--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:36:14 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1761/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -474.55          -478.03
2       -474.53          -477.60
--------------------------------------
TOTAL     -474.54          -477.84
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.883104    0.088762    0.352783    1.488230    0.854249   1090.99   1147.50    1.001
r(A<->C){all}   0.167585    0.019095    0.000050    0.443355    0.136145    179.08    181.94    1.001
r(A<->G){all}   0.180049    0.021588    0.000150    0.473522    0.146768    192.99    212.69    1.000
r(A<->T){all}   0.157465    0.019037    0.000040    0.448606    0.119989    212.17    221.26    1.004
r(C<->G){all}   0.161923    0.016999    0.000191    0.420253    0.130040    152.92    229.16    1.006
r(C<->T){all}   0.164875    0.019264    0.000022    0.438127    0.126714    232.40    261.22    1.004
r(G<->T){all}   0.168103    0.019555    0.000006    0.448653    0.134615     84.48    191.38    1.001
pi(A){all}      0.225158    0.000503    0.180862    0.267063    0.225034   1226.25   1288.80    1.000
pi(C){all}      0.253768    0.000550    0.207560    0.298654    0.253385   1290.45   1395.73    1.000
pi(G){all}      0.283733    0.000598    0.235265    0.329651    0.283144   1385.16   1443.08    1.000
pi(T){all}      0.237341    0.000527    0.193574    0.282473    0.237047   1115.41   1208.27    1.000
alpha{1,2}      0.431521    0.254590    0.000114    1.456041    0.261105   1345.43   1423.22    1.001
alpha{3}        0.457958    0.229322    0.000367    1.469619    0.289619   1301.07   1309.61    1.001
pinvar{all}     0.995357    0.000029    0.984602    0.999996    0.997105   1295.48   1353.74    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-455.7719
Model 2: PositiveSelection	-455.771988
Model 0: one-ratio	-455.77203
Model 7: beta	-455.771912
Model 8: beta&w>1	-455.772006


Model 0 vs 1	2.599999999119973E-4

Model 2 vs 1	1.7600000001039007E-4

Model 8 vs 7	1.8799999998009298E-4
>C1
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C2
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C3
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C4
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C5
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C6
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=114 

C1              LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C2              LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C3              LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C4              LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C5              LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C6              LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
                **************************************************

C1              SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C2              SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C3              SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C4              SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C5              SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C6              SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
                **************************************************

C1              ISRLVNSEGSSSAE
C2              ISRLVNSEGSSSAE
C3              ISRLVNSEGSSSAE
C4              ISRLVNSEGSSSAE
C5              ISRLVNSEGSSSAE
C6              ISRLVNSEGSSSAE
                **************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  114 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  114 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3420]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3420]--->[3420]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.457 Mb, Max= 30.641 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C2              LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C3              LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C4              LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C5              LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
C6              LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
                **************************************************

C1              SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C2              SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C3              SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C4              SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C5              SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
C6              SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
                **************************************************

C1              ISRLVNSEGSSSAE
C2              ISRLVNSEGSSSAE
C3              ISRLVNSEGSSSAE
C4              ISRLVNSEGSSSAE
C5              ISRLVNSEGSSSAE
C6              ISRLVNSEGSSSAE
                **************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
C2              TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
C3              TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
C4              TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
C5              TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
C6              TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
                **************************************************

C1              TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
C2              TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
C3              TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
C4              TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
C5              TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
C6              TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
                **************************************************

C1              TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
C2              TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
C3              TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
C4              TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
C5              TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
C6              TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
                **************************************************

C1              AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
C2              AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
C3              AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
C4              AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
C5              AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
C6              AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
                **************************************************

C1              CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
C2              CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
C3              CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
C4              CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
C5              CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
C6              CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
                **************************************************

C1              TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
C2              TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
C3              TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
C4              TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
C5              TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
C6              TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
                **************************************************

C1              ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
C2              ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
C3              ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
C4              ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
C5              ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
C6              ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
                ******************************************



>C1
TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
>C2
TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
>C3
TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
>C4
TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
>C5
TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
>C6
TTGATCGAAGCTGATTATGCTGCGTGGCTCAAGGAACGCTGGGAGCATTT
TGAACACCACACGCCGCTGCGGGTGGTCAACTGCCCGGATTACCACCTGA
TTCGGGTCGCACATGAGTTGATAGCTCAAGTGCTCAATGAGCATCTAGAC
AGCAAGGTTACGGTGCTGCTGTTTCGTCGAAAGTATTCGCCGTTCTTGTG
CCAGCTACTTCATGATCGCACCACCGACAAGATGGTCCGCGCCGTCGGCC
TCATTCGAGACGCGATCGCGCTAATAATGCTTGACGATATAGAATCGCGG
ATATCACGGTTGGTGAACTCCGAGGGTTCGAGTAGCGCGGAA
>C1
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C2
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C3
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C4
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C5
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE
>C6
LIEADYAAWLKERWEHFEHHTPLRVVNCPDYHLIRVAHELIAQVLNEHLD
SKVTVLLFRRKYSPFLCQLLHDRTTDKMVRAVGLIRDAIALIMLDDIESR
ISRLVNSEGSSSAE


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 342 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579858492
      Setting output file names to "/data/7res/ML1761/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 993132185
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5687294830
      Seed = 1750970775
      Swapseed = 1579858492
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -765.412279 -- -24.965149
         Chain 2 -- -765.412395 -- -24.965149
         Chain 3 -- -765.412395 -- -24.965149
         Chain 4 -- -765.412395 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -765.412395 -- -24.965149
         Chain 2 -- -765.412351 -- -24.965149
         Chain 3 -- -765.412351 -- -24.965149
         Chain 4 -- -765.412395 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-765.412] (-765.412) (-765.412) (-765.412) * [-765.412] (-765.412) (-765.412) (-765.412) 
        500 -- (-490.993) [-484.658] (-487.090) (-487.800) * (-484.033) (-480.794) [-486.579] (-488.652) -- 0:33:19
       1000 -- (-494.595) (-480.918) [-490.389] (-481.916) * [-482.756] (-487.003) (-488.637) (-480.254) -- 0:16:39
       1500 -- (-492.013) (-483.146) (-486.618) [-487.612] * [-484.441] (-481.693) (-482.806) (-489.838) -- 0:11:05
       2000 -- (-486.935) [-482.723] (-482.866) (-489.363) * [-482.233] (-491.615) (-485.857) (-484.805) -- 0:08:19
       2500 -- (-483.426) (-482.109) (-485.263) [-485.883] * [-487.542] (-490.286) (-490.919) (-483.990) -- 0:06:39
       3000 -- (-486.902) [-481.369] (-482.890) (-485.282) * (-486.645) [-481.475] (-482.979) (-491.182) -- 0:05:32
       3500 -- (-492.305) (-481.841) [-483.866] (-482.948) * (-484.963) [-480.357] (-487.180) (-482.165) -- 0:04:44
       4000 -- (-480.734) (-482.375) (-489.270) [-481.457] * (-479.365) (-481.546) (-488.108) [-483.267] -- 0:04:09
       4500 -- [-488.800] (-488.587) (-487.612) (-485.036) * [-476.862] (-485.566) (-484.704) (-482.182) -- 0:03:41
       5000 -- (-484.204) [-481.201] (-485.119) (-480.170) * (-484.530) (-482.462) (-505.892) [-478.197] -- 0:03:19

