.832) [-473.299] (-474.884) (-476.533) -- 0:00:13
791500 -- (-478.890) [-478.284] (-479.357) (-475.319) * (-475.308) (-473.337) (-479.071) [-475.527] -- 0:00:13
792000 -- [-474.362] (-478.270) (-480.088) (-475.204) * (-475.887) [-473.548] (-476.897) (-475.903) -- 0:00:13
792500 -- (-473.981) (-475.411) [-475.625] (-477.011) * (-477.835) [-473.485] (-474.132) (-475.530) -- 0:00:13
793000 -- (-474.981) (-474.126) (-477.344) [-474.742] * (-474.668) [-475.149] (-474.466) (-481.676) -- 0:00:13
793500 -- [-474.500] (-474.740) (-475.083) (-476.027) * (-475.404) (-476.156) [-476.836] (-476.824) -- 0:00:13
794000 -- [-478.250] (-474.597) (-475.903) (-475.252) * (-473.228) (-475.459) [-476.416] (-473.494) -- 0:00:12
794500 -- (-474.466) (-478.276) (-474.848) [-478.051] * [-472.974] (-474.324) (-475.237) (-474.680) -- 0:00:12
795000 -- (-476.040) (-476.087) (-477.138) [-478.359] * (-473.302) (-476.088) (-473.834) [-474.026] -- 0:00:12
Average standard deviation of split frequencies: 0.009661
795500 -- (-476.134) [-477.015] (-475.489) (-478.313) * (-475.300) (-475.090) (-476.295) [-473.998] -- 0:00:12
796000 -- (-474.965) (-473.314) [-473.351] (-476.239) * (-474.466) (-475.535) (-475.656) [-477.740] -- 0:00:12
796500 -- [-475.732] (-475.729) (-473.355) (-475.030) * [-474.289] (-476.983) (-475.482) (-474.917) -- 0:00:12
797000 -- (-477.400) (-475.099) (-473.402) [-474.028] * [-475.104] (-475.612) (-473.601) (-475.581) -- 0:00:12
797500 -- [-477.038] (-477.485) (-473.768) (-475.022) * (-476.864) (-474.136) (-475.362) [-475.430] -- 0:00:12
798000 -- (-477.881) [-474.144] (-476.689) (-474.947) * (-475.821) (-473.645) (-475.263) [-475.188] -- 0:00:12
798500 -- (-475.552) (-474.899) (-477.835) [-475.388] * (-473.608) (-474.058) [-476.182] (-473.404) -- 0:00:12
799000 -- (-474.307) (-475.332) [-475.542] (-473.221) * (-479.518) (-474.415) [-473.842] (-476.463) -- 0:00:12
799500 -- (-475.414) (-477.441) [-475.418] (-474.986) * (-473.823) (-475.871) [-473.724] (-474.473) -- 0:00:12
800000 -- [-477.310] (-478.980) (-476.197) (-475.555) * (-478.353) [-474.487] (-474.235) (-473.729) -- 0:00:12
Average standard deviation of split frequencies: 0.010083
800500 -- [-479.324] (-474.248) (-473.994) (-475.111) * (-474.857) [-474.368] (-473.836) (-473.584) -- 0:00:12
801000 -- (-475.516) (-477.221) [-473.970] (-475.071) * (-475.654) (-474.186) [-475.288] (-476.515) -- 0:00:12
801500 -- (-475.232) (-475.557) [-475.737] (-474.525) * (-472.863) (-475.819) [-474.824] (-476.916) -- 0:00:12
802000 -- [-475.521] (-478.008) (-474.497) (-476.106) * (-475.380) [-475.732] (-473.793) (-478.126) -- 0:00:12
802500 -- (-475.345) [-476.620] (-472.872) (-473.762) * [-474.150] (-475.291) (-474.389) (-479.039) -- 0:00:12
803000 -- (-475.053) (-474.844) [-473.809] (-474.284) * (-473.403) (-480.729) [-473.393] (-476.635) -- 0:00:12
803500 -- (-474.751) [-476.561] (-475.055) (-477.204) * (-477.421) [-475.016] (-477.381) (-474.919) -- 0:00:12
804000 -- (-473.645) (-478.353) [-475.617] (-478.166) * (-475.461) (-476.578) [-474.546] (-479.607) -- 0:00:12
804500 -- [-474.684] (-474.425) (-476.164) (-477.076) * (-474.892) [-473.969] (-477.158) (-475.019) -- 0:00:12
805000 -- (-477.572) (-477.352) (-473.651) [-474.946] * (-474.554) [-474.578] (-476.447) (-479.528) -- 0:00:12
Average standard deviation of split frequencies: 0.010272
805500 -- (-474.388) [-474.583] (-478.923) (-474.056) * (-474.692) [-477.050] (-476.062) (-473.714) -- 0:00:12
806000 -- [-477.415] (-474.471) (-481.640) (-482.082) * [-473.062] (-478.720) (-474.733) (-475.957) -- 0:00:12
806500 -- (-474.569) (-478.761) [-474.149] (-474.899) * (-474.994) (-475.139) [-475.019] (-475.107) -- 0:00:12
807000 -- (-473.331) (-480.109) [-477.290] (-475.191) * (-474.785) [-474.475] (-478.906) (-476.084) -- 0:00:12
807500 -- (-473.368) (-477.512) (-474.563) [-473.810] * [-473.672] (-475.569) (-473.525) (-473.399) -- 0:00:12
808000 -- (-473.452) (-475.783) (-476.030) [-476.797] * (-474.455) (-475.814) [-473.123] (-473.894) -- 0:00:12
808500 -- [-473.242] (-473.861) (-475.932) (-477.182) * (-477.556) [-474.605] (-473.120) (-474.036) -- 0:00:12
809000 -- (-474.426) (-477.890) [-477.289] (-477.045) * (-477.046) (-475.137) [-473.224] (-478.877) -- 0:00:12
809500 -- [-474.985] (-476.425) (-476.365) (-474.587) * (-475.933) (-477.369) [-474.079] (-473.439) -- 0:00:12
810000 -- (-477.812) [-477.801] (-473.397) (-476.779) * [-477.882] (-474.478) (-477.453) (-474.403) -- 0:00:11
Average standard deviation of split frequencies: 0.009813
810500 -- [-475.991] (-477.164) (-473.709) (-478.946) * (-475.314) (-473.404) [-473.662] (-475.164) -- 0:00:11
811000 -- [-476.211] (-473.832) (-473.978) (-479.979) * (-475.615) (-476.178) [-473.762] (-474.461) -- 0:00:11
811500 -- (-474.595) (-476.146) [-473.906] (-474.872) * [-473.969] (-475.048) (-473.963) (-473.760) -- 0:00:11
812000 -- (-476.504) [-475.420] (-475.259) (-475.240) * (-474.146) [-477.600] (-475.047) (-474.403) -- 0:00:11
812500 -- (-478.823) [-474.020] (-473.896) (-478.257) * (-476.835) [-477.256] (-474.175) (-481.073) -- 0:00:11
813000 -- [-474.596] (-476.567) (-477.242) (-476.581) * (-474.386) [-475.584] (-473.957) (-474.319) -- 0:00:11
813500 -- (-478.423) (-474.234) [-474.800] (-474.734) * (-475.102) (-476.009) [-479.394] (-478.144) -- 0:00:11
814000 -- (-476.100) [-474.256] (-475.340) (-474.635) * (-478.470) (-477.165) [-476.730] (-474.530) -- 0:00:11
814500 -- (-475.969) (-480.728) [-474.189] (-474.399) * [-475.137] (-474.322) (-474.751) (-476.830) -- 0:00:11
815000 -- (-474.127) (-474.676) [-476.117] (-477.092) * (-474.452) (-474.416) [-473.472] (-477.045) -- 0:00:11
Average standard deviation of split frequencies: 0.009821
815500 -- (-474.309) (-476.310) [-475.513] (-475.853) * (-475.323) [-477.282] (-477.207) (-476.397) -- 0:00:11
816000 -- (-474.758) (-474.782) [-475.027] (-475.362) * (-474.566) (-475.064) (-479.958) [-474.752] -- 0:00:11
816500 -- (-478.001) (-474.463) [-476.706] (-475.583) * (-475.627) [-475.741] (-474.010) (-473.461) -- 0:00:11
817000 -- (-476.065) [-474.308] (-474.110) (-476.323) * (-480.964) (-473.581) [-473.283] (-474.669) -- 0:00:11
817500 -- (-473.278) (-475.783) [-476.144] (-479.438) * (-476.569) (-475.956) (-473.092) [-475.766] -- 0:00:11
818000 -- (-474.279) (-475.336) (-481.382) [-482.320] * (-474.579) (-475.406) (-473.946) [-474.364] -- 0:00:11
818500 -- (-474.948) (-474.974) (-476.015) [-475.210] * (-478.256) (-476.960) [-474.551] (-474.726) -- 0:00:11
819000 -- (-477.419) [-474.937] (-477.013) (-477.701) * (-474.865) (-476.369) (-478.091) [-475.332] -- 0:00:11
819500 -- (-476.521) (-478.802) [-475.652] (-474.623) * (-474.994) (-475.132) [-473.730] (-477.729) -- 0:00:11
820000 -- (-481.314) (-476.696) [-475.210] (-479.028) * (-475.219) (-478.114) [-474.117] (-474.823) -- 0:00:11
Average standard deviation of split frequencies: 0.009550
820500 -- (-475.914) [-476.863] (-476.037) (-474.968) * [-476.921] (-474.460) (-476.929) (-474.823) -- 0:00:11
821000 -- (-473.154) (-476.688) [-475.546] (-475.357) * [-475.812] (-474.117) (-474.134) (-475.370) -- 0:00:11
821500 -- [-473.836] (-477.978) (-474.667) (-475.985) * (-474.454) (-474.020) (-478.473) [-474.908] -- 0:00:11
822000 -- (-473.851) (-474.112) [-474.957] (-477.616) * (-473.608) (-473.833) [-478.203] (-476.639) -- 0:00:11
822500 -- (-475.427) (-478.196) (-475.716) [-473.831] * (-474.507) (-473.913) [-475.268] (-477.110) -- 0:00:11
823000 -- (-475.574) (-473.499) [-475.383] (-476.578) * [-474.563] (-476.418) (-481.359) (-476.142) -- 0:00:11
823500 -- (-475.252) (-472.889) (-479.556) [-476.454] * (-473.197) [-476.424] (-477.309) (-474.636) -- 0:00:11
824000 -- (-479.674) (-476.341) [-475.650] (-476.698) * (-476.017) (-475.939) (-479.436) [-474.667] -- 0:00:11
824500 -- (-473.730) [-477.563] (-478.841) (-475.179) * (-474.441) (-475.600) (-476.763) [-475.171] -- 0:00:11
825000 -- (-476.150) (-476.778) (-475.000) [-476.619] * [-474.870] (-478.751) (-474.610) (-479.037) -- 0:00:11
Average standard deviation of split frequencies: 0.009631
825500 -- (-474.737) (-481.716) (-475.537) [-474.645] * (-475.628) (-475.855) [-473.915] (-475.824) -- 0:00:10
826000 -- [-475.434] (-474.103) (-475.792) (-474.000) * (-473.847) [-473.765] (-473.789) (-478.344) -- 0:00:10
826500 -- (-476.107) (-475.570) [-474.616] (-478.872) * (-476.273) (-475.532) (-477.068) [-474.637] -- 0:00:10
827000 -- (-477.360) [-475.121] (-473.890) (-476.527) * (-473.413) (-473.381) (-476.794) [-475.316] -- 0:00:10
827500 -- (-476.526) (-474.777) [-473.432] (-475.392) * (-474.670) (-475.424) (-476.219) [-475.861] -- 0:00:10
828000 -- (-474.409) [-475.176] (-475.395) (-474.918) * (-474.532) (-475.907) [-476.600] (-475.508) -- 0:00:10
828500 -- [-473.418] (-475.812) (-473.388) (-475.052) * [-477.575] (-476.527) (-475.412) (-474.080) -- 0:00:10
829000 -- (-475.033) (-474.511) [-473.824] (-475.834) * (-475.571) (-473.949) [-475.285] (-474.670) -- 0:00:10
829500 -- (-474.349) (-473.494) (-476.244) [-475.862] * (-473.833) (-475.268) (-473.816) [-478.902] -- 0:00:10
830000 -- (-474.456) [-473.881] (-473.614) (-479.954) * (-476.965) (-476.182) (-475.671) [-477.807] -- 0:00:10
Average standard deviation of split frequencies: 0.009293
830500 -- [-476.824] (-473.760) (-475.538) (-476.324) * (-475.364) (-479.939) [-473.966] (-475.345) -- 0:00:10