      Average standard deviation of split frequencies: 0.057140

       5500 -- (-489.259) [-487.752] (-493.442) (-482.044) * (-483.886) [-484.481] (-490.940) (-486.288) -- 0:03:00
       6000 -- (-488.139) (-493.566) (-482.809) [-482.444] * (-487.956) (-487.601) [-478.019] (-491.915) -- 0:02:45
       6500 -- [-484.622] (-480.834) (-492.147) (-486.106) * [-484.564] (-484.953) (-476.422) (-480.040) -- 0:02:32
       7000 -- [-479.547] (-477.057) (-478.262) (-489.045) * (-481.526) (-485.053) [-474.575] (-489.727) -- 0:02:21
       7500 -- (-489.921) (-474.281) (-486.706) [-483.400] * (-487.002) (-484.175) [-478.276] (-499.092) -- 0:02:12
       8000 -- (-489.861) (-474.442) (-487.839) [-495.636] * (-483.062) (-485.611) (-477.589) [-488.470] -- 0:02:04
       8500 -- (-488.466) [-474.763] (-483.380) (-490.549) * [-491.843] (-483.512) (-475.656) (-483.621) -- 0:01:56
       9000 -- (-481.069) (-473.816) [-487.889] (-483.823) * (-486.865) (-480.433) (-476.292) [-484.118] -- 0:01:50
       9500 -- (-482.037) (-475.299) [-478.919] (-487.082) * (-484.713) (-485.778) (-474.976) [-479.243] -- 0:01:44
      10000 -- [-481.597] (-477.577) (-487.468) (-476.262) * (-481.713) (-485.012) (-476.878) [-478.357] -- 0:01:39

      Average standard deviation of split frequencies: 0.074432

      10500 -- (-483.598) [-475.091] (-493.498) (-474.236) * (-487.473) (-485.661) [-476.496] (-483.146) -- 0:01:34
      11000 -- (-479.678) (-475.705) (-488.922) [-474.047] * (-492.244) (-474.754) (-473.842) [-483.520] -- 0:01:29
      11500 -- [-485.431] (-474.727) (-492.814) (-476.577) * (-495.035) (-477.979) (-473.613) [-486.663] -- 0:01:25
      12000 -- (-487.747) (-476.664) [-483.927] (-475.669) * (-477.807) [-476.501] (-477.077) (-484.527) -- 0:01:22
      12500 -- (-497.195) [-474.755] (-484.477) (-473.317) * (-481.868) [-479.084] (-477.225) (-481.452) -- 0:01:19
      13000 -- (-486.117) [-474.950] (-481.910) (-476.028) * [-483.840] (-478.952) (-474.953) (-491.439) -- 0:01:15
      13500 -- (-491.828) (-476.014) (-484.701) [-476.892] * (-483.918) (-474.822) (-478.855) [-484.189] -- 0:02:26
      14000 -- (-484.736) [-475.986] (-498.131) (-476.430) * (-485.387) (-474.672) (-474.496) [-481.807] -- 0:02:20
      14500 -- [-480.459] (-480.610) (-487.876) (-473.730) * (-481.138) (-473.610) [-474.307] (-481.947) -- 0:02:15
      15000 -- (-489.810) (-475.458) (-484.383) [-473.407] * [-486.081] (-473.340) (-476.209) (-489.163) -- 0:02:11

      Average standard deviation of split frequencies: 0.051911

      15500 -- (-494.564) [-473.666] (-497.965) (-474.695) * (-483.444) (-474.965) (-474.831) [-477.831] -- 0:02:07
      16000 -- (-491.152) (-474.741) [-473.584] (-474.794) * (-486.964) [-474.281] (-478.186) (-482.100) -- 0:02:03
      16500 -- (-496.093) (-474.386) (-474.480) [-473.230] * (-483.168) (-473.446) [-474.538] (-486.513) -- 0:01:59
      17000 -- (-474.665) (-474.690) (-476.489) [-479.913] * (-483.585) (-473.180) [-473.802] (-485.940) -- 0:01:55
      17500 -- (-474.146) [-474.856] (-474.576) (-475.365) * (-482.546) [-474.961] (-474.151) (-485.719) -- 0:01:52
      18000 -- (-477.286) [-473.606] (-476.863) (-474.610) * [-485.590] (-480.550) (-473.585) (-481.121) -- 0:01:49
      18500 -- (-476.614) (-474.370) [-475.751] (-474.671) * (-478.284) [-475.883] (-475.917) (-492.407) -- 0:01:46
      19000 -- (-478.259) (-475.508) [-479.831] (-475.434) * [-484.202] (-475.241) (-475.039) (-485.638) -- 0:01:43
      19500 -- [-475.160] (-479.538) (-482.300) (-476.879) * (-491.496) [-479.075] (-478.208) (-480.369) -- 0:01:40
      20000 -- (-478.992) [-476.947] (-474.999) (-475.095) * (-482.077) [-475.115] (-473.813) (-492.943) -- 0:01:38

      Average standard deviation of split frequencies: 0.053223

      20500 -- (-478.689) (-473.563) [-476.193] (-472.893) * (-509.578) [-476.717] (-473.144) (-486.332) -- 0:01:35
      21000 -- (-476.449) (-473.438) [-475.941] (-474.825) * (-479.340) (-475.721) [-473.157] (-481.554) -- 0:01:33
      21500 -- [-479.616] (-473.568) (-473.876) (-473.689) * [-478.258] (-474.471) (-473.709) (-479.432) -- 0:01:31
      22000 -- [-479.949] (-473.223) (-477.364) (-474.417) * (-478.598) [-477.168] (-472.932) (-478.714) -- 0:01:28
      22500 -- (-477.629) (-478.837) [-476.938] (-473.727) * (-476.117) (-475.754) (-474.602) [-487.529] -- 0:01:26
      23000 -- (-474.695) (-474.662) (-475.163) [-473.106] * [-475.216] (-477.288) (-473.392) (-486.103) -- 0:01:24
      23500 -- (-475.266) (-476.172) [-476.128] (-474.706) * (-473.497) (-475.662) (-476.528) [-480.956] -- 0:01:23
      24000 -- (-475.193) (-474.872) (-474.032) [-473.500] * [-474.573] (-475.663) (-475.720) (-481.663) -- 0:01:21
      24500 -- (-477.362) (-475.330) (-474.023) [-475.028] * (-476.265) (-474.114) [-473.689] (-489.373) -- 0:01:19
      25000 -- [-475.849] (-475.482) (-476.082) (-473.852) * (-475.147) (-476.580) (-473.826) [-488.110] -- 0:01:18