831000 -- [-473.390] (-475.590) (-474.258) (-473.573) * [-473.389] (-476.184) (-475.330) (-474.613) -- 0:00:10
831500 -- [-477.790] (-477.441) (-474.960) (-474.420) * (-476.955) [-474.189] (-475.573) (-475.422) -- 0:00:10
832000 -- (-475.298) (-478.464) [-474.506] (-475.906) * [-473.890] (-481.489) (-480.011) (-477.329) -- 0:00:10
832500 -- (-474.282) [-475.432] (-479.359) (-475.145) * [-476.793] (-475.698) (-475.664) (-478.221) -- 0:00:10
833000 -- (-475.477) [-475.118] (-473.798) (-473.038) * [-473.445] (-473.987) (-475.225) (-474.904) -- 0:00:10
833500 -- (-473.594) (-477.098) (-474.318) [-473.743] * (-473.776) (-472.973) [-473.127] (-476.097) -- 0:00:10
834000 -- (-475.246) [-477.966] (-475.255) (-475.672) * (-478.976) (-475.532) (-474.368) [-475.591] -- 0:00:10
834500 -- [-477.054] (-476.281) (-474.563) (-479.961) * (-474.228) (-478.520) (-473.226) [-478.706] -- 0:00:10
835000 -- (-474.000) [-475.187] (-473.258) (-475.069) * (-479.090) (-475.817) (-474.290) [-473.423] -- 0:00:10
Average standard deviation of split frequencies: 0.009339
835500 -- (-474.713) (-474.022) [-474.123] (-474.789) * (-479.969) (-475.641) (-473.808) [-473.396] -- 0:00:10
836000 -- (-473.704) [-473.517] (-474.451) (-474.255) * [-475.856] (-479.985) (-475.265) (-474.628) -- 0:00:10
836500 -- (-474.059) (-475.753) (-474.550) [-476.958] * (-476.209) (-474.987) [-475.245] (-476.053) -- 0:00:10
837000 -- [-473.541] (-475.655) (-475.111) (-475.675) * (-474.606) (-482.305) (-476.690) [-475.619] -- 0:00:10
837500 -- (-473.353) (-474.692) (-474.379) [-478.030] * [-473.672] (-483.104) (-478.617) (-478.824) -- 0:00:10
838000 -- [-473.291] (-473.783) (-476.362) (-477.228) * (-474.874) (-477.558) [-474.759] (-475.264) -- 0:00:10
838500 -- (-473.823) (-481.781) [-477.056] (-473.656) * [-475.878] (-475.176) (-475.923) (-474.406) -- 0:00:10
839000 -- [-478.122] (-479.553) (-476.296) (-477.028) * (-475.597) [-473.460] (-473.381) (-476.090) -- 0:00:10
839500 -- (-474.651) [-473.395] (-476.074) (-476.610) * (-476.371) (-477.464) [-473.905] (-474.665) -- 0:00:10
840000 -- (-477.953) (-473.734) (-474.545) [-473.874] * [-473.862] (-475.828) (-474.184) (-477.110) -- 0:00:10
Average standard deviation of split frequencies: 0.009393
840500 -- (-479.266) [-474.098] (-473.611) (-473.619) * (-475.841) [-474.815] (-473.535) (-475.037) -- 0:00:10
841000 -- (-476.395) (-475.420) (-480.773) [-474.868] * (-475.711) [-474.613] (-475.094) (-479.660) -- 0:00:10
841500 -- (-475.357) (-480.273) [-476.030] (-476.725) * (-474.064) (-474.684) [-474.639] (-474.965) -- 0:00:09
842000 -- (-475.378) (-478.730) (-477.954) [-478.705] * (-476.949) [-477.100] (-476.315) (-473.779) -- 0:00:09
842500 -- (-472.967) (-475.815) (-474.528) [-473.886] * [-473.800] (-476.535) (-474.860) (-473.225) -- 0:00:09
843000 -- [-473.466] (-477.399) (-475.097) (-473.927) * (-473.452) [-475.215] (-477.462) (-476.252) -- 0:00:09
843500 -- (-473.901) (-475.045) [-473.849] (-475.081) * [-476.125] (-478.129) (-477.255) (-475.870) -- 0:00:09
844000 -- [-474.218] (-476.387) (-477.979) (-473.395) * (-474.326) [-474.707] (-473.843) (-476.117) -- 0:00:09
844500 -- [-474.393] (-473.164) (-478.693) (-473.973) * [-475.320] (-476.049) (-475.069) (-477.375) -- 0:00:09
845000 -- (-475.858) [-475.265] (-474.331) (-474.671) * (-475.940) (-475.970) [-474.274] (-475.830) -- 0:00:09
Average standard deviation of split frequencies: 0.009299
845500 -- (-476.586) [-473.305] (-473.829) (-474.074) * (-474.166) (-474.563) (-474.191) [-475.018] -- 0:00:09
846000 -- (-474.096) (-474.436) (-475.131) [-473.238] * (-481.634) [-473.562] (-476.114) (-476.542) -- 0:00:09
846500 -- (-477.044) (-473.859) (-474.169) [-473.304] * (-481.860) [-474.105] (-473.455) (-476.053) -- 0:00:09
847000 -- (-479.309) [-474.340] (-474.569) (-477.197) * (-476.846) (-475.193) (-477.208) [-474.683] -- 0:00:09
847500 -- (-476.221) (-474.080) (-476.212) [-476.045] * (-475.102) (-477.273) [-476.977] (-476.448) -- 0:00:09
848000 -- (-476.325) [-474.524] (-475.907) (-477.803) * (-476.186) (-474.759) (-473.966) [-480.127] -- 0:00:09
848500 -- [-473.263] (-473.644) (-474.994) (-475.108) * [-476.705] (-474.377) (-476.809) (-476.210) -- 0:00:09
849000 -- (-473.707) (-474.488) [-476.108] (-476.933) * [-475.375] (-476.910) (-473.285) (-474.515) -- 0:00:09
849500 -- (-474.524) (-474.252) [-476.055] (-476.311) * (-475.153) [-474.994] (-474.323) (-474.883) -- 0:00:09
850000 -- (-473.463) (-475.727) (-474.941) [-477.866] * [-473.818] (-474.005) (-475.423) (-474.457) -- 0:00:09
Average standard deviation of split frequencies: 0.009525
850500 -- [-473.281] (-477.758) (-475.162) (-477.622) * (-473.956) [-473.195] (-477.593) (-474.451) -- 0:00:09
851000 -- (-475.390) [-477.338] (-475.861) (-474.384) * (-475.232) [-473.598] (-473.919) (-476.032) -- 0:00:09
851500 -- [-480.268] (-479.788) (-474.398) (-476.950) * [-477.681] (-479.210) (-475.145) (-473.851) -- 0:00:09
852000 -- [-479.462] (-481.463) (-474.617) (-477.091) * (-477.199) (-477.989) (-473.806) [-479.401] -- 0:00:09
852500 -- (-473.590) [-474.528] (-473.138) (-473.605) * [-474.628] (-475.666) (-475.337) (-478.107) -- 0:00:09
853000 -- (-473.314) [-476.549] (-473.913) (-474.178) * [-474.699] (-475.411) (-474.901) (-477.234) -- 0:00:09
853500 -- (-474.904) (-475.030) (-474.035) [-474.738] * [-476.099] (-474.656) (-473.617) (-475.222) -- 0:00:09
854000 -- (-473.828) (-476.654) (-473.357) [-477.781] * (-473.738) (-474.424) [-474.265] (-475.266) -- 0:00:09
854500 -- (-474.011) (-474.203) (-475.134) [-473.154] * (-473.436) [-474.876] (-474.962) (-475.667) -- 0:00:09
855000 -- (-475.925) (-476.691) [-475.856] (-474.989) * [-474.078] (-474.010) (-477.745) (-476.379) -- 0:00:09
Average standard deviation of split frequencies: 0.008334
855500 -- [-474.226] (-475.193) (-473.632) (-474.472) * [-476.151] (-477.199) (-474.430) (-479.393) -- 0:00:09
856000 -- (-479.058) (-475.201) [-473.473] (-477.157) * [-473.713] (-474.247) (-473.476) (-475.822) -- 0:00:09
856500 -- (-478.231) [-473.555] (-474.642) (-477.721) * [-478.568] (-473.953) (-476.216) (-474.901) -- 0:00:09
857000 -- [-475.108] (-473.443) (-473.120) (-473.085) * (-477.586) (-477.722) (-477.112) [-476.311] -- 0:00:09
857500 -- (-475.277) (-473.117) (-474.840) [-473.460] * (-476.008) (-476.490) (-477.976) [-476.216] -- 0:00:08
858000 -- (-476.507) (-476.962) (-478.514) [-473.058] * (-477.027) (-475.960) [-476.901] (-473.978) -- 0:00:08
858500 -- [-476.789] (-475.468) (-475.341) (-472.991) * (-475.285) (-475.276) [-473.833] (-478.707) -- 0:00:08
859000 -- (-474.441) (-473.804) (-478.743) [-473.936] * (-474.210) [-474.367] (-473.994) (-479.425) -- 0:00:08
859500 -- [-474.210] (-475.739) (-477.850) (-475.196) * (-475.509) (-478.903) [-473.828] (-478.836) -- 0:00:08
860000 -- (-474.812) (-474.852) [-474.113] (-474.647) * (-473.264) [-475.511] (-475.163) (-473.810) -- 0:00:08
Average standard deviation of split frequencies: 0.008033
860500 -- (-477.989) [-474.658] (-475.741) (-480.410) * (-473.929) (-479.619) (-476.902) [-474.963] -- 0:00:08
861000 -- (-474.208) (-474.342) [-475.581] (-474.061) * (-474.729) (-475.486) (-475.987) [-473.513] -- 0:00:08
861500 -- (-475.620) (-474.928) (-477.309) [-474.588] * (-474.176) (-481.051) (-475.472) [-476.295] -- 0:00:08
862000 -- (-473.848) (-476.390) (-474.504) [-477.321] * (-473.823) (-478.177) (-475.104) [-474.347] -- 0:00:08
862500 -- (-476.642) (-478.269) (-476.402) [-479.872] * [-474.741] (-475.823) (-474.966) (-476.120) -- 0:00:08
863000 -- (-475.519) (-473.774) (-476.169) [-477.954] * (-474.655) (-475.954) [-474.154] (-477.411) -- 0:00:08
863500 -- [-474.947] (-475.208) (-475.768) (-475.206) * (-474.869) (-476.224) [-473.551] (-478.219) -- 0:00:08
864000 -- (-475.400) (-479.728) [-475.997] (-473.625) * (-475.225) [-474.549] (-473.756) (-477.438) -- 0:00:08
864500 -- (-477.340) (-475.766) (-475.115) [-480.390] * (-475.107) [-475.202] (-475.055) (-474.459) -- 0:00:08
865000 -- (-474.829) (-477.792) (-473.316) [-473.617] * (-473.959) [-474.957] (-473.145) (-474.584) -- 0:00:08
Average standard deviation of split frequencies: 0.007984
865500 -- (-473.690) [-478.107] (-474.445) (-477.391) * [-478.149] (-473.706) (-474.361) (-476.160) -- 0:00:08
866000 -- (-473.848) [-477.961] (-474.307) (-473.810) * (-479.662) (-474.558) [-474.723] (-477.212) -- 0:00:08
866500 -- [-474.265] (-477.400) (-475.961) (-473.954) * (-475.450) (-477.716) (-474.990) [-478.731] -- 0:00:08
867000 -- [-477.217] (-474.970) (-475.927) (-474.581) * (-480.690) [-476.156] (-476.061) (-475.001) -- 0:00:08
867500 -- (-476.047) [-473.951] (-476.091) (-474.303) * [-477.397] (-475.530) (-477.895) (-475.903) -- 0:00:08
868000 -- [-476.867] (-476.985) (-475.972) (-476.642) * (-474.411) (-474.889) [-475.707] (-478.728) -- 0:00:08
868500 -- (-475.401) (-473.329) (-478.163) [-475.903] * (-473.241) (-476.632) [-476.355] (-474.239) -- 0:00:08
869000 -- (-478.109) (-474.691) [-478.614] (-473.664) * (-474.575) (-473.647) [-475.154] (-473.292) -- 0:00:08
869500 -- (-478.261) (-473.183) (-474.666) [-474.848] * (-474.424) [-473.798] (-473.826) (-474.569) -- 0:00:08
870000 -- (-476.486) (-474.607) [-475.523] (-481.961) * (-473.649) (-474.736) (-477.415) [-475.844] -- 0:00:08
Average standard deviation of split frequencies: 0.007652
870500 -- (-476.825) [-473.895] (-478.404) (-481.349) * (-474.182) [-475.988] (-473.825) (-479.923) -- 0:00:08
871000 -- (-477.939) (-473.867) (-474.005) [-475.403] * (-476.184) [-476.128] (-473.309) (-475.712) -- 0:00:08
871500 -- (-476.666) [-473.467] (-475.089) (-473.828) * (-473.807) (-473.740) (-474.099) [-475.729] -- 0:00:08
872000 -- (-477.619) (-473.789) (-475.011) [-474.903] * (-474.595) [-473.335] (-475.617) (-474.426) -- 0:00:08
872500 -- (-478.365) (-475.541) [-474.072] (-476.097) * (-473.966) (-473.716) [-475.253] (-474.036) -- 0:00:08
873000 -- (-474.095) [-473.725] (-475.402) (-476.542) * (-473.641) (-474.936) (-475.661) [-473.648] -- 0:00:08
873500 -- (-475.276) (-476.825) [-474.209] (-475.544) * (-475.518) [-475.508] (-476.995) (-475.071) -- 0:00:07
874000 -- (-476.282) (-479.015) [-474.588] (-476.429) * (-475.949) (-474.115) (-477.182) [-474.159] -- 0:00:07
874500 -- (-473.483) [-474.682] (-474.311) (-474.929) * (-479.367) [-473.349] (-476.876) (-474.947) -- 0:00:07
875000 -- (-474.202) (-475.126) [-473.960] (-478.437) * (-473.696) [-473.720] (-474.234) (-474.514) -- 0:00:07
Average standard deviation of split frequencies: 0.008000
875500 -- (-475.419) (-474.876) (-476.302) [-474.474] * (-474.266) [-475.136] (-475.466) (-477.989) -- 0:00:07
876000 -- (-474.415) (-474.868) (-478.761) [-473.872] * (-476.540) [-474.464] (-476.127) (-477.029) -- 0:00:07
876500 -- [-474.639] (-478.197) (-476.399) (-475.789) * (-475.837) [-474.508] (-477.595) (-474.768) -- 0:00:07
877000 -- (-477.174) (-479.635) [-474.994] (-478.348) * (-476.519) (-475.141) (-477.611) [-477.755] -- 0:00:07
877500 -- [-475.498] (-474.820) (-474.363) (-475.754) * (-475.957) (-480.085) (-477.365) [-473.718] -- 0:00:07
878000 -- (-475.579) (-478.230) (-476.704) [-476.747] * (-474.239) [-478.590] (-472.994) (-477.790) -- 0:00:07
878500 -- (-482.027) (-474.646) (-477.095) [-475.560] * (-474.336) (-474.667) [-475.252] (-474.712) -- 0:00:07
879000 -- (-473.832) (-475.866) [-474.749] (-475.590) * (-476.330) [-480.406] (-478.552) (-473.747) -- 0:00:07
879500 -- (-475.206) (-478.302) [-474.553] (-475.993) * (-476.012) [-474.864] (-475.881) (-474.624) -- 0:00:07
880000 -- (-475.583) (-476.725) [-475.264] (-476.445) * [-475.691] (-473.860) (-473.992) (-475.806) -- 0:00:07
Average standard deviation of split frequencies: 0.007922
880500 -- (-478.455) (-474.924) (-475.628) [-476.130] * (-477.679) [-473.766] (-475.917) (-474.848) -- 0:00:07
881000 -- (-478.244) [-474.715] (-477.335) (-476.245) * (-478.296) (-477.691) [-474.702] (-475.237) -- 0:00:07
881500 -- (-475.035) (-475.014) (-476.984) [-475.139] * (-476.331) (-475.974) [-476.314] (-475.447) -- 0:00:07
882000 -- (-474.831) [-475.200] (-475.994) (-476.285) * [-478.395] (-477.152) (-476.984) (-475.216) -- 0:00:07
882500 -- (-475.364) (-474.296) [-477.249] (-474.657) * [-474.089] (-476.683) (-477.832) (-474.268) -- 0:00:07
883000 -- [-474.548] (-475.276) (-477.254) (-475.590) * (-477.628) (-473.183) [-476.799] (-474.057) -- 0:00:07
883500 -- [-474.611] (-476.243) (-473.732) (-474.312) * (-473.170) (-472.917) (-473.623) [-475.255] -- 0:00:07
884000 -- (-474.361) (-480.495) [-475.373] (-473.357) * [-473.012] (-473.226) (-474.455) (-475.501) -- 0:00:07
884500 -- [-484.020] (-476.107) (-475.343) (-476.758) * (-475.650) (-473.243) (-479.320) [-473.057] -- 0:00:07
885000 -- (-476.393) (-476.354) [-476.094] (-475.849) * (-474.198) (-475.034) [-475.222] (-473.796) -- 0:00:07
Average standard deviation of split frequencies: 0.007804
885500 -- (-476.619) [-473.741] (-475.195) (-475.379) * [-475.101] (-475.166) (-478.938) (-480.588) -- 0:00:07
886000 -- [-475.375] (-475.735) (-474.109) (-477.084) * (-474.517) (-475.998) (-474.886) [-476.672] -- 0:00:07
886500 -- (-477.942) (-474.083) (-474.968) [-474.990] * (-473.505) (-475.131) (-473.397) [-474.073] -- 0:00:07
887000 -- [-474.509] (-473.412) (-474.568) (-475.039) * (-473.960) [-475.182] (-473.494) (-474.334) -- 0:00:07
887500 -- (-474.116) (-477.490) [-473.138] (-474.000) * [-474.498] (-477.301) (-473.452) (-476.743) -- 0:00:06
888000 -- (-475.867) [-477.559] (-478.257) (-475.136) * [-474.298] (-476.384) (-473.743) (-474.579) -- 0:00:07
888500 -- [-473.973] (-476.488) (-477.594) (-484.994) * (-474.319) (-475.127) (-474.084) [-474.807] -- 0:00:07
889000 -- (-475.869) [-474.697] (-475.721) (-474.555) * (-475.512) [-473.874] (-475.946) (-475.655) -- 0:00:06
889500 -- (-475.970) (-477.548) [-478.416] (-473.931) * (-477.405) (-473.657) [-476.538] (-475.760) -- 0:00:06
890000 -- (-477.321) (-475.966) [-479.642] (-478.847) * (-473.949) [-473.283] (-475.706) (-484.904) -- 0:00:06
Average standard deviation of split frequencies: 0.007551
890500 -- [-476.620] (-475.614) (-478.164) (-474.195) * (-473.905) [-474.018] (-475.699) (-474.382) -- 0:00:06
891000 -- (-478.802) (-475.630) [-476.083] (-474.007) * (-477.767) (-473.106) (-479.096) [-474.670] -- 0:00:06
891500 -- (-474.830) (-475.703) (-475.137) [-475.276] * [-473.613] (-473.714) (-473.595) (-475.626) -- 0:00:06
892000 -- (-473.753) (-475.390) [-474.681] (-473.335) * (-475.875) (-474.407) (-474.380) [-474.939] -- 0:00:06
892500 -- (-474.621) [-475.632] (-477.940) (-476.563) * (-475.694) (-474.272) [-474.649] (-479.119) -- 0:00:06
893000 -- (-475.145) (-476.109) (-477.697) [-478.274] * (-474.568) [-474.227] (-474.338) (-478.286) -- 0:00:06
893500 -- [-473.363] (-473.674) (-478.425) (-473.576) * (-473.364) [-475.707] (-473.840) (-475.680) -- 0:00:06
894000 -- [-474.414] (-474.488) (-473.475) (-473.991) * (-476.749) (-474.977) (-473.848) [-474.713] -- 0:00:06
894500 -- (-475.573) (-475.540) (-477.384) [-473.904] * [-473.910] (-475.382) (-474.636) (-474.588) -- 0:00:06
895000 -- (-475.253) [-473.225] (-474.252) (-477.025) * (-473.526) (-474.820) [-474.808] (-474.590) -- 0:00:06
Average standard deviation of split frequencies: 0.007576
895500 -- (-477.613) [-473.148] (-475.300) (-478.864) * (-473.391) (-476.669) [-474.848] (-474.855) -- 0:00:06
896000 -- [-475.444] (-476.296) (-475.747) (-477.764) * (-473.948) [-474.021] (-475.541) (-475.036) -- 0:00:06
896500 -- (-476.295) [-474.405] (-477.126) (-474.127) * (-473.727) [-476.655] (-474.749) (-476.698) -- 0:00:06
897000 -- (-474.198) (-474.193) (-475.574) [-477.773] * (-475.827) [-477.280] (-475.824) (-476.321) -- 0:00:06
897500 -- (-475.915) [-475.020] (-479.373) (-475.331) * (-477.359) [-476.880] (-476.660) (-474.388) -- 0:00:06
898000 -- [-474.526] (-474.506) (-477.281) (-476.852) * (-481.381) (-475.305) [-473.329] (-473.807) -- 0:00:06
898500 -- (-475.014) [-475.127] (-478.611) (-480.440) * (-481.799) (-474.999) [-473.742] (-478.024) -- 0:00:06
899000 -- (-477.172) (-473.286) [-476.681] (-474.071) * [-475.605] (-477.481) (-476.621) (-478.148) -- 0:00:06
899500 -- (-479.113) (-475.680) (-474.717) [-475.087] * (-474.285) [-478.880] (-474.183) (-474.608) -- 0:00:06
900000 -- (-478.464) [-476.438] (-473.638) (-475.299) * (-477.450) (-473.509) (-479.250) [-474.529] -- 0:00:06
Average standard deviation of split frequencies: 0.007607
900500 -- (-474.650) (-476.499) (-474.362) [-473.852] * [-474.663] (-476.161) (-476.814) (-476.362) -- 0:00:06
901000 -- (-473.795) [-475.317] (-477.913) (-475.170) * [-474.093] (-474.891) (-473.955) (-479.346) -- 0:00:06
901500 -- [-479.321] (-473.035) (-473.843) (-475.227) * (-475.197) (-474.878) [-473.636] (-475.183) -- 0:00:06
902000 -- (-474.792) (-477.459) (-476.196) [-476.448] * (-477.193) [-474.694] (-476.731) (-474.314) -- 0:00:06
902500 -- (-478.027) [-473.285] (-473.088) (-474.722) * (-478.820) (-474.504) [-476.247] (-473.742) -- 0:00:06
903000 -- (-476.293) (-473.096) (-473.858) [-476.875] * (-473.814) [-477.714] (-474.870) (-478.446) -- 0:00:06
903500 -- (-475.069) (-474.825) [-475.217] (-473.720) * (-473.587) (-478.044) (-479.119) [-474.811] -- 0:00:05
904000 -- (-473.840) [-473.692] (-475.123) (-475.462) * [-476.864] (-480.012) (-477.783) (-482.021) -- 0:00:05
904500 -- (-473.037) [-473.105] (-474.885) (-476.395) * (-476.812) (-477.196) [-475.154] (-479.588) -- 0:00:06
905000 -- (-476.842) (-473.276) (-473.811) [-474.633] * [-473.115] (-476.649) (-478.128) (-478.715) -- 0:00:05
Average standard deviation of split frequencies: 0.007527
905500 -- [-475.177] (-475.622) (-475.125) (-473.178) * (-478.657) [-479.163] (-481.090) (-475.933) -- 0:00:05
906000 -- (-474.395) (-473.681) (-474.492) [-477.614] * (-473.910) (-476.146) [-474.405] (-474.020) -- 0:00:05
906500 -- (-475.974) [-475.387] (-473.190) (-475.879) * [-474.308] (-474.833) (-474.321) (-473.961) -- 0:00:05
907000 -- (-476.271) [-475.647] (-473.190) (-473.518) * (-477.508) (-474.625) [-476.505] (-475.303) -- 0:00:05
907500 -- (-474.050) (-474.018) [-474.132] (-477.740) * (-475.754) [-474.275] (-478.221) (-474.477) -- 0:00:05
908000 -- [-473.797] (-472.927) (-479.666) (-476.548) * (-475.118) (-473.460) [-473.968] (-475.459) -- 0:00:05
908500 -- (-473.660) [-474.886] (-474.419) (-476.747) * [-476.407] (-475.758) (-473.156) (-477.249) -- 0:00:05
909000 -- (-476.802) (-473.702) [-478.194] (-473.866) * (-479.178) (-473.662) [-476.073] (-475.061) -- 0:00:05
909500 -- (-475.729) (-473.138) (-476.496) [-474.293] * (-482.678) (-475.650) [-477.572] (-473.224) -- 0:00:05
910000 -- (-476.269) (-474.485) (-475.823) [-473.195] * [-476.533] (-478.464) (-475.170) (-473.422) -- 0:00:05
Average standard deviation of split frequencies: 0.007454
910500 -- (-474.798) (-476.386) [-475.514] (-474.429) * [-477.657] (-482.361) (-474.364) (-478.855) -- 0:00:05