      Average standard deviation of split frequencies: 0.042064

      25500 -- (-475.286) (-474.724) [-474.635] (-474.416) * (-475.800) (-473.940) (-474.673) [-482.221] -- 0:01:16
      26000 -- (-475.346) (-473.758) (-474.377) [-473.636] * (-474.895) (-476.159) (-473.891) [-479.249] -- 0:01:14
      26500 -- (-475.166) [-475.123] (-477.977) (-474.110) * [-475.745] (-475.009) (-475.349) (-480.541) -- 0:01:13
      27000 -- (-477.736) (-474.607) (-476.359) [-474.866] * [-473.385] (-474.375) (-473.597) (-485.946) -- 0:01:12
      27500 -- (-477.604) (-475.640) (-478.299) [-480.090] * [-475.409] (-473.705) (-473.662) (-487.701) -- 0:01:10
      28000 -- (-477.164) (-475.207) [-476.632] (-474.355) * (-475.001) (-476.482) (-475.602) [-486.933] -- 0:01:09
      28500 -- (-475.034) (-473.010) (-475.313) [-474.593] * (-476.969) [-474.620] (-473.676) (-485.458) -- 0:01:42
      29000 -- (-473.948) (-480.528) [-473.869] (-476.470) * (-478.225) [-473.449] (-473.435) (-491.541) -- 0:01:40
      29500 -- (-474.129) (-478.729) [-474.825] (-475.501) * (-479.674) (-475.146) [-472.908] (-483.614) -- 0:01:38
      30000 -- (-474.837) (-476.030) [-475.462] (-475.361) * [-476.230] (-474.532) (-473.994) (-493.629) -- 0:01:37

      Average standard deviation of split frequencies: 0.038796

      30500 -- (-475.552) (-474.406) [-475.195] (-473.308) * [-475.023] (-475.703) (-474.424) (-488.227) -- 0:01:35
      31000 -- (-478.123) (-476.418) (-474.518) [-474.395] * (-476.883) [-473.865] (-473.828) (-490.258) -- 0:01:33
      31500 -- [-473.395] (-482.536) (-474.021) (-477.069) * (-477.965) [-473.596] (-475.003) (-476.904) -- 0:01:32
      32000 -- (-477.698) (-485.245) (-475.304) [-476.298] * (-474.033) (-473.799) (-476.315) [-474.941] -- 0:01:30
      32500 -- (-477.325) [-475.862] (-476.908) (-474.536) * (-474.788) (-474.336) (-475.508) [-476.436] -- 0:01:29
      33000 -- (-474.776) (-476.105) (-476.566) [-474.410] * (-475.361) (-473.317) (-474.906) [-473.592] -- 0:01:27
      33500 -- (-474.640) [-475.005] (-477.647) (-479.080) * (-479.395) [-472.891] (-474.531) (-475.158) -- 0:01:26
      34000 -- [-473.819] (-475.815) (-476.625) (-473.595) * (-473.411) (-475.045) (-477.629) [-474.685] -- 0:01:25
      34500 -- (-474.293) [-476.272] (-478.795) (-475.807) * (-476.772) (-475.573) [-475.751] (-474.253) -- 0:01:23
      35000 -- (-474.492) (-475.539) (-475.932) [-476.711] * (-474.522) [-475.654] (-473.216) (-478.714) -- 0:01:22

      Average standard deviation of split frequencies: 0.035712

      35500 -- (-473.500) (-478.185) (-477.048) [-477.680] * (-475.398) (-475.547) (-476.854) [-483.006] -- 0:01:21
      36000 -- (-474.440) (-474.921) (-477.652) [-476.040] * (-476.921) (-474.575) [-476.769] (-478.193) -- 0:01:20
      36500 -- (-474.324) [-475.038] (-474.980) (-476.501) * [-473.034] (-474.504) (-478.052) (-474.704) -- 0:01:19
      37000 -- (-474.449) (-476.161) [-473.061] (-473.492) * (-476.942) [-475.764] (-478.179) (-474.735) -- 0:01:18
      37500 -- (-475.972) (-474.675) [-474.335] (-475.659) * (-476.380) (-475.602) [-474.354] (-474.469) -- 0:01:17
      38000 -- (-475.456) (-474.209) [-473.880] (-477.326) * (-474.553) [-474.720] (-474.536) (-476.521) -- 0:01:15
      38500 -- (-477.492) [-473.263] (-475.140) (-476.008) * (-473.595) [-477.355] (-474.741) (-473.179) -- 0:01:14
      39000 -- (-474.890) [-475.706] (-476.387) (-474.416) * [-475.231] (-477.931) (-479.541) (-474.414) -- 0:01:13
      39500 -- (-483.068) [-474.502] (-477.270) (-481.066) * (-475.311) [-476.350] (-476.295) (-473.875) -- 0:01:12
      40000 -- (-480.242) [-473.451] (-475.118) (-478.312) * [-473.461] (-475.418) (-473.881) (-473.539) -- 0:01:12

      Average standard deviation of split frequencies: 0.036515

      40500 -- (-476.859) (-477.957) (-476.606) [-476.786] * (-475.113) (-474.798) [-477.621] (-476.242) -- 0:01:11
      41000 -- (-475.753) (-473.077) [-477.807] (-476.043) * [-474.247] (-474.473) (-474.556) (-482.021) -- 0:01:10
      41500 -- [-477.458] (-473.073) (-476.938) (-477.294) * [-473.836] (-475.602) (-475.216) (-476.237) -- 0:01:09
      42000 -- (-477.975) (-475.298) [-475.710] (-476.075) * (-474.483) (-475.430) [-475.488] (-473.728) -- 0:01:08
      42500 -- (-481.831) (-476.493) (-475.616) [-476.836] * [-473.739] (-475.507) (-473.803) (-475.824) -- 0:01:07
      43000 -- (-474.546) (-477.168) [-476.985] (-477.036) * (-474.822) [-473.200] (-477.019) (-474.246) -- 0:01:06
      43500 -- (-473.943) [-477.047] (-479.358) (-476.769) * [-475.696] (-475.573) (-476.627) (-474.185) -- 0:01:05
      44000 -- (-477.784) [-474.590] (-478.029) (-474.735) * (-476.318) (-474.603) (-476.352) [-474.336] -- 0:01:05
      44500 -- (-474.848) (-474.765) (-473.696) [-479.616] * [-477.256] (-473.906) (-474.613) (-476.874) -- 0:01:04
      45000 -- (-475.403) (-476.077) (-474.407) [-477.967] * [-475.055] (-473.386) (-473.337) (-477.539) -- 0:01:24