911000 -- [-479.270] (-476.514) (-477.477) (-473.078) * (-482.769) [-476.894] (-474.759) (-474.876) -- 0:00:05
911500 -- (-476.861) (-477.338) [-476.070] (-481.313) * (-479.558) (-482.076) [-473.350] (-479.865) -- 0:00:05
912000 -- (-475.939) (-475.702) (-477.267) [-473.491] * [-478.056] (-478.287) (-473.555) (-475.422) -- 0:00:05
912500 -- [-478.988] (-475.793) (-480.491) (-474.090) * (-479.787) (-477.533) (-474.271) [-474.256] -- 0:00:05
913000 -- (-477.796) (-474.030) [-478.692] (-474.855) * (-479.461) (-474.712) (-476.896) [-473.497] -- 0:00:05
913500 -- (-475.814) (-477.039) [-475.306] (-475.163) * (-474.190) [-473.593] (-478.098) (-474.717) -- 0:00:05
914000 -- [-475.004] (-482.127) (-474.929) (-474.858) * (-473.974) [-479.587] (-476.903) (-475.117) -- 0:00:05
914500 -- (-476.856) [-474.894] (-478.750) (-474.877) * [-474.012] (-475.587) (-476.676) (-476.503) -- 0:00:05
915000 -- (-474.145) (-475.147) (-474.819) [-474.759] * (-475.543) [-475.770] (-476.889) (-475.141) -- 0:00:05
Average standard deviation of split frequencies: 0.007411
915500 -- (-475.635) (-473.722) (-473.958) [-475.656] * (-476.616) (-475.151) (-474.654) [-474.634] -- 0:00:05
916000 -- (-474.242) (-478.468) (-475.564) [-473.739] * (-475.629) (-475.031) (-474.160) [-476.765] -- 0:00:05
916500 -- (-475.285) (-475.332) (-474.084) [-473.803] * (-475.878) (-474.169) [-474.331] (-476.457) -- 0:00:05
917000 -- (-474.315) [-475.941] (-473.725) (-473.220) * (-475.956) (-473.492) [-474.151] (-478.479) -- 0:00:05
917500 -- (-473.555) (-473.938) (-479.725) [-475.002] * (-474.387) (-474.934) (-473.544) [-474.435] -- 0:00:05
918000 -- (-474.052) (-473.578) [-475.288] (-475.186) * (-473.152) (-475.847) [-473.987] (-474.610) -- 0:00:05
918500 -- (-477.153) (-473.639) [-475.647] (-475.398) * (-473.654) (-475.547) [-473.468] (-474.420) -- 0:00:05
919000 -- [-473.920] (-474.554) (-475.174) (-476.867) * [-474.097] (-477.875) (-473.313) (-475.465) -- 0:00:05
919500 -- [-473.703] (-474.630) (-475.092) (-474.982) * [-476.862] (-472.859) (-476.039) (-479.656) -- 0:00:04
920000 -- [-475.940] (-474.975) (-473.390) (-474.351) * (-474.919) (-474.829) (-474.937) [-473.656] -- 0:00:04
Average standard deviation of split frequencies: 0.007646
920500 -- (-476.024) (-473.345) [-473.525] (-476.917) * (-475.476) (-476.817) [-473.981] (-477.375) -- 0:00:04
921000 -- (-475.508) (-474.662) (-473.907) [-475.286] * (-476.080) (-478.060) [-473.829] (-476.636) -- 0:00:04
921500 -- (-478.101) (-474.551) [-473.613] (-474.875) * (-475.313) (-476.394) [-476.102] (-475.461) -- 0:00:04
922000 -- (-478.547) (-476.229) (-474.149) [-474.724] * (-473.834) [-478.423] (-473.122) (-475.454) -- 0:00:04
922500 -- (-473.889) (-475.311) (-475.523) [-474.021] * (-477.349) (-478.114) [-476.411] (-476.715) -- 0:00:04
923000 -- (-477.130) (-474.570) (-476.791) [-473.964] * (-474.291) [-477.659] (-473.946) (-473.172) -- 0:00:04
923500 -- (-473.975) (-475.737) (-475.559) [-474.140] * [-474.009] (-477.507) (-478.355) (-474.508) -- 0:00:04
924000 -- (-475.901) (-474.024) (-476.124) [-476.287] * (-473.780) [-474.995] (-475.788) (-478.568) -- 0:00:04
924500 -- [-476.745] (-473.874) (-475.191) (-476.875) * [-477.477] (-474.505) (-477.837) (-476.833) -- 0:00:04
925000 -- (-478.016) (-474.289) (-475.031) [-480.274] * (-474.196) (-474.529) (-475.754) [-473.460] -- 0:00:04
Average standard deviation of split frequencies: 0.007466
925500 -- (-476.965) (-474.049) (-474.096) [-475.761] * (-475.100) [-475.029] (-478.668) (-473.728) -- 0:00:04
926000 -- (-473.597) (-476.066) (-474.697) [-473.857] * (-476.784) (-476.266) [-476.549] (-473.944) -- 0:00:04
926500 -- (-475.148) [-480.926] (-478.313) (-481.598) * (-475.643) [-473.854] (-474.640) (-473.796) -- 0:00:04
927000 -- (-474.867) [-475.431] (-475.219) (-478.440) * (-475.089) (-474.777) [-474.712] (-473.742) -- 0:00:04
927500 -- (-476.070) (-477.420) [-474.483] (-477.360) * (-477.742) [-475.074] (-477.702) (-474.064) -- 0:00:04
928000 -- (-474.023) (-476.852) [-475.505] (-473.802) * (-475.917) (-477.341) (-481.232) [-473.067] -- 0:00:04
928500 -- [-474.246] (-474.915) (-477.086) (-473.400) * (-474.974) [-475.954] (-476.188) (-474.549) -- 0:00:04
929000 -- (-473.292) [-474.490] (-477.089) (-475.497) * [-476.321] (-477.804) (-477.174) (-474.611) -- 0:00:04
929500 -- [-474.040] (-474.312) (-473.446) (-479.765) * (-475.353) [-473.957] (-474.169) (-476.863) -- 0:00:04
930000 -- (-474.163) (-473.730) (-477.243) [-475.827] * (-474.486) (-474.852) (-475.747) [-476.452] -- 0:00:04
Average standard deviation of split frequencies: 0.007564
930500 -- (-475.086) (-474.436) [-476.087] (-475.888) * (-473.725) (-475.410) [-473.464] (-477.531) -- 0:00:04
931000 -- (-476.999) [-473.366] (-474.941) (-477.358) * (-473.720) (-476.399) (-473.467) [-475.628] -- 0:00:04
931500 -- (-474.487) [-477.258] (-477.848) (-479.633) * (-475.022) [-477.928] (-473.407) (-474.081) -- 0:00:04
932000 -- [-473.126] (-474.859) (-476.405) (-475.526) * [-474.851] (-474.533) (-474.175) (-474.093) -- 0:00:04
932500 -- (-473.870) (-473.678) [-477.334] (-474.633) * (-474.826) [-476.870] (-476.934) (-474.093) -- 0:00:04
933000 -- [-473.631] (-474.627) (-477.607) (-476.505) * (-478.458) (-473.515) (-476.687) [-473.873] -- 0:00:04
933500 -- (-473.597) (-478.225) (-479.532) [-474.445] * [-473.678] (-476.735) (-479.171) (-475.531) -- 0:00:04
934000 -- (-474.578) (-480.518) (-477.093) [-473.185] * (-479.982) (-474.743) [-475.119] (-475.880) -- 0:00:04
934500 -- [-474.550] (-475.666) (-473.926) (-472.901) * (-473.323) (-475.694) (-473.046) [-474.073] -- 0:00:04
935000 -- (-475.491) (-474.770) (-473.988) [-474.761] * (-475.684) (-476.610) (-475.642) [-474.410] -- 0:00:04
Average standard deviation of split frequencies: 0.007521
935500 -- (-473.569) (-477.341) (-475.240) [-476.712] * (-474.671) (-478.853) [-473.607] (-474.796) -- 0:00:03
936000 -- (-476.243) (-475.207) [-475.129] (-475.121) * [-474.034] (-475.667) (-475.269) (-476.077) -- 0:00:03
936500 -- (-474.924) [-474.772] (-473.440) (-473.998) * (-474.546) (-476.024) [-474.747] (-474.740) -- 0:00:03
937000 -- (-476.039) [-477.553] (-477.625) (-473.881) * (-474.524) (-476.722) (-473.505) [-473.992] -- 0:00:03
937500 -- (-474.819) (-475.145) [-475.098] (-476.637) * (-477.860) (-475.538) (-475.906) [-473.723] -- 0:00:03
938000 -- (-475.925) [-476.721] (-474.740) (-474.261) * [-477.622] (-476.728) (-475.490) (-476.093) -- 0:00:03
938500 -- [-474.279] (-476.474) (-476.784) (-478.613) * (-476.136) (-474.987) (-474.779) [-473.751] -- 0:00:03
939000 -- (-474.545) [-475.757] (-475.065) (-475.628) * (-473.416) [-476.112] (-477.910) (-475.509) -- 0:00:03
939500 -- (-475.097) [-474.276] (-478.095) (-474.388) * (-476.401) [-474.928] (-475.720) (-473.941) -- 0:00:03
940000 -- (-478.009) (-475.038) [-478.897] (-473.728) * [-478.098] (-474.861) (-477.497) (-474.781) -- 0:00:03
Average standard deviation of split frequencies: 0.007517
940500 -- (-476.812) (-474.916) (-475.119) [-473.798] * (-476.652) (-473.219) (-476.352) [-479.358] -- 0:00:03
941000 -- (-475.469) (-473.981) (-474.659) [-473.408] * (-475.077) (-476.183) (-477.943) [-481.008] -- 0:00:03
941500 -- (-475.182) (-474.195) (-478.415) [-474.151] * (-475.076) [-474.305] (-474.310) (-477.869) -- 0:00:03
942000 -- [-473.461] (-473.612) (-474.376) (-473.570) * (-474.906) [-476.643] (-477.670) (-473.528) -- 0:00:03
942500 -- (-475.808) (-475.963) (-473.009) [-475.733] * (-474.753) (-476.126) [-474.993] (-473.571) -- 0:00:03
943000 -- [-475.609] (-474.286) (-474.891) (-475.951) * (-473.952) (-473.085) [-475.341] (-475.333) -- 0:00:03
943500 -- (-473.080) (-473.474) (-476.499) [-480.742] * (-474.679) [-473.610] (-474.923) (-475.425) -- 0:00:03
944000 -- [-473.088] (-476.027) (-474.513) (-478.019) * (-474.914) (-481.529) (-477.104) [-476.401] -- 0:00:03
944500 -- (-474.839) (-473.904) (-474.057) [-477.190] * [-474.348] (-476.784) (-475.320) (-478.071) -- 0:00:03
945000 -- [-475.169] (-474.634) (-475.938) (-478.842) * [-473.497] (-477.719) (-473.504) (-474.483) -- 0:00:03
Average standard deviation of split frequencies: 0.007375
945500 -- (-475.960) [-474.350] (-475.559) (-473.176) * [-473.464] (-478.585) (-480.141) (-474.340) -- 0:00:03
946000 -- (-474.023) [-476.493] (-475.559) (-473.621) * (-480.211) [-475.308] (-474.214) (-474.649) -- 0:00:03
946500 -- (-480.416) (-474.744) [-477.679] (-476.494) * (-475.647) (-477.158) (-477.003) [-476.385] -- 0:00:03
947000 -- (-475.710) (-479.068) (-476.948) [-477.458] * (-474.480) [-474.863] (-477.622) (-477.360) -- 0:00:03
947500 -- (-476.191) (-478.711) (-475.749) [-476.885] * (-473.187) (-478.630) (-475.001) [-474.848] -- 0:00:03
948000 -- (-475.829) [-475.839] (-477.685) (-476.839) * (-473.649) (-473.124) (-473.458) [-477.218] -- 0:00:03
948500 -- [-475.668] (-474.074) (-476.956) (-474.449) * (-478.369) [-475.122] (-473.374) (-474.911) -- 0:00:03
949000 -- (-474.909) (-475.740) [-474.245] (-481.079) * (-475.387) (-473.611) [-474.073] (-474.469) -- 0:00:03
949500 -- (-475.047) (-476.927) (-474.773) [-478.200] * (-478.891) (-476.889) (-474.159) [-475.527] -- 0:00:03
950000 -- (-474.702) [-474.234] (-476.980) (-480.669) * [-476.637] (-474.985) (-477.694) (-474.418) -- 0:00:03
Average standard deviation of split frequencies: 0.007372