      Average standard deviation of split frequencies: 0.036112

      45500 -- (-478.510) [-478.255] (-474.590) (-474.413) * (-479.808) (-473.904) [-474.223] (-476.723) -- 0:01:23
      46000 -- (-478.692) [-473.977] (-478.235) (-473.587) * (-478.195) (-478.323) [-476.262] (-473.567) -- 0:01:22
      46500 -- (-477.780) (-473.697) [-474.111] (-474.044) * [-474.374] (-476.576) (-474.974) (-473.120) -- 0:01:22
      47000 -- (-477.445) (-473.439) [-473.509] (-475.365) * [-475.022] (-479.929) (-474.765) (-473.217) -- 0:01:21
      47500 -- (-476.476) [-477.243] (-475.349) (-477.327) * [-473.983] (-475.122) (-477.085) (-476.752) -- 0:01:20
      48000 -- (-477.022) (-474.810) [-474.938] (-482.774) * [-475.432] (-477.068) (-475.853) (-473.602) -- 0:01:19
      48500 -- (-474.461) [-475.133] (-477.685) (-473.970) * (-476.978) (-474.265) [-474.733] (-477.680) -- 0:01:18
      49000 -- (-473.877) (-475.577) (-475.347) [-475.157] * [-473.095] (-475.603) (-474.593) (-473.273) -- 0:01:17
      49500 -- (-474.841) (-474.168) [-473.470] (-476.300) * (-475.346) [-474.670] (-476.751) (-473.907) -- 0:01:16
      50000 -- (-475.381) [-474.136] (-477.894) (-474.163) * (-476.858) (-474.392) [-474.438] (-478.832) -- 0:01:16

      Average standard deviation of split frequencies: 0.032099

      50500 -- (-475.056) [-474.057] (-473.430) (-476.947) * (-478.825) (-473.477) [-475.140] (-476.721) -- 0:01:15
      51000 -- (-473.349) (-473.267) (-484.226) [-476.241] * (-478.313) (-473.979) [-473.660] (-474.911) -- 0:01:14
      51500 -- (-473.859) (-474.808) (-480.790) [-475.445] * (-473.620) (-476.366) (-473.230) [-474.412] -- 0:01:13
      52000 -- (-476.178) (-477.254) [-474.937] (-474.212) * (-474.115) [-478.026] (-473.922) (-478.394) -- 0:01:12
      52500 -- [-476.301] (-474.784) (-475.345) (-475.546) * (-476.000) (-478.037) (-476.323) [-476.083] -- 0:01:12
      53000 -- (-477.293) (-474.623) [-474.141] (-474.494) * (-478.352) (-476.939) [-474.013] (-477.019) -- 0:01:11
      53500 -- (-482.038) [-475.019] (-476.816) (-476.533) * (-473.997) [-476.837] (-475.184) (-477.263) -- 0:01:10
      54000 -- (-476.073) (-475.481) [-475.632] (-475.562) * [-474.360] (-481.185) (-474.740) (-475.338) -- 0:01:10
      54500 -- (-476.748) (-473.994) [-478.500] (-474.842) * (-474.904) (-477.559) [-476.406] (-476.977) -- 0:01:09
      55000 -- (-476.511) [-474.073] (-477.967) (-475.508) * (-474.135) (-475.409) [-475.033] (-479.138) -- 0:01:08

      Average standard deviation of split frequencies: 0.031567

      55500 -- [-475.459] (-478.005) (-476.459) (-475.067) * [-473.108] (-477.679) (-473.408) (-479.813) -- 0:01:08
      56000 -- (-477.613) (-476.070) [-477.224] (-474.230) * (-473.913) (-475.279) [-474.526] (-475.206) -- 0:01:07
      56500 -- (-475.276) (-476.077) [-474.487] (-474.949) * (-474.698) (-474.623) (-475.643) [-474.871] -- 0:01:06
      57000 -- (-477.522) (-476.512) [-475.917] (-475.733) * (-473.099) (-474.418) [-477.970] (-477.362) -- 0:01:06
      57500 -- (-477.700) (-475.457) [-474.796] (-473.617) * (-474.571) [-473.551] (-475.958) (-476.550) -- 0:01:05
      58000 -- (-476.067) [-474.710] (-478.767) (-474.986) * (-477.407) (-473.911) (-480.147) [-474.534] -- 0:01:04
      58500 -- (-476.407) (-473.593) (-476.093) [-476.384] * (-480.813) [-473.928] (-477.876) (-474.925) -- 0:01:04
      59000 -- (-475.558) (-475.937) [-476.138] (-476.472) * (-474.824) [-474.962] (-480.292) (-474.797) -- 0:01:03
      59500 -- [-474.675] (-474.615) (-474.744) (-476.796) * [-474.184] (-475.454) (-474.154) (-473.419) -- 0:01:03
      60000 -- (-475.190) (-473.311) [-474.303] (-477.259) * (-474.733) [-474.446] (-473.862) (-477.014) -- 0:01:02

      Average standard deviation of split frequencies: 0.033126

      60500 -- (-474.196) (-477.980) (-474.172) [-475.911] * [-475.003] (-475.554) (-473.573) (-473.380) -- 0:01:02
      61000 -- (-473.470) (-482.233) (-473.986) [-476.734] * (-478.244) (-473.376) [-474.899] (-473.715) -- 0:01:16
      61500 -- [-474.705] (-476.570) (-474.839) (-475.792) * (-474.746) [-474.148] (-476.307) (-473.966) -- 0:01:16
      62000 -- (-473.872) (-479.935) (-474.486) [-474.905] * (-475.644) [-474.071] (-477.636) (-477.298) -- 0:01:15
      62500 -- (-474.126) [-477.088] (-475.528) (-476.654) * [-475.478] (-474.654) (-477.661) (-482.623) -- 0:01:15
      63000 -- (-474.783) (-473.719) (-473.073) [-473.388] * (-474.082) (-475.128) [-474.788] (-480.536) -- 0:01:14
      63500 -- [-475.592] (-473.965) (-473.172) (-474.358) * (-475.328) (-475.076) [-474.948] (-475.594) -- 0:01:13
      64000 -- (-477.422) (-476.255) [-473.543] (-477.748) * [-473.160] (-476.120) (-476.276) (-473.731) -- 0:01:13
      64500 -- (-475.626) (-475.554) [-473.605] (-475.161) * [-473.236] (-478.086) (-474.330) (-477.962) -- 0:01:12
      65000 -- [-473.856] (-475.786) (-473.313) (-476.622) * (-474.513) (-475.876) [-477.067] (-476.416) -- 0:01:11

      Average standard deviation of split frequencies: 0.027818

      65500 -- (-475.248) (-477.442) [-473.881] (-474.104) * (-475.078) (-480.170) [-476.597] (-475.597) -- 0:01:11
      66000 -- (-477.034) (-474.869) [-473.700] (-475.433) * (-473.531) [-475.987] (-474.383) (-475.646) -- 0:01:10
      66500 -- [-475.410] (-473.669) (-475.739) (-474.123) * (-473.334) (-475.481) [-474.570] (-477.729) -- 0:01:10
      67000 -- [-474.454] (-473.449) (-474.979) (-475.500) * (-475.190) [-475.767] (-477.457) (-477.008) -- 0:01:09
      67500 -- [-474.820] (-473.276) (-475.528) (-475.819) * (-474.967) [-476.417] (-474.858) (-474.548) -- 0:01:09
      68000 -- (-476.941) (-480.129) [-473.285] (-478.226) * (-475.078) [-474.628] (-474.937) (-477.643) -- 0:01:08
      68500 -- (-475.575) (-478.026) (-474.388) [-480.165] * (-475.999) [-473.412] (-474.387) (-477.307) -- 0:01:07
      69000 -- (-478.011) (-474.892) [-475.265] (-474.914) * (-474.605) [-473.051] (-479.944) (-477.527) -- 0:01:07
      69500 -- (-474.270) (-473.708) (-479.282) [-473.846] * [-475.528] (-476.659) (-473.599) (-473.293) -- 0:01:06
      70000 -- [-477.422] (-473.976) (-473.986) (-479.622) * (-475.641) (-478.427) [-474.427] (-473.945) -- 0:01:06