950500 -- (-474.940) [-475.063] (-474.220) (-479.374) * (-476.593) (-473.841) [-474.366] (-474.479) -- 0:00:03
951000 -- (-473.436) (-477.363) (-474.474) [-478.071] * (-475.800) (-475.912) [-477.579] (-475.401) -- 0:00:03
951500 -- (-473.202) [-475.162] (-475.544) (-478.916) * (-476.194) [-475.945] (-474.190) (-474.807) -- 0:00:03
952000 -- (-475.714) (-474.507) [-476.515] (-477.094) * [-477.761] (-478.009) (-476.141) (-474.644) -- 0:00:02
952500 -- [-474.072] (-475.883) (-474.481) (-473.854) * (-474.365) (-473.934) [-475.363] (-475.072) -- 0:00:02
953000 -- (-473.745) (-475.344) [-476.281] (-474.941) * (-479.333) (-474.006) (-481.285) [-475.869] -- 0:00:02
953500 -- [-476.645] (-476.476) (-473.893) (-474.429) * (-474.534) (-473.154) (-479.981) [-473.938] -- 0:00:02
954000 -- (-477.251) (-483.701) (-473.628) [-475.609] * [-475.446] (-474.387) (-475.120) (-474.025) -- 0:00:02
954500 -- (-475.101) [-478.962] (-475.194) (-475.637) * (-475.916) [-473.772] (-476.422) (-474.289) -- 0:00:02
955000 -- (-475.884) (-476.995) (-473.606) [-476.328] * [-472.959] (-476.254) (-479.489) (-477.702) -- 0:00:02
Average standard deviation of split frequencies: 0.007364
955500 -- (-474.008) [-476.607] (-474.267) (-478.405) * (-481.535) (-474.222) (-474.980) [-477.818] -- 0:00:02
956000 -- [-474.030] (-475.553) (-476.145) (-474.388) * (-481.340) [-474.540] (-474.916) (-474.176) -- 0:00:02
956500 -- (-473.849) (-476.789) [-476.482] (-475.609) * (-474.086) (-474.193) (-474.733) [-474.651] -- 0:00:02
957000 -- (-474.914) (-476.485) [-477.423] (-474.479) * (-474.486) (-474.877) (-477.147) [-474.186] -- 0:00:02
957500 -- (-476.623) (-478.734) [-476.812] (-474.203) * (-477.658) [-475.041] (-477.027) (-473.888) -- 0:00:02
958000 -- (-477.325) [-474.343] (-474.413) (-477.576) * (-475.266) (-474.572) [-475.540] (-474.086) -- 0:00:02
958500 -- (-475.317) (-481.269) (-475.137) [-473.487] * (-474.546) (-475.669) (-478.538) [-475.953] -- 0:00:02
959000 -- [-474.507] (-474.481) (-475.159) (-473.818) * [-474.780] (-473.689) (-477.338) (-475.681) -- 0:00:02
959500 -- (-481.603) (-475.943) [-474.351] (-474.424) * [-475.207] (-474.642) (-475.680) (-476.837) -- 0:00:02
960000 -- (-475.197) (-476.087) (-474.448) [-473.532] * (-479.637) [-473.299] (-476.226) (-478.947) -- 0:00:02
Average standard deviation of split frequencies: 0.007426
960500 -- (-474.512) (-473.988) [-475.944] (-476.757) * (-476.881) (-473.960) [-475.813] (-475.192) -- 0:00:02
961000 -- (-479.326) (-473.159) (-474.421) [-476.341] * (-473.505) (-476.728) (-474.985) [-473.709] -- 0:00:02
961500 -- (-474.660) (-473.031) (-473.498) [-475.452] * [-473.755] (-475.167) (-487.182) (-478.328) -- 0:00:02
962000 -- (-476.520) (-473.158) (-478.250) [-476.439] * (-477.748) [-474.630] (-476.654) (-474.820) -- 0:00:02
962500 -- (-476.149) (-475.764) [-475.563] (-474.539) * [-475.239] (-475.289) (-473.952) (-476.333) -- 0:00:02
963000 -- (-474.704) (-476.011) [-479.052] (-473.969) * [-476.626] (-477.281) (-476.636) (-475.658) -- 0:00:02
963500 -- (-473.728) (-474.340) [-475.999] (-476.205) * [-474.753] (-483.667) (-476.102) (-476.258) -- 0:00:02
964000 -- (-476.141) [-476.953] (-481.519) (-473.432) * (-477.471) (-479.240) [-474.920] (-477.833) -- 0:00:02
964500 -- [-474.558] (-475.649) (-479.907) (-480.525) * (-476.032) [-474.762] (-476.495) (-475.641) -- 0:00:02
965000 -- (-474.528) (-474.938) [-476.332] (-473.392) * (-479.926) (-477.722) (-475.238) [-475.374] -- 0:00:02
Average standard deviation of split frequencies: 0.007418
965500 -- [-473.683] (-474.266) (-473.835) (-475.272) * [-475.173] (-479.650) (-476.569) (-474.783) -- 0:00:02
966000 -- (-475.860) (-474.835) (-473.650) [-475.802] * [-475.114] (-474.610) (-476.663) (-475.458) -- 0:00:02
966500 -- (-474.674) [-473.250] (-476.605) (-478.487) * (-475.621) (-474.873) [-474.469] (-479.025) -- 0:00:02
967000 -- [-473.283] (-475.488) (-475.486) (-476.483) * (-475.618) (-472.984) (-482.573) [-475.916] -- 0:00:02
967500 -- [-474.593] (-475.240) (-479.678) (-474.515) * (-476.387) (-475.981) (-478.908) [-473.931] -- 0:00:02
968000 -- (-475.226) (-475.256) [-476.829] (-476.238) * (-477.432) (-474.071) [-474.533] (-475.239) -- 0:00:01
968500 -- (-475.967) (-476.150) (-473.279) [-476.964] * (-476.844) [-474.544] (-475.240) (-474.119) -- 0:00:01
969000 -- [-474.124] (-475.122) (-475.991) (-477.060) * [-477.981] (-484.238) (-474.873) (-476.258) -- 0:00:01
969500 -- (-473.715) (-474.676) [-473.341] (-474.698) * (-478.642) (-473.627) (-478.063) [-479.737] -- 0:00:01
970000 -- (-475.295) [-473.240] (-473.595) (-474.548) * (-477.214) (-474.828) (-476.116) [-474.312] -- 0:00:01
Average standard deviation of split frequencies: 0.007706
970500 -- (-473.359) [-478.651] (-474.924) (-472.988) * (-475.901) (-475.862) [-475.095] (-477.622) -- 0:00:01
971000 -- (-473.877) [-475.038] (-474.619) (-474.649) * [-475.295] (-476.028) (-476.087) (-473.561) -- 0:00:01
971500 -- (-474.199) (-479.206) [-474.757] (-478.630) * (-476.152) (-473.894) (-474.468) [-473.000] -- 0:00:01
972000 -- (-474.271) (-477.366) (-474.843) [-476.032] * (-476.461) (-473.544) [-475.075] (-476.503) -- 0:00:01
972500 -- (-473.412) [-475.426] (-478.790) (-474.996) * [-476.819] (-474.010) (-476.745) (-475.204) -- 0:00:01
973000 -- (-473.160) (-473.878) (-474.236) [-478.054] * (-473.606) (-474.510) (-476.175) [-474.206] -- 0:00:01
973500 -- [-473.412] (-473.678) (-474.577) (-475.595) * (-476.053) (-477.280) (-476.169) [-473.576] -- 0:00:01
974000 -- (-473.392) [-473.678] (-473.910) (-474.329) * (-473.201) (-476.678) [-476.141] (-476.746) -- 0:00:01
974500 -- [-473.248] (-476.024) (-476.497) (-476.000) * (-477.984) [-473.972] (-482.601) (-476.358) -- 0:00:01
975000 -- [-473.693] (-474.036) (-477.303) (-475.044) * (-475.581) [-474.327] (-479.748) (-475.144) -- 0:00:01
Average standard deviation of split frequencies: 0.007503
975500 -- (-473.748) [-473.577] (-475.005) (-477.044) * (-474.965) (-474.044) [-478.747] (-477.281) -- 0:00:01
976000 -- (-478.401) [-474.451] (-473.931) (-474.282) * (-473.941) (-476.727) [-479.168] (-477.531) -- 0:00:01
976500 -- (-478.131) [-474.464] (-478.102) (-478.152) * (-472.920) (-475.035) (-474.723) [-477.607] -- 0:00:01
977000 -- (-481.815) (-476.623) [-475.191] (-476.379) * [-474.287] (-478.258) (-476.517) (-476.653) -- 0:00:01
977500 -- (-477.235) (-475.582) (-476.575) [-475.701] * (-479.433) [-476.589] (-477.135) (-473.479) -- 0:00:01
978000 -- [-474.254] (-475.180) (-476.448) (-474.785) * (-474.500) (-475.060) [-474.568] (-476.995) -- 0:00:01
978500 -- (-477.512) (-474.358) [-477.302] (-474.617) * [-476.736] (-474.493) (-476.343) (-479.294) -- 0:00:01
979000 -- (-475.293) (-474.532) [-474.999] (-475.699) * (-473.840) [-475.782] (-478.803) (-474.696) -- 0:00:01
979500 -- (-475.500) [-476.390] (-474.832) (-476.973) * (-473.446) (-473.964) [-473.717] (-474.045) -- 0:00:01
980000 -- (-475.238) (-474.956) (-473.673) [-473.827] * (-476.281) (-473.153) (-473.804) [-473.546] -- 0:00:01
Average standard deviation of split frequencies: 0.007563
980500 -- (-477.616) [-474.168] (-474.488) (-477.665) * (-474.064) [-473.489] (-473.169) (-475.087) -- 0:00:01
981000 -- [-478.119] (-475.717) (-476.046) (-473.953) * [-474.438] (-478.401) (-475.496) (-476.504) -- 0:00:01
981500 -- (-477.300) (-475.568) (-477.325) [-473.776] * (-474.983) (-477.359) (-474.211) [-473.645] -- 0:00:01
982000 -- [-477.058] (-473.962) (-479.928) (-475.599) * [-475.813] (-477.794) (-475.928) (-475.678) -- 0:00:01
982500 -- [-479.152] (-475.150) (-478.280) (-473.937) * (-474.426) (-476.716) (-474.747) [-477.008] -- 0:00:01
983000 -- (-483.034) (-475.053) [-482.543] (-475.721) * [-475.335] (-477.173) (-474.456) (-474.841) -- 0:00:01
983500 -- (-473.633) (-476.438) [-473.868] (-476.792) * (-473.999) [-476.224] (-474.580) (-475.372) -- 0:00:01
984000 -- (-476.604) (-476.710) [-472.942] (-474.573) * (-474.185) [-473.853] (-478.992) (-475.417) -- 0:00:00
984500 -- (-474.184) [-481.274] (-474.684) (-473.858) * (-477.740) [-474.057] (-475.668) (-475.570) -- 0:00:00
985000 -- (-474.960) [-480.774] (-480.488) (-474.772) * (-474.751) (-473.801) (-474.279) [-474.671] -- 0:00:00
Average standard deviation of split frequencies: 0.007650
985500 -- (-474.192) (-485.065) [-474.491] (-475.697) * (-475.544) (-473.665) [-476.195] (-475.658) -- 0:00:00
986000 -- (-474.255) (-480.172) (-474.806) [-474.121] * (-473.395) (-474.036) [-477.894] (-474.897) -- 0:00:00
986500 -- [-477.527] (-475.850) (-474.898) (-473.567) * [-474.042] (-474.476) (-477.108) (-474.318) -- 0:00:00
987000 -- (-477.380) (-474.156) [-474.615] (-473.883) * (-485.803) (-475.642) [-475.110] (-476.624) -- 0:00:00
987500 -- [-475.435] (-474.118) (-481.567) (-473.780) * (-474.574) (-477.636) (-477.051) [-478.117] -- 0:00:00
988000 -- [-473.079] (-476.068) (-474.670) (-477.260) * (-474.510) (-475.893) (-474.912) [-474.020] -- 0:00:00
988500 -- (-476.272) (-478.042) (-473.475) [-476.919] * (-478.662) [-475.039] (-473.922) (-475.257) -- 0:00:00
989000 -- [-474.512] (-473.818) (-473.748) (-474.955) * (-475.060) (-475.921) [-473.387] (-473.394) -- 0:00:00
989500 -- (-476.538) [-474.215] (-473.148) (-473.457) * [-474.147] (-475.932) (-479.812) (-473.731) -- 0:00:00
990000 -- (-477.950) (-475.276) [-473.783] (-475.289) * [-475.111] (-475.967) (-474.528) (-474.850) -- 0:00:00
Average standard deviation of split frequencies: 0.007867
990500 -- (-473.601) (-474.703) (-475.483) [-473.537] * [-473.334] (-475.333) (-474.254) (-474.583) -- 0:00:00
991000 -- (-476.389) [-475.848] (-475.394) (-476.209) * [-475.101] (-475.120) (-473.657) (-478.373) -- 0:00:00
991500 -- (-474.790) (-475.140) (-475.296) [-473.216] * (-474.696) [-474.763] (-474.092) (-476.532) -- 0:00:00
992000 -- (-475.602) (-477.267) [-473.900] (-473.500) * (-477.391) (-475.224) [-475.458] (-473.763) -- 0:00:00
992500 -- [-473.974] (-474.264) (-475.368) (-476.552) * (-477.923) (-473.669) [-473.578] (-474.647) -- 0:00:00
993000 -- (-473.403) (-475.587) (-476.569) [-474.955] * (-477.267) (-477.822) [-473.986] (-473.667) -- 0:00:00
993500 -- (-473.043) (-475.883) [-475.283] (-474.044) * (-477.319) (-473.472) [-474.801] (-474.176) -- 0:00:00
994000 -- (-473.680) (-478.533) (-474.873) [-473.559] * [-476.655] (-482.178) (-473.140) (-478.243) -- 0:00:00
994500 -- [-473.907] (-473.840) (-474.338) (-473.286) * (-477.572) (-484.316) (-475.763) [-475.005] -- 0:00:00
995000 -- (-474.435) [-477.289] (-474.197) (-473.785) * (-475.686) [-476.943] (-476.637) (-479.209) -- 0:00:00
Average standard deviation of split frequencies: 0.007888
995500 -- [-474.689] (-483.503) (-478.408) (-474.434) * (-477.400) (-476.752) [-473.216] (-475.592) -- 0:00:00
996000 -- (-473.588) (-476.613) (-476.583) [-474.733] * (-474.570) (-474.375) (-474.476) [-474.599] -- 0:00:00
996500 -- (-473.908) (-480.472) [-474.359] (-476.892) * (-476.379) (-475.169) [-478.090] (-474.513) -- 0:00:00
997000 -- (-473.627) (-473.734) (-479.679) [-475.237] * (-477.324) (-475.857) (-477.730) [-473.793] -- 0:00:00
997500 -- (-474.099) (-474.947) (-476.218) [-474.065] * [-473.742] (-474.887) (-473.971) (-477.566) -- 0:00:00
998000 -- (-474.041) (-476.319) (-475.240) [-474.953] * (-475.753) [-474.602] (-477.259) (-478.276) -- 0:00:00
998500 -- [-474.195] (-478.658) (-474.491) (-476.561) * (-476.379) [-472.952] (-476.009) (-475.427) -- 0:00:00
999000 -- [-474.384] (-474.774) (-474.982) (-475.718) * (-473.880) [-473.860] (-474.785) (-476.174) -- 0:00:00
999500 -- (-477.013) (-475.503) [-473.662] (-478.249) * (-473.944) (-476.795) (-478.300) [-473.294] -- 0:00:00
1000000 -- (-474.785) [-474.768] (-478.949) (-474.341) * (-473.855) [-476.265] (-474.813) (-474.560) -- 0:00:00
Average standard deviation of split frequencies: 0.007600
Analysis completed in 1 mins 2 seconds
Analysis used 60.57 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -472.83
Likelihood of best state for "cold" chain of run 2 was -472.83
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 58 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
36.8 % ( 23 %) Dirichlet(Pi{all})
36.5 % ( 29 %) Slider(Pi{all})
79.0 % ( 70 %) Multiplier(Alpha{1,2})
77.9 % ( 53 %) Multiplier(Alpha{3})
24.8 % ( 30 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.6 % ( 35 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 75 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
36.8 % ( 29 %) Dirichlet(Pi{all})
37.4 % ( 27 %) Slider(Pi{all})
78.6 % ( 39 %) Multiplier(Alpha{1,2})
77.0 % ( 55 %) Multiplier(Alpha{3})
25.2 % ( 22 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 88 %) ParsSPR(Tau{all},V{all})
28.1 % ( 33 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.5 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166672 0.82 0.67
3 | 166612 166658 0.84
4 | 166554 166061 167443
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166764 0.82 0.67
3 | 166729 166871 0.84
4 | 166713 166766 166157
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -474.56
|2 2 1|
| 1 11 2 2|
| 1 2 21 2 2 |
| 211 2 2 1 1 2 |
| 2 2 2 1 12 |
|1 2 1 22 1 1 1* 2 1 * 22 |
| * 1 2 1 2 1 2 1 2 2 22 1 |
| 1 1 2 2 222 2 1 1 *11 |
| 2 21 1 2 1 1 21 2 21 2 1 2 |
| 1 2 1 1 2 12 1 1 2 2 |
| 2 1 2 11 * 1 11 |
| * 2 1 |
| 1 * 1 |
| 1 2 |
| 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -476.23
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -474.55 -478.03
2 -474.53 -477.60
--------------------------------------
TOTAL -474.54 -477.84
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.883104 0.088762 0.352783 1.488230 0.854249 1090.99 1147.50 1.001
r(A<->C){all} 0.167585 0.019095 0.000050 0.443355 0.136145 179.08 181.94 1.001
r(A<->G){all} 0.180049 0.021588 0.000150 0.473522 0.146768 192.99 212.69 1.000
r(A<->T){all} 0.157465 0.019037 0.000040 0.448606 0.119989 212.17 221.26 1.004
r(C<->G){all} 0.161923 0.016999 0.000191 0.420253 0.130040 152.92 229.16 1.006
r(C<->T){all} 0.164875 0.019264 0.000022 0.438127 0.126714 232.40 261.22 1.004
r(G<->T){all} 0.168103 0.019555 0.000006 0.448653 0.134615 84.48 191.38 1.001
pi(A){all} 0.225158 0.000503 0.180862 0.267063 0.225034 1226.25 1288.80 1.000
pi(C){all} 0.253768 0.000550 0.207560 0.298654 0.253385 1290.45 1395.73 1.000
pi(G){all} 0.283733 0.000598 0.235265 0.329651 0.283144 1385.16 1443.08 1.000
pi(T){all} 0.237341 0.000527 0.193574 0.282473 0.237047 1115.41 1208.27 1.000
alpha{1,2} 0.431521 0.254590 0.000114 1.456041 0.261105 1345.43 1423.22 1.001
alpha{3} 0.457958 0.229322 0.000367 1.469619 0.289619 1301.07 1309.61 1.001
pinvar{all} 0.995357 0.000029 0.984602 0.999996 0.997105 1295.48 1353.74 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .****.
8 -- .*...*
9 -- ..*.*.
10 -- .***.*
11 -- ...*.*
12 -- .*.*..
13 -- .**...
14 -- .*.***
15 -- ...**.
16 -- ..**..
17 -- .**.**
18 -- .*..*.
19 -- ..*..*
20 -- ....**
21 -- ..****
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 465 0.154897 0.014604 0.144570 0.165223 2
8 459 0.152898 0.016488 0.141239 0.164557 2
9 454 0.151233 0.004711 0.147901 0.154564 2
10 453 0.150899 0.003298 0.148568 0.153231 2
11 450 0.149900 0.010364 0.142572 0.157229 2
12 435 0.144903 0.004240 0.141905 0.147901 2
13 429 0.142905 0.005182 0.139241 0.146569 2
14 427 0.142239 0.007066 0.137242 0.147235 2
15 421 0.140240 0.007066 0.135243 0.145237 2
16 420 0.139907 0.015075 0.129247 0.150566 2
17 416 0.138574 0.001884 0.137242 0.139907 2
18 408 0.135909 0.003769 0.133245 0.138574 2
19 399 0.132911 0.004240 0.129913 0.135909 2
20 387 0.128914 0.005182 0.125250 0.132578 2
21 379 0.126249 0.010835 0.118588 0.133911 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100401 0.010522 0.000002 0.311109 0.066858 1.000 2
length{all}[2] 0.097709 0.009843 0.000075 0.296207 0.066423 1.000 2
length{all}[3] 0.099122 0.009461 0.000005 0.298312 0.069181 1.000 2
length{all}[4] 0.096672 0.009171 0.000130 0.291324 0.067354 1.000 2
length{all}[5] 0.095318 0.009087 0.000010 0.278276 0.065611 1.000 2
length{all}[6] 0.099001 0.009616 0.000031 0.286473 0.069168 1.001 2
length{all}[7] 0.089668 0.008192 0.000465 0.269985 0.058294 1.000 2
length{all}[8] 0.096400 0.007872 0.000181 0.282891 0.067686 1.000 2
length{all}[9] 0.092442 0.008049 0.000121 0.260493 0.063697 1.001 2
length{all}[10] 0.098703 0.009291 0.000221 0.285508 0.071390 0.998 2
length{all}[11] 0.109007 0.014683 0.000496 0.346134 0.072368 0.998 2
length{all}[12] 0.096336 0.008791 0.000082 0.268013 0.068859 0.998 2
length{all}[13] 0.100207 0.011069 0.000069 0.329138 0.067974 1.003 2
length{all}[14] 0.100457 0.009938 0.000233 0.264886 0.077923 0.998 2
length{all}[15] 0.103005 0.010349 0.000033 0.306299 0.071574 0.999 2
length{all}[16] 0.104939 0.009982 0.000167 0.318245 0.077418 1.000 2
length{all}[17] 0.099939 0.009903 0.000005 0.303824 0.074184 1.011 2
length{all}[18] 0.093746 0.008473 0.000244 0.294799 0.068860 1.010 2
length{all}[19] 0.104028 0.010157 0.000253 0.311360 0.072826 0.999 2
length{all}[20] 0.096306 0.008968 0.000603 0.277368 0.068361 0.998 2
length{all}[21] 0.100637 0.011624 0.000151 0.308338 0.065994 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007600
Maximum standard deviation of split frequencies = 0.016488
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.011
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 44 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 342
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 47 patterns at 114 / 114 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 47 patterns at 114 / 114 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
45872 bytes for conP
4136 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.055545 0.049749 0.054761 0.028056 0.091950 0.014285 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -488.732612
Iterating by ming2
Initial: fx= 488.732612
x= 0.05554 0.04975 0.05476 0.02806 0.09195 0.01428 0.30000 1.30000
1 h-m-p 0.0000 0.0001 273.4601 ++ 479.211500 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0059 53.0867 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 249.9395 ++ 471.524075 m 0.0001 44 | 2/8
4 h-m-p 0.0006 0.0074 42.5346 -----------.. | 2/8
5 h-m-p 0.0000 0.0002 223.8067 +++ 461.771725 m 0.0002 76 | 3/8
6 h-m-p 0.0012 0.0101 32.0614 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 194.3880 ++ 460.072931 m 0.0000 107 | 4/8
8 h-m-p 0.0003 0.0145 22.9355 ----------.. | 4/8
9 h-m-p 0.0000 0.0000 158.6813 ++ 459.895987 m 0.0000 137 | 5/8
10 h-m-p 0.0001 0.0211 15.6918 ---------.. | 5/8
11 h-m-p 0.0000 0.0003 111.8723 +++ 455.772030 m 0.0003 167 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 455.772030 m 8.0000 178 | 6/8
13 h-m-p 0.2245 8.0000 0.0001 ----C 455.772030 0 0.0003 195 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 --------C 455.772030 0 0.0000 216
Out..