      Average standard deviation of split frequencies: 0.029277

      70500 -- (-473.261) [-473.049] (-474.860) (-474.193) * [-474.901] (-475.438) (-480.516) (-476.534) -- 0:01:05
      71000 -- [-475.714] (-476.808) (-477.466) (-476.167) * (-478.387) (-474.026) [-476.198] (-475.933) -- 0:01:05
      71500 -- [-476.555] (-478.106) (-478.937) (-475.677) * (-473.841) (-475.476) (-475.592) [-474.176] -- 0:01:04
      72000 -- (-478.997) [-475.430] (-473.917) (-478.437) * (-474.048) (-479.586) (-474.472) [-475.207] -- 0:01:04
      72500 -- (-475.504) (-479.213) [-475.029] (-478.676) * [-473.367] (-476.812) (-474.861) (-474.645) -- 0:01:03
      73000 -- [-474.682] (-477.411) (-479.348) (-473.384) * (-477.473) [-477.283] (-475.221) (-477.017) -- 0:01:03
      73500 -- [-475.849] (-474.254) (-479.288) (-474.155) * (-476.459) (-473.982) (-477.943) [-474.122] -- 0:01:03
      74000 -- (-476.489) [-474.829] (-475.121) (-474.954) * (-475.256) [-473.843] (-480.433) (-474.784) -- 0:01:02
      74500 -- (-474.531) [-474.465] (-480.591) (-474.158) * [-474.067] (-475.039) (-475.733) (-477.529) -- 0:01:02
      75000 -- [-474.394] (-476.461) (-473.301) (-475.284) * [-476.606] (-475.992) (-476.057) (-480.742) -- 0:01:01

      Average standard deviation of split frequencies: 0.028075

      75500 -- (-475.402) (-473.599) [-474.453] (-474.712) * (-475.256) [-473.582] (-477.418) (-474.934) -- 0:01:13
      76000 -- (-476.452) [-473.961] (-475.660) (-474.340) * (-475.524) (-474.708) [-478.895] (-478.686) -- 0:01:12
      76500 -- (-475.036) [-476.105] (-475.665) (-474.354) * [-476.852] (-475.572) (-476.895) (-477.076) -- 0:01:12
      77000 -- (-473.811) [-474.495] (-474.534) (-474.666) * (-478.139) [-476.530] (-473.812) (-477.394) -- 0:01:11
      77500 -- [-476.394] (-476.007) (-477.502) (-476.547) * (-475.709) (-475.348) [-473.740] (-475.980) -- 0:01:11
      78000 -- (-477.073) (-476.025) [-475.645] (-474.265) * (-474.381) (-476.736) [-473.417] (-477.049) -- 0:01:10
      78500 -- (-474.193) (-473.514) [-475.484] (-475.464) * (-473.956) (-474.876) [-475.999] (-473.391) -- 0:01:10
      79000 -- [-474.515] (-475.287) (-474.853) (-474.558) * (-474.404) (-474.761) (-475.133) [-474.697] -- 0:01:09
      79500 -- [-473.920] (-476.740) (-475.633) (-474.868) * [-477.064] (-474.627) (-478.099) (-473.578) -- 0:01:09
      80000 -- (-477.626) (-476.233) [-475.896] (-474.991) * [-474.442] (-478.067) (-477.483) (-474.795) -- 0:01:09

      Average standard deviation of split frequencies: 0.026590

      80500 -- (-475.056) (-475.120) [-480.150] (-477.413) * [-476.059] (-474.863) (-475.238) (-475.783) -- 0:01:08
      81000 -- (-474.021) (-476.639) (-475.455) [-476.802] * (-474.019) (-474.055) [-474.864] (-473.793) -- 0:01:08
      81500 -- (-478.209) [-474.351] (-475.328) (-477.289) * [-474.006] (-473.711) (-473.493) (-473.750) -- 0:01:07
      82000 -- [-476.214] (-476.017) (-477.780) (-476.081) * (-475.187) (-474.411) [-473.794] (-473.354) -- 0:01:07
      82500 -- (-473.686) (-482.901) [-481.978] (-475.604) * (-473.265) (-474.876) (-473.338) [-474.203] -- 0:01:06
      83000 -- [-475.594] (-475.309) (-473.625) (-476.802) * (-475.120) (-475.237) [-474.152] (-474.637) -- 0:01:06
      83500 -- [-476.949] (-474.223) (-474.134) (-475.444) * [-475.205] (-476.434) (-476.616) (-474.374) -- 0:01:05
      84000 -- (-474.668) (-473.029) (-476.348) [-474.637] * (-474.928) (-477.961) [-476.410] (-476.349) -- 0:01:05
      84500 -- [-477.331] (-473.576) (-476.049) (-475.696) * (-479.593) (-477.626) [-479.358] (-476.525) -- 0:01:05
      85000 -- (-480.585) (-475.755) (-474.730) [-473.798] * [-478.799] (-475.339) (-474.050) (-476.782) -- 0:01:04

      Average standard deviation of split frequencies: 0.026885

      85500 -- (-476.522) (-475.359) [-475.848] (-473.391) * (-479.296) [-477.561] (-473.415) (-473.837) -- 0:01:04
      86000 -- [-476.255] (-478.738) (-473.753) (-474.560) * (-474.418) (-475.292) (-476.994) [-475.435] -- 0:01:03
      86500 -- (-476.073) [-474.835] (-473.629) (-475.129) * (-476.804) (-476.171) (-478.892) [-478.664] -- 0:01:03
      87000 -- (-474.720) [-474.469] (-473.824) (-476.273) * (-473.763) (-476.555) (-474.634) [-477.375] -- 0:01:02
      87500 -- (-475.420) (-473.559) [-474.538] (-475.784) * (-473.608) [-474.010] (-473.313) (-474.762) -- 0:01:02
      88000 -- [-473.504] (-473.119) (-475.073) (-474.684) * [-476.140] (-473.430) (-474.123) (-477.628) -- 0:01:02
      88500 -- (-477.237) (-473.788) (-474.059) [-473.600] * (-474.704) (-477.015) (-475.642) [-474.898] -- 0:01:01
      89000 -- (-479.609) [-473.061] (-473.824) (-474.713) * (-476.308) (-475.977) (-473.786) [-475.499] -- 0:01:01
      89500 -- (-475.048) (-473.109) [-474.827] (-475.508) * (-474.014) (-473.852) (-475.193) [-477.041] -- 0:01:01
      90000 -- (-475.663) [-474.498] (-474.110) (-477.918) * (-475.833) (-475.361) (-476.493) [-475.263] -- 0:01:00