lnL = -455.772030
217 lfun, 217 eigenQcodon, 1302 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038995 0.060130 0.058441 0.050691 0.016254 0.081036 0.299872 0.569768 0.574445
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.792104
np = 9
lnL0 = -489.620130
Iterating by ming2
Initial: fx= 489.620130
x= 0.03899 0.06013 0.05844 0.05069 0.01625 0.08104 0.29987 0.56977 0.57444
1 h-m-p 0.0000 0.0001 268.4394 ++ 478.960074 m 0.0001 14 | 1/9
2 h-m-p 0.0002 0.0010 131.8613 ++ 466.284083 m 0.0010 26 | 2/9
3 h-m-p 0.0000 0.0001 760.2810 ++ 461.245520 m 0.0001 38 | 3/9
4 h-m-p 0.0001 0.0005 153.0926 ++ 458.278789 m 0.0005 50 | 4/9
5 h-m-p 0.0000 0.0000 12708.8000 ++ 457.880847 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 302615.6951 ++ 455.772009 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 455.772009 m 8.0000 86 | 6/9
8 h-m-p 0.0034 1.6824 0.5096 ---------N 455.772009 0 0.0000 110 | 6/9
9 h-m-p 0.0160 8.0000 0.0002 +++++ 455.772009 m 8.0000 128 | 6/9
10 h-m-p 0.0060 2.8652 0.3034 ---------Y 455.772009 0 0.0000 152 | 6/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 455.772009 m 8.0000 170 | 6/9
12 h-m-p 0.0053 2.6694 0.2844 --------Y 455.772009 0 0.0000 193 | 6/9
13 h-m-p 0.0160 8.0000 0.0001 +++++ 455.772009 m 8.0000 211 | 6/9
14 h-m-p 0.0058 2.9194 0.2541 ------------.. | 6/9
15 h-m-p 0.0160 8.0000 0.0001 +++++ 455.772009 m 8.0000 254 | 6/9
16 h-m-p 0.0051 2.5364 0.3862 ---------Y 455.772009 0 0.0000 278 | 6/9
17 h-m-p 0.0160 8.0000 0.0005 +++++ 455.772008 m 8.0000 296 | 6/9
18 h-m-p 0.0076 1.8189 0.5452 -----------C 455.772008 0 0.0000 322 | 6/9
19 h-m-p 0.0160 8.0000 0.0001 +++++ 455.772008 m 8.0000 340 | 6/9
20 h-m-p 0.0017 0.8440 0.7453 ------------.. | 6/9
21 h-m-p 0.0160 8.0000 0.0001 +++++ 455.772008 m 8.0000 383 | 6/9
22 h-m-p 0.0051 2.5642 0.3837 ---------C 455.772008 0 0.0000 407 | 6/9
23 h-m-p 0.0160 8.0000 0.0122 +++++ 455.772001 m 8.0000 425 | 6/9
24 h-m-p 0.2514 2.7293 0.3882 ------------Y 455.772001 0 0.0000 452 | 6/9
25 h-m-p 0.0160 8.0000 0.0001 +++++ 455.772001 m 8.0000 470 | 6/9
26 h-m-p 0.0022 1.1018 0.6355 ------------.. | 6/9
27 h-m-p 0.0160 8.0000 0.0001 +++++ 455.772001 m 8.0000 513 | 6/9
28 h-m-p 0.0068 3.4004 0.3027 -------------.. | 6/9
29 h-m-p 0.0160 8.0000 0.0001 +++++ 455.772001 m 8.0000 557 | 6/9
30 h-m-p 0.0069 3.4398 0.2993 ----------Y 455.772001 0 0.0000 582 | 6/9
31 h-m-p 0.0160 8.0000 0.0003 +++++ 455.772001 m 8.0000 600 | 6/9
32 h-m-p 0.0063 2.4348 0.4353 ------------.. | 6/9
33 h-m-p 0.0160 8.0000 0.0001 +++++ 455.772001 m 8.0000 643 | 6/9
34 h-m-p 0.0068 3.4102 0.3027 -----------Y 455.772001 0 0.0000 669 | 6/9
35 h-m-p 0.0160 8.0000 0.0003 +++++ 455.772001 m 8.0000 687 | 6/9
36 h-m-p 0.0057 1.9543 0.3981 -----------Y 455.772001 0 0.0000 713 | 6/9
37 h-m-p 0.0160 8.0000 0.0003 +++++ 455.772001 m 8.0000 731 | 6/9
38 h-m-p 0.0086 2.3264 0.3040 ---------Y 455.772001 0 0.0000 755 | 6/9
39 h-m-p 0.0160 8.0000 0.0002 +++++ 455.772000 m 8.0000 773 | 6/9
40 h-m-p 0.0044 2.1312 0.3294 -----------Y 455.772000 0 0.0000 799 | 6/9
41 h-m-p 0.0160 8.0000 0.0001 +++++ 455.772000 m 8.0000 817 | 6/9
42 h-m-p 0.0035 1.7568 0.3954 ---------C 455.772000 0 0.0000 841 | 6/9
43 h-m-p 0.0160 8.0000 0.0001 +++++ 455.772000 m 8.0000 859 | 6/9
44 h-m-p 0.0037 1.8427 0.3771 ---------Y 455.772000 0 0.0000 883 | 6/9
45 h-m-p 0.0160 8.0000 0.0011 -------C 455.772000 0 0.0000 905 | 6/9
46 h-m-p 0.0160 8.0000 0.0000 +++++ 455.772000 m 8.0000 923 | 6/9
47 h-m-p 0.0037 1.8504 0.3768 ---------C 455.772000 0 0.0000 947 | 6/9
48 h-m-p 0.0160 8.0000 0.0001 +++++ 455.772000 m 8.0000 965 | 6/9
49 h-m-p 0.0040 1.9835 0.3519 ---------Y 455.772000 0 0.0000 989 | 6/9
50 h-m-p 0.0160 8.0000 0.0001 -----------C 455.772000 0 0.0000 1015 | 6/9
51 h-m-p 0.0160 8.0000 0.0000 +++++ 455.772000 m 8.0000 1033 | 6/9
52 h-m-p 0.0030 1.4882 0.1770 ---------N 455.772000 0 0.0000 1057 | 6/9
53 h-m-p 0.0160 8.0000 0.0000 ---C 455.772000 0 0.0001 1075 | 6/9
54 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/9
55 h-m-p 0.0160 8.0000 0.0001 +++++ 455.772000 m 8.0000 1119 | 6/9
56 h-m-p 0.0071 3.5388 0.2952 ----------Y 455.772000 0 0.0000 1144 | 6/9
57 h-m-p 0.0160 8.0000 0.0018 +++++ 455.771999 m 8.0000 1162 | 6/9
58 h-m-p 0.0526 3.4653 0.2669 ------------Y 455.771999 0 0.0000 1189 | 6/9
59 h-m-p 0.0160 8.0000 0.0000 +++++ 455.771999 m 8.0000 1207 | 6/9
60 h-m-p 0.0008 0.4122 0.9849 +++++ 455.771990 m 0.4122 1225 | 7/9
61 h-m-p 0.1865 0.9324 0.4937 ++ 455.771934 m 0.9324 1240 | 8/9
62 h-m-p 0.0996 0.4978 0.5137 ++ 455.771900 m 0.4978 1254 | 9/9
63 h-m-p 0.0160 8.0000 0.0000 Y 455.771900 0 0.0160 1267 | 9/9
64 h-m-p 0.0160 8.0000 0.0000 Y 455.771900 0 0.0160 1279
Out..
lnL = -455.771900
1280 lfun, 3840 eigenQcodon, 15360 P(t)
Time used: 0:06
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.093197 0.069038 0.016681 0.047775 0.099662 0.069672 0.000100 1.628659 0.440747 0.130747 1.355158
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 15.916855
np = 11
lnL0 = -494.972709
Iterating by ming2
Initial: fx= 494.972709
x= 0.09320 0.06904 0.01668 0.04778 0.09966 0.06967 0.00011 1.62866 0.44075 0.13075 1.35516
1 h-m-p 0.0000 0.0000 218.2031 ++ 494.889732 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 236.5736 +++ 485.170879 m 0.0003 31 | 2/11
3 h-m-p 0.0002 0.0009 72.5383 ++ 472.440427 m 0.0009 45 | 3/11
4 h-m-p 0.0006 0.0029 28.2643 ++ 467.714606 m 0.0029 59 | 4/11
5 h-m-p 0.0007 0.0036 27.7869 ++ 466.019797 m 0.0036 73 | 5/11
6 h-m-p 0.0001 0.0005 178.0555 ++ 458.028593 m 0.0005 87 | 6/11
7 h-m-p 0.0109 0.5327 8.0301 -------------.. | 6/11
8 h-m-p 0.0000 0.0001 152.9337 ++ 455.802607 m 0.0001 126 | 7/11
9 h-m-p 0.0160 8.0000 1.6028 -------------.. | 7/11
10 h-m-p 0.0000 0.0000 110.7560 ++ 455.771988 m 0.0000 165 | 8/11
11 h-m-p 0.0160 8.0000 0.0000 Y 455.771988 0 0.0160 179 | 8/11
12 h-m-p 0.0160 8.0000 0.0000 C 455.771988 0 0.0059 196
Out..
lnL = -455.771988
197 lfun, 788 eigenQcodon, 3546 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -455.781876 S = -455.770554 -0.004333
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:07
did 20 / 47 patterns 0:07
did 30 / 47 patterns 0:07
did 40 / 47 patterns 0:07
did 47 / 47 patterns 0:07
Time used: 0:07
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.064724 0.018508 0.024109 0.098012 0.082577 0.027146 0.000100 0.614211 1.120926
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.055669
np = 9
lnL0 = -488.826943
Iterating by ming2
Initial: fx= 488.826943
x= 0.06472 0.01851 0.02411 0.09801 0.08258 0.02715 0.00011 0.61421 1.12093
1 h-m-p 0.0000 0.0000 244.8510 ++ 488.662194 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0116 38.4273 +++++ 475.610750 m 0.0116 29 | 2/9
3 h-m-p 0.0000 0.0001 87.9232 ++ 474.297223 m 0.0001 41 | 3/9
4 h-m-p 0.0003 0.0040 33.8368 ++ 468.142946 m 0.0040 53 | 4/9
5 h-m-p 0.0003 0.0014 113.9296 ++ 457.069054 m 0.0014 65 | 5/9
6 h-m-p 0.0000 0.0001 665.4508 ++ 455.880283 m 0.0001 77 | 6/9
7 h-m-p 0.0000 0.0001 57.1695 ++ 455.771912 m 0.0001 89 | 7/9
8 h-m-p 1.6000 8.0000 0.0001 ----------Y 455.771912 0 0.0000 111
Out..
lnL = -455.771912
112 lfun, 1232 eigenQcodon, 6720 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.036655 0.025009 0.046580 0.029864 0.021319 0.010724 0.000100 0.900000 0.924485 1.439647 1.299940
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.608465
np = 11
lnL0 = -474.118656
Iterating by ming2
Initial: fx= 474.118656
x= 0.03665 0.02501 0.04658 0.02986 0.02132 0.01072 0.00011 0.90000 0.92448 1.43965 1.29994
1 h-m-p 0.0000 0.0000 256.5991 ++ 473.587921 m 0.0000 16 | 1/11
2 h-m-p 0.0001 0.0124 31.9997 ++++ 465.020252 m 0.0124 32 | 2/11
3 h-m-p 0.0000 0.0002 828.7235 ++ 459.862917 m 0.0002 46 | 3/11
4 h-m-p 0.0003 0.0016 19.4078 ++ 459.819428 m 0.0016 60 | 4/11
5 h-m-p 0.0000 0.0001 139.0102 ++ 459.419311 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0000 41098.7658 ++ 458.329499 m 0.0000 88 | 6/11
7 h-m-p 0.0001 0.0005 443.7779 ++ 455.772006 m 0.0005 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0002 ++ 455.772006 m 8.0000 116 | 7/11
9 h-m-p 0.0074 3.2288 0.2198 ------------Y 455.772006 0 0.0000 146 | 7/11
10 h-m-p 0.0160 8.0000 0.0004 +++++ 455.772006 m 8.0000 167 | 7/11
11 h-m-p 0.0031 0.9368 1.0609 ----------Y 455.772006 0 0.0000 195 | 7/11
12 h-m-p 0.0160 8.0000 0.0005 +++++ 455.772006 m 8.0000 212 | 7/11
13 h-m-p 0.0046 1.1455 0.8772 ----------Y 455.772006 0 0.0000 240 | 7/11
14 h-m-p 0.0160 8.0000 0.0001 +++++ 455.772006 m 8.0000 261 | 7/11
15 h-m-p 0.0024 1.1850 0.8845 -----------N 455.772006 0 0.0000 290 | 7/11
16 h-m-p 0.0160 8.0000 0.0001 +++++ 455.772006 m 8.0000 311 | 7/11
17 h-m-p 0.0028 1.4063 1.0995 ----------Y 455.772006 0 0.0000 339 | 7/11
18 h-m-p 0.0160 8.0000 0.0000 ------------Y 455.772006 0 0.0000 365 | 7/11
19 h-m-p 0.0160 8.0000 0.0001 ----------C 455.772006 0 0.0000 393
Out..