      Average standard deviation of split frequencies: 0.025477

      90500 -- [-474.248] (-473.583) (-474.049) (-473.289) * (-474.908) (-473.659) (-475.554) [-473.704] -- 0:01:10
      91000 -- (-478.079) (-478.915) [-474.042] (-475.436) * (-475.873) (-475.856) (-474.548) [-477.061] -- 0:01:09
      91500 -- (-477.833) (-474.861) (-475.758) [-473.638] * (-473.903) (-474.827) (-475.829) [-477.414] -- 0:01:09
      92000 -- [-479.992] (-476.924) (-477.280) (-478.612) * [-477.005] (-475.642) (-481.511) (-475.329) -- 0:01:09
      92500 -- [-477.136] (-474.747) (-474.325) (-475.601) * (-476.153) (-474.358) [-474.482] (-474.282) -- 0:01:08
      93000 -- [-476.588] (-473.231) (-474.448) (-476.012) * [-476.200] (-476.674) (-476.043) (-474.841) -- 0:01:08
      93500 -- (-473.704) (-473.691) [-476.651] (-473.894) * [-473.439] (-475.487) (-475.223) (-475.675) -- 0:01:07
      94000 -- (-473.621) (-473.364) [-478.148] (-476.554) * (-474.420) [-474.438] (-473.778) (-477.213) -- 0:01:07
      94500 -- (-476.563) [-474.578] (-474.985) (-475.057) * [-475.145] (-474.323) (-474.433) (-476.262) -- 0:01:07
      95000 -- (-475.383) [-475.283] (-477.704) (-476.684) * [-476.817] (-475.870) (-474.135) (-479.343) -- 0:01:06

      Average standard deviation of split frequencies: 0.025043

      95500 -- [-473.845] (-473.209) (-474.812) (-473.669) * (-478.910) (-474.135) (-475.724) [-474.235] -- 0:01:06
      96000 -- (-478.261) (-475.720) (-473.607) [-475.331] * [-479.346] (-476.114) (-474.309) (-474.270) -- 0:01:05
      96500 -- (-476.514) [-473.111] (-475.023) (-479.391) * (-474.222) (-475.805) (-474.155) [-473.892] -- 0:01:05
      97000 -- (-473.751) [-476.515] (-478.070) (-476.110) * [-473.541] (-479.151) (-474.748) (-475.989) -- 0:01:05
      97500 -- (-474.868) (-477.066) [-474.580] (-476.687) * (-474.704) [-473.969] (-474.604) (-482.077) -- 0:01:04
      98000 -- (-474.125) (-476.652) [-473.085] (-473.222) * [-475.702] (-474.250) (-473.690) (-479.133) -- 0:01:04
      98500 -- (-473.561) (-476.401) [-473.910] (-475.590) * (-478.273) (-477.574) [-474.071] (-474.347) -- 0:01:04
      99000 -- (-475.223) [-476.942] (-477.257) (-478.576) * (-475.217) [-475.085] (-474.928) (-474.194) -- 0:01:03
      99500 -- (-474.965) [-474.676] (-474.627) (-476.055) * (-475.257) (-473.122) [-473.387] (-476.375) -- 0:01:03
      100000 -- [-474.543] (-473.691) (-474.845) (-473.850) * (-475.204) (-473.459) [-473.491] (-474.177) -- 0:01:02

      Average standard deviation of split frequencies: 0.025421

      100500 -- (-476.773) (-474.902) (-477.834) [-474.520] * [-474.460] (-475.513) (-475.074) (-473.778) -- 0:01:02
      101000 -- (-478.006) (-475.076) (-476.751) [-473.860] * (-473.702) (-474.698) (-473.791) [-475.175] -- 0:01:02
      101500 -- (-478.204) (-486.264) (-475.917) [-473.403] * (-474.961) [-472.935] (-476.662) (-476.475) -- 0:01:01
      102000 -- (-476.279) (-479.971) [-475.402] (-475.619) * (-477.912) [-474.068] (-479.267) (-478.064) -- 0:01:10
      102500 -- (-475.015) (-474.976) [-474.607] (-474.617) * (-475.100) (-478.852) [-478.374] (-473.191) -- 0:01:10
      103000 -- (-474.465) (-474.343) [-473.753] (-476.289) * (-476.676) (-479.768) [-475.968] (-473.939) -- 0:01:09
      103500 -- (-473.823) [-475.811] (-477.603) (-475.692) * [-474.836] (-476.963) (-474.942) (-475.791) -- 0:01:09
      104000 -- (-474.811) (-474.877) [-475.648] (-474.957) * (-476.321) (-477.091) (-476.158) [-477.336] -- 0:01:08
      104500 -- (-484.995) [-474.498] (-474.703) (-476.984) * (-474.784) (-474.075) [-475.651] (-476.991) -- 0:01:08
      105000 -- (-481.863) (-485.095) [-476.898] (-475.633) * (-474.931) (-474.077) [-474.029] (-476.821) -- 0:01:08

      Average standard deviation of split frequencies: 0.025413

      105500 -- [-475.017] (-473.852) (-475.579) (-476.404) * (-475.311) (-475.002) [-473.530] (-477.550) -- 0:01:07
      106000 -- (-476.298) (-476.959) (-475.295) [-477.829] * [-475.479] (-474.557) (-475.147) (-474.544) -- 0:01:07
      106500 -- (-478.643) (-476.809) [-473.371] (-479.902) * [-473.815] (-474.023) (-474.252) (-474.875) -- 0:01:07
      107000 -- (-474.551) [-477.402] (-478.326) (-478.540) * [-477.081] (-473.806) (-473.625) (-475.526) -- 0:01:06
      107500 -- (-473.940) [-477.163] (-476.825) (-473.473) * (-475.236) (-474.616) [-476.028] (-479.392) -- 0:01:06
      108000 -- (-473.981) (-475.907) (-475.090) [-473.370] * [-473.605] (-475.561) (-480.414) (-475.579) -- 0:01:06
      108500 -- [-476.604] (-475.350) (-475.324) (-479.037) * [-474.003] (-477.531) (-476.774) (-476.819) -- 0:01:05
      109000 -- (-477.907) (-476.547) (-475.225) [-476.923] * (-473.606) (-473.437) (-478.796) [-476.371] -- 0:01:05
      109500 -- (-474.493) (-479.837) (-474.668) [-474.667] * (-475.898) (-474.152) [-477.068] (-476.653) -- 0:01:05
      110000 -- [-475.171] (-474.848) (-476.479) (-475.185) * (-474.932) [-477.364] (-475.470) (-475.631) -- 0:01:04

      Average standard deviation of split frequencies: 0.024138

      110500 -- [-475.701] (-474.801) (-475.003) (-474.723) * [-473.062] (-475.568) (-475.866) (-473.424) -- 0:01:04
      111000 -- (-475.294) [-476.312] (-476.203) (-475.009) * [-476.371] (-476.910) (-477.860) (-475.420) -- 0:01:04
      111500 -- (-475.264) [-475.912] (-474.163) (-474.711) * (-474.259) (-476.067) [-475.966] (-481.068) -- 0:01:03
      112000 -- (-475.481) (-473.888) (-476.018) [-476.488] * [-473.154] (-479.496) (-473.956) (-480.301) -- 0:01:03
      112500 -- (-477.172) [-474.375] (-475.489) (-481.897) * (-477.811) (-480.174) [-474.488] (-479.372) -- 0:01:03
      113000 -- (-475.222) [-476.546] (-474.530) (-474.360) * [-473.441] (-474.617) (-474.500) (-476.609) -- 0:01:02
      113500 -- (-475.698) (-477.692) (-474.643) [-476.467] * (-479.371) (-476.681) [-478.247] (-474.938) -- 0:01:02
      114000 -- (-476.317) [-476.221] (-477.533) (-473.855) * (-477.931) (-476.023) [-474.013] (-477.147) -- 0:01:02
      114500 -- (-474.095) (-475.307) (-477.593) [-475.005] * (-473.451) (-475.446) (-477.981) [-475.473] -- 0:01:01
      115000 -- (-475.151) [-474.022] (-473.122) (-474.027) * (-474.892) (-475.580) [-475.446] (-476.106) -- 0:01:01

      Average standard deviation of split frequencies: 0.023367

      115500 -- (-478.338) (-475.074) [-473.648] (-475.371) * [-474.427] (-474.141) (-475.013) (-474.009) -- 0:01:01
      116000 -- [-480.123] (-474.787) (-474.321) (-474.392) * (-473.945) (-478.699) (-479.174) [-473.788] -- 0:01:08
      116500 -- (-478.862) (-475.307) [-476.466] (-474.845) * (-475.402) [-475.987] (-477.539) (-476.190) -- 0:01:08
      117000 -- [-473.813] (-477.937) (-478.049) (-474.095) * (-474.024) (-481.274) [-475.511] (-479.082) -- 0:01:07
      117500 -- (-476.458) (-474.473) (-475.921) [-477.952] * [-474.196] (-475.580) (-475.143) (-477.816) -- 0:01:07
      118000 -- (-475.121) (-476.383) [-476.348] (-474.452) * [-474.082] (-474.344) (-474.370) (-476.561) -- 0:01:07
      118500 -- (-478.978) (-474.455) (-476.997) [-473.789] * [-476.140] (-474.061) (-474.347) (-476.111) -- 0:01:06
      119000 -- [-474.292] (-474.914) (-478.999) (-474.291) * (-476.219) (-474.156) (-479.577) [-476.109] -- 0:01:06
      119500 -- (-475.481) (-473.534) (-475.350) [-473.548] * [-477.151] (-475.113) (-477.500) (-473.767) -- 0:01:06
      120000 -- (-475.416) (-474.608) [-477.694] (-473.618) * (-475.365) [-474.709] (-478.114) (-474.687) -- 0:01:06

      Average standard deviation of split frequencies: 0.020836

      120500 -- (-474.207) (-475.522) [-478.073] (-477.205) * (-475.168) (-477.224) (-479.124) [-474.154] -- 0:01:05
      121000 -- (-474.990) [-477.808] (-477.879) (-475.818) * [-475.152] (-473.298) (-474.670) (-474.565) -- 0:01:05
      121500 -- (-476.218) (-478.796) (-474.460) [-473.850] * (-475.983) (-474.055) (-476.093) [-474.916] -- 0:01:05
      122000 -- (-474.725) (-475.024) [-474.206] (-477.684) * (-476.319) [-474.352] (-476.236) (-475.266) -- 0:01:04
      122500 -- (-476.910) (-475.416) (-473.137) [-476.373] * [-477.180] (-477.002) (-475.244) (-474.212) -- 0:01:04
      123000 -- (-480.369) (-476.453) [-473.302] (-476.361) * (-481.585) (-474.187) [-474.720] (-477.409) -- 0:01:04
      123500 -- (-477.905) [-474.318] (-476.220) (-478.594) * [-477.082] (-473.327) (-475.433) (-474.349) -- 0:01:03
      124000 -- (-479.605) [-474.317] (-475.847) (-478.175) * [-477.172] (-474.338) (-477.304) (-474.152) -- 0:01:03
      124500 -- (-475.777) [-475.111] (-475.707) (-477.070) * (-480.774) (-477.350) [-474.138] (-474.418) -- 0:01:03
      125000 -- (-474.581) [-477.861] (-474.593) (-476.002) * (-478.396) (-474.317) (-474.531) [-475.233] -- 0:01:03

      Average standard deviation of split frequencies: 0.017919

      125500 -- [-474.684] (-480.675) (-473.996) (-476.617) * (-475.581) (-474.460) (-474.735) [-478.316] -- 0:01:02
      126000 -- [-474.521] (-475.218) (-477.430) (-477.325) * (-473.608) [-477.042] (-476.307) (-476.068) -- 0:01:02
      126500 -- (-478.540) [-475.720] (-474.139) (-477.583) * (-475.026) [-475.873] (-475.667) (-474.725) -- 0:01:02
      127000 -- (-475.543) (-475.594) [-475.675] (-475.723) * (-473.452) [-473.515] (-482.286) (-474.630) -- 0:01:01
      127500 -- (-476.869) [-478.156] (-474.481) (-475.150) * [-474.121] (-477.364) (-474.629) (-478.049) -- 0:01:01
      128000 -- (-478.978) (-476.215) [-474.336] (-480.983) * [-476.048] (-474.578) (-474.831) (-474.812) -- 0:01:01
      128500 -- (-474.352) (-475.561) (-475.066) [-479.460] * [-477.909] (-474.360) (-478.503) (-474.609) -- 0:01:01
      129000 -- [-479.216] (-475.141) (-480.659) (-476.061) * (-476.138) [-475.655] (-474.339) (-473.907) -- 0:01:00
      129500 -- (-478.572) [-473.513] (-479.674) (-475.399) * (-473.224) (-475.800) (-476.263) [-476.203] -- 0:01:00
      130000 -- (-478.636) (-477.748) (-473.951) [-474.834] * [-474.905] (-475.901) (-473.353) (-478.036) -- 0:01:00

      Average standard deviation of split frequencies: 0.018228

      130500 -- (-476.519) (-473.889) [-474.287] (-478.359) * (-474.559) (-473.852) [-473.752] (-474.730) -- 0:00:59
      131000 -- (-475.545) (-482.008) (-477.016) [-477.831] * [-476.309] (-474.339) (-475.041) (-475.793) -- 0:00:59
      131500 -- (-479.887) (-474.615) [-474.586] (-475.481) * (-473.861) (-475.765) [-474.894] (-475.588) -- 0:01:06
      132000 -- (-475.317) [-476.603] (-473.659) (-474.002) * [-474.441] (-477.247) (-475.004) (-476.101) -- 0:01:05
      132500 -- (-475.433) (-478.801) (-473.595) [-474.151] * [-473.873] (-474.947) (-474.971) (-474.096) -- 0:01:05
      133000 -- (-478.276) (-474.201) (-474.261) [-474.521] * (-476.427) [-479.290] (-474.644) (-475.806) -- 0:01:05
      133500 -- (-475.084) (-476.281) [-473.903] (-474.308) * (-473.760) (-474.514) (-480.406) [-474.938] -- 0:01:04
      134000 -- [-475.984] (-474.707) (-473.948) (-477.846) * (-474.948) (-474.619) [-476.641] (-476.246) -- 0:01:04
      134500 -- [-474.675] (-477.788) (-477.023) (-479.335) * (-475.541) (-476.589) [-475.915] (-474.984) -- 0:01:04
      135000 -- (-474.450) (-478.854) [-473.808] (-476.862) * (-473.488) (-474.423) (-475.738) [-473.883] -- 0:01:04