lnL = -455.772006
394 lfun, 4728 eigenQcodon, 26004 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -455.780086 S = -455.770152 -0.004357
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:16
did 20 / 47 patterns 0:16
did 30 / 47 patterns 0:17
did 40 / 47 patterns 0:17
did 47 / 47 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=114
NC_011896_1_WP_010908526_1_1875_MLBR_RS08905 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
NC_002677_1_NP_302205_1_1077_ML1761 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
NZ_LVXE01000063_1_WP_010908526_1_2430_A3216_RS12625 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
NZ_LYPH01000067_1_WP_010908526_1_2385_A8144_RS11455 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
NZ_CP029543_1_WP_010908526_1_1905_DIJ64_RS09705 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
NZ_AP014567_1_WP_010908526_1_1952_JK2ML_RS09940 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
**************************************************
NC_011896_1_WP_010908526_1_1875_MLBR_RS08905 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
NC_002677_1_NP_302205_1_1077_ML1761 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
NZ_LVXE01000063_1_WP_010908526_1_2430_A3216_RS12625 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
NZ_LYPH01000067_1_WP_010908526_1_2385_A8144_RS11455 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
NZ_CP029543_1_WP_010908526_1_1905_DIJ64_RS09705 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
NZ_AP014567_1_WP_010908526_1_1952_JK2ML_RS09940 SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
**************************************************
NC_011896_1_WP_010908526_1_1875_MLBR_RS08905 ISRLVNSEGSSSAE
NC_002677_1_NP_302205_1_1077_ML1761 ISRLVNSEGSSSAE
NZ_LVXE01000063_1_WP_010908526_1_2430_A3216_RS12625 ISRLVNSEGSSSAE
NZ_LYPH01000067_1_WP_010908526_1_2385_A8144_RS11455 ISRLVNSEGSSSAE
NZ_CP029543_1_WP_010908526_1_1905_DIJ64_RS09705 ISRLVNSEGSSSAE
NZ_AP014567_1_WP_010908526_1_1952_JK2ML_RS09940 ISRLVNSEGSSSAE
**************
>NC_011896_1_WP_010908526_1_1875_MLBR_RS08905 TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA >NC_002677_1_NP_302205_1_1077_ML1761 TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA >NZ_LVXE01000063_1_WP_010908526_1_2430_A3216_RS12625 TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA >NZ_LYPH01000067_1_WP_010908526_1_2385_A8144_RS11455 TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA >NZ_CP029543_1_WP_010908526_1_1905_DIJ64_RS09705 TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA >NZ_AP014567_1_WP_010908526_1_1952_JK2ML_RS09940 TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
>NC_011896_1_WP_010908526_1_1875_MLBR_RS08905 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR ISRLVNSEGSSSAE >NC_002677_1_NP_302205_1_1077_ML1761 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR ISRLVNSEGSSSAE >NZ_LVXE01000063_1_WP_010908526_1_2430_A3216_RS12625 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR ISRLVNSEGSSSAE >NZ_LYPH01000067_1_WP_010908526_1_2385_A8144_RS11455 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR ISRLVNSEGSSSAE >NZ_CP029543_1_WP_010908526_1_1905_DIJ64_RS09705 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR ISRLVNSEGSSSAE >NZ_AP014567_1_WP_010908526_1_1952_JK2ML_RS09940 LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR ISRLVNSEGSSSAE
#NEXUS
[ID: 5687294830]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908526_1_1875_MLBR_RS08905
NC_002677_1_NP_302205_1_1077_ML1761
NZ_LVXE01000063_1_WP_010908526_1_2430_A3216_RS12625
NZ_LYPH01000067_1_WP_010908526_1_2385_A8144_RS11455
NZ_CP029543_1_WP_010908526_1_1905_DIJ64_RS09705
NZ_AP014567_1_WP_010908526_1_1952_JK2ML_RS09940
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908526_1_1875_MLBR_RS08905,
2 NC_002677_1_NP_302205_1_1077_ML1761,
3 NZ_LVXE01000063_1_WP_010908526_1_2430_A3216_RS12625,
4 NZ_LYPH01000067_1_WP_010908526_1_2385_A8144_RS11455,
5 NZ_CP029543_1_WP_010908526_1_1905_DIJ64_RS09705,
6 NZ_AP014567_1_WP_010908526_1_1952_JK2ML_RS09940
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06685842,2:0.06642349,3:0.06918051,4:0.06735393,5:0.06561082,6:0.06916776);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06685842,2:0.06642349,3:0.06918051,4:0.06735393,5:0.06561082,6:0.06916776);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -474.55 -478.03
2 -474.53 -477.60
--------------------------------------
TOTAL -474.54 -477.84
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.883104 0.088762 0.352783 1.488230 0.854249 1090.99 1147.50 1.001
r(A<->C){all} 0.167585 0.019095 0.000050 0.443355 0.136145 179.08 181.94 1.001
r(A<->G){all} 0.180049 0.021588 0.000150 0.473522 0.146768 192.99 212.69 1.000
r(A<->T){all} 0.157465 0.019037 0.000040 0.448606 0.119989 212.17 221.26 1.004
r(C<->G){all} 0.161923 0.016999 0.000191 0.420253 0.130040 152.92 229.16 1.006
r(C<->T){all} 0.164875 0.019264 0.000022 0.438127 0.126714 232.40 261.22 1.004
r(G<->T){all} 0.168103 0.019555 0.000006 0.448653 0.134615 84.48 191.38 1.001
pi(A){all} 0.225158 0.000503 0.180862 0.267063 0.225034 1226.25 1288.80 1.000
pi(C){all} 0.253768 0.000550 0.207560 0.298654 0.253385 1290.45 1395.73 1.000
pi(G){all} 0.283733 0.000598 0.235265 0.329651 0.283144 1385.16 1443.08 1.000
pi(T){all} 0.237341 0.000527 0.193574 0.282473 0.237047 1115.41 1208.27 1.000
alpha{1,2} 0.431521 0.254590 0.000114 1.456041 0.261105 1345.43 1423.22 1.001
alpha{3} 0.457958 0.229322 0.000367 1.469619 0.289619 1301.07 1309.61 1.001
pinvar{all} 0.995357 0.000029 0.984602 0.999996 0.997105 1295.48 1353.74 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1761/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 114
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 1 1 1 1 1 1 | TAC 1 1 1 1 1 1 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 4 4 4 4 4 4 | Arg CGT 1 1 1 1 1 1
CTC 3 3 3 3 3 3 | CCC 0 0 0 0 0 0 | CAC 3 3 3 3 3 3 | CGC 3 3 3 3 3 3
CTA 3 3 3 3 3 3 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2
CTG 4 4 4 4 4 4 | CCG 3 3 3 3 3 3 | CAG 1 1 1 1 1 1 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 2 2 2 2 2 2 | ACC 2 2 2 2 2 2 | AAC 2 2 2 2 2 2 | AGC 2 2 2 2 2 2
ATA 4 4 4 4 4 4 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 2 2 2 2 2 2 | AAG 4 4 4 4 4 4 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 3 3 3 3 3 3 | Asp GAT 4 4 4 4 4 4 | Gly GGT 1 1 1 1 1 1
GTC 4 4 4 4 4 4 | GCC 1 1 1 1 1 1 | GAC 4 4 4 4 4 4 | GGC 1 1 1 1 1 1
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 5 5 5 5 5 5 | GGA 0 0 0 0 0 0
GTG 4 4 4 4 4 4 | GCG 4 4 4 4 4 4 | GAG 4 4 4 4 4 4 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908526_1_1875_MLBR_RS08905
position 1: T:0.16667 C:0.29825 A:0.21053 G:0.32456
position 2: T:0.33333 C:0.18421 A:0.31579 G:0.16667
position 3: T:0.21053 C:0.28070 A:0.14912 G:0.35965
Average T:0.23684 C:0.25439 A:0.22515 G:0.28363
#2: NC_002677_1_NP_302205_1_1077_ML1761
position 1: T:0.16667 C:0.29825 A:0.21053 G:0.32456
position 2: T:0.33333 C:0.18421 A:0.31579 G:0.16667
position 3: T:0.21053 C:0.28070 A:0.14912 G:0.35965
Average T:0.23684 C:0.25439 A:0.22515 G:0.28363
#3: NZ_LVXE01000063_1_WP_010908526_1_2430_A3216_RS12625
position 1: T:0.16667 C:0.29825 A:0.21053 G:0.32456
position 2: T:0.33333 C:0.18421 A:0.31579 G:0.16667
position 3: T:0.21053 C:0.28070 A:0.14912 G:0.35965
Average T:0.23684 C:0.25439 A:0.22515 G:0.28363
#4: NZ_LYPH01000067_1_WP_010908526_1_2385_A8144_RS11455
position 1: T:0.16667 C:0.29825 A:0.21053 G:0.32456
position 2: T:0.33333 C:0.18421 A:0.31579 G:0.16667
position 3: T:0.21053 C:0.28070 A:0.14912 G:0.35965
Average T:0.23684 C:0.25439 A:0.22515 G:0.28363
#5: NZ_CP029543_1_WP_010908526_1_1905_DIJ64_RS09705
position 1: T:0.16667 C:0.29825 A:0.21053 G:0.32456
position 2: T:0.33333 C:0.18421 A:0.31579 G:0.16667
position 3: T:0.21053 C:0.28070 A:0.14912 G:0.35965
Average T:0.23684 C:0.25439 A:0.22515 G:0.28363
#6: NZ_AP014567_1_WP_010908526_1_1952_JK2ML_RS09940
position 1: T:0.16667 C:0.29825 A:0.21053 G:0.32456
position 2: T:0.33333 C:0.18421 A:0.31579 G:0.16667
position 3: T:0.21053 C:0.28070 A:0.14912 G:0.35965
Average T:0.23684 C:0.25439 A:0.22515 G:0.28363
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 0
TTC 6 | TCC 6 | TAC 6 | TGC 12
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 18 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 24 | Arg R CGT 6
CTC 18 | CCC 0 | CAC 18 | CGC 18
CTA 18 | CCA 0 | Gln Q CAA 6 | CGA 12
CTG 24 | CCG 18 | CAG 6 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 6
ATC 12 | ACC 12 | AAC 12 | AGC 12
ATA 24 | ACA 0 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 12 | ACG 12 | AAG 24 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 18 | Asp D GAT 24 | Gly G GGT 6
GTC 24 | GCC 6 | GAC 24 | GGC 6
GTA 0 | GCA 6 | Glu E GAA 30 | GGA 0
GTG 24 | GCG 24 | GAG 24 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16667 C:0.29825 A:0.21053 G:0.32456
position 2: T:0.33333 C:0.18421 A:0.31579 G:0.16667
position 3: T:0.21053 C:0.28070 A:0.14912 G:0.35965
Average T:0.23684 C:0.25439 A:0.22515 G:0.28363
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -455.772030 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299872 1.299940
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908526_1_1875_MLBR_RS08905: 0.000004, NC_002677_1_NP_302205_1_1077_ML1761: 0.000004, NZ_LVXE01000063_1_WP_010908526_1_2430_A3216_RS12625: 0.000004, NZ_LYPH01000067_1_WP_010908526_1_2385_A8144_RS11455: 0.000004, NZ_CP029543_1_WP_010908526_1_1905_DIJ64_RS09705: 0.000004, NZ_AP014567_1_WP_010908526_1_1952_JK2ML_RS09940: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29987
omega (dN/dS) = 1.29994
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 271.8 70.2 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 271.8 70.2 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 271.8 70.2 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 271.8 70.2 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 271.8 70.2 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 271.8 70.2 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -455.771900 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908526_1_1875_MLBR_RS08905: 0.000004, NC_002677_1_NP_302205_1_1077_ML1761: 0.000004, NZ_LVXE01000063_1_WP_010908526_1_2430_A3216_RS12625: 0.000004, NZ_LYPH01000067_1_WP_010908526_1_2385_A8144_RS11455: 0.000004, NZ_CP029543_1_WP_010908526_1_1905_DIJ64_RS09705: 0.000004, NZ_AP014567_1_WP_010908526_1_1952_JK2ML_RS09940: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 278.9 63.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 278.9 63.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 278.9 63.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 278.9 63.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 278.9 63.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 278.9 63.1 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -455.771988 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.681378 0.191858 0.000001 1.321235
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908526_1_1875_MLBR_RS08905: 0.000004, NC_002677_1_NP_302205_1_1077_ML1761: 0.000004, NZ_LVXE01000063_1_WP_010908526_1_2430_A3216_RS12625: 0.000004, NZ_LYPH01000067_1_WP_010908526_1_2385_A8144_RS11455: 0.000004, NZ_CP029543_1_WP_010908526_1_1905_DIJ64_RS09705: 0.000004, NZ_AP014567_1_WP_010908526_1_1952_JK2ML_RS09940: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.68138 0.19186 0.12676
w: 0.00000 1.00000 1.32123
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 278.9 63.1 0.3593 0.0000 0.0000 0.0 0.0
7..2 0.000 278.9 63.1 0.3593 0.0000 0.0000 0.0 0.0
7..3 0.000 278.9 63.1 0.3593 0.0000 0.0000 0.0 0.0
7..4 0.000 278.9 63.1 0.3593 0.0000 0.0000 0.0 0.0
7..5 0.000 278.9 63.1 0.3593 0.0000 0.0000 0.0 0.0
7..6 0.000 278.9 63.1 0.3593 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908526_1_1875_MLBR_RS08905)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908526_1_1875_MLBR_RS08905)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:07
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -455.771912 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.036792 1.198930
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908526_1_1875_MLBR_RS08905: 0.000004, NC_002677_1_NP_302205_1_1077_ML1761: 0.000004, NZ_LVXE01000063_1_WP_010908526_1_2430_A3216_RS12625: 0.000004, NZ_LYPH01000067_1_WP_010908526_1_2385_A8144_RS11455: 0.000004, NZ_CP029543_1_WP_010908526_1_1905_DIJ64_RS09705: 0.000004, NZ_AP014567_1_WP_010908526_1_1952_JK2ML_RS09940: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.03679 q = 1.19893
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 0.00030 0.00914 0.19492
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 278.9 63.1 0.0204 0.0000 0.0000 0.0 0.0
7..2 0.000 278.9 63.1 0.0204 0.0000 0.0000 0.0 0.0
7..3 0.000 278.9 63.1 0.0204 0.0000 0.0000 0.0 0.0
7..4 0.000 278.9 63.1 0.0204 0.0000 0.0000 0.0 0.0
7..5 0.000 278.9 63.1 0.0204 0.0000 0.0000 0.0 0.0
7..6 0.000 278.9 63.1 0.0204 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -455.772006 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.702664 0.631322 1.560396 1.495481
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908526_1_1875_MLBR_RS08905: 0.000004, NC_002677_1_NP_302205_1_1077_ML1761: 0.000004, NZ_LVXE01000063_1_WP_010908526_1_2430_A3216_RS12625: 0.000004, NZ_LYPH01000067_1_WP_010908526_1_2385_A8144_RS11455: 0.000004, NZ_CP029543_1_WP_010908526_1_1905_DIJ64_RS09705: 0.000004, NZ_AP014567_1_WP_010908526_1_1952_JK2ML_RS09940: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.70266 p = 0.63132 q = 1.56040
(p1 = 0.29734) w = 1.49548
MLEs of dN/dS (w) for site classes (K=11)
p: 0.07027 0.07027 0.07027 0.07027 0.07027 0.07027 0.07027 0.07027 0.07027 0.07027 0.29734
w: 0.00527 0.03027 0.06892 0.11960 0.18227 0.25789 0.34861 0.45862 0.59708 0.79318 1.49548
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 278.9 63.1 0.6457 0.0000 0.0000 0.0 0.0
7..2 0.000 278.9 63.1 0.6457 0.0000 0.0000 0.0 0.0
7..3 0.000 278.9 63.1 0.6457 0.0000 0.0000 0.0 0.0
7..4 0.000 278.9 63.1 0.6457 0.0000 0.0000 0.0 0.0
7..5 0.000 278.9 63.1 0.6457 0.0000 0.0000 0.0 0.0
7..6 0.000 278.9 63.1 0.6457 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908526_1_1875_MLBR_RS08905)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908526_1_1875_MLBR_RS08905)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:17
Model 1: NearlyNeutral -455.7719 Model 2: PositiveSelection -455.771988 Model 0: one-ratio -455.77203 Model 7: beta -455.771912 Model 8: beta&w>1 -455.772006 Model 0 vs 1 2.599999999119973E-4 Model 2 vs 1 1.7600000001039007E-4 Model 8 vs 7 1.8799999998009298E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