      Average standard deviation of split frequencies: 0.019338

      135500 -- (-477.682) (-474.995) (-473.866) [-474.508] * (-474.391) (-476.217) [-474.499] (-478.557) -- 0:01:03
      136000 -- (-476.199) (-474.485) [-473.751] (-475.289) * [-474.881] (-476.822) (-479.378) (-476.862) -- 0:01:03
      136500 -- (-475.850) (-473.464) (-474.094) [-474.912] * (-473.453) [-475.834] (-474.401) (-479.490) -- 0:01:03
      137000 -- (-478.773) (-474.398) (-474.554) [-474.601] * (-473.518) [-475.902] (-474.468) (-479.001) -- 0:01:02
      137500 -- (-479.414) (-475.694) (-474.108) [-475.209] * [-475.864] (-478.225) (-474.984) (-473.116) -- 0:01:02
      138000 -- (-479.771) (-475.529) [-477.090] (-473.929) * (-476.146) [-475.206] (-474.963) (-476.172) -- 0:01:02
      138500 -- (-480.217) (-475.099) [-474.387] (-473.436) * (-475.508) (-477.403) (-476.956) [-475.386] -- 0:01:02
      139000 -- (-476.745) (-475.032) (-474.474) [-473.479] * [-474.660] (-475.800) (-476.110) (-476.908) -- 0:01:01
      139500 -- (-474.741) [-474.023] (-476.091) (-474.498) * (-475.156) (-478.504) (-475.493) [-474.779] -- 0:01:01
      140000 -- (-476.195) (-475.157) [-474.486] (-474.852) * (-475.062) (-476.091) [-474.494] (-477.544) -- 0:01:01

      Average standard deviation of split frequencies: 0.020293

      140500 -- [-476.068] (-473.708) (-475.044) (-473.789) * (-477.984) (-476.551) (-479.018) [-474.039] -- 0:01:01
      141000 -- [-475.683] (-475.214) (-480.363) (-474.937) * (-476.949) (-475.095) [-475.349] (-476.637) -- 0:01:00
      141500 -- (-475.320) (-474.021) [-473.657] (-477.255) * [-475.214] (-476.368) (-473.950) (-476.527) -- 0:01:00
      142000 -- (-477.076) (-475.775) (-473.749) [-475.826] * (-479.940) (-475.188) (-474.318) [-477.573] -- 0:01:00
      142500 -- (-478.846) (-476.732) (-477.130) [-475.228] * (-479.781) (-484.460) (-482.011) [-475.746] -- 0:01:00
      143000 -- (-479.636) (-477.533) [-474.496] (-477.583) * [-476.340] (-476.143) (-481.938) (-478.991) -- 0:00:59
      143500 -- [-481.106] (-476.633) (-474.726) (-476.317) * (-473.950) (-474.047) [-475.557] (-485.292) -- 0:00:59
      144000 -- (-478.399) (-474.827) (-478.449) [-473.299] * [-475.227] (-475.221) (-474.570) (-474.763) -- 0:00:59
      144500 -- (-477.596) [-474.633] (-476.821) (-474.418) * (-475.822) [-475.408] (-475.733) (-477.485) -- 0:00:59
      145000 -- (-478.421) (-476.796) (-475.486) [-474.963] * (-480.457) [-476.122] (-474.109) (-480.210) -- 0:00:58

      Average standard deviation of split frequencies: 0.019033

      145500 -- (-480.078) (-478.317) [-474.441] (-474.857) * (-476.537) [-473.273] (-474.415) (-478.349) -- 0:00:58
      146000 -- (-476.144) (-482.071) [-474.012] (-478.136) * (-475.667) (-473.452) [-474.424] (-475.264) -- 0:00:58
      146500 -- [-475.816] (-474.905) (-473.743) (-478.513) * [-474.775] (-474.744) (-474.295) (-476.348) -- 0:00:58
      147000 -- (-477.578) (-476.744) [-474.079] (-473.353) * (-476.041) (-476.940) (-476.390) [-476.100] -- 0:00:58
      147500 -- (-476.899) (-478.232) [-475.520] (-474.233) * [-474.440] (-476.884) (-474.521) (-476.311) -- 0:01:03
      148000 -- (-476.409) [-475.362] (-474.770) (-475.500) * (-473.888) (-477.263) (-474.016) [-474.906] -- 0:01:03
      148500 -- (-475.304) (-477.706) [-473.352] (-473.448) * [-477.815] (-476.675) (-476.042) (-475.065) -- 0:01:03
      149000 -- (-479.805) (-473.609) (-474.459) [-474.089] * (-475.728) [-477.182] (-480.563) (-474.755) -- 0:01:02
      149500 -- [-482.698] (-473.733) (-473.721) (-475.219) * (-475.307) [-475.413] (-476.928) (-475.158) -- 0:01:02
      150000 -- (-474.707) (-475.070) (-473.518) [-474.101] * [-477.777] (-474.672) (-476.086) (-478.677) -- 0:01:02

      Average standard deviation of split frequencies: 0.018114

      150500 -- (-473.703) (-474.469) [-477.907] (-474.008) * [-475.384] (-474.564) (-474.779) (-477.259) -- 0:01:02
      151000 -- [-474.878] (-474.785) (-478.342) (-474.232) * (-478.793) (-477.673) (-474.847) [-477.043] -- 0:01:01
      151500 -- (-474.025) [-473.560] (-474.823) (-474.437) * (-474.980) (-473.367) (-474.261) [-475.228] -- 0:01:01
      152000 -- (-475.537) [-474.852] (-476.909) (-473.985) * (-476.289) (-475.978) [-474.211] (-473.403) -- 0:01:01
      152500 -- (-475.319) (-474.657) (-478.780) [-475.110] * (-477.014) (-477.454) [-473.760] (-476.368) -- 0:01:01
      153000 -- (-474.235) (-473.818) [-479.353] (-475.672) * (-477.470) (-477.519) (-473.535) [-475.218] -- 0:01:00
      153500 -- (-474.271) (-475.107) (-474.525) [-473.335] * [-478.149] (-475.725) (-476.141) (-473.327) -- 0:01:00
      154000 -- (-474.325) [-473.773] (-475.819) (-474.161) * (-473.979) [-473.627] (-474.646) (-475.464) -- 0:01:00
      154500 -- (-474.832) (-476.787) [-473.779] (-475.980) * (-474.109) (-473.970) (-475.212) [-475.595] -- 0:01:00
      155000 -- [-473.090] (-476.407) (-473.080) (-473.935) * (-477.669) [-475.135] (-475.787) (-475.708) -- 0:00:59

      Average standard deviation of split frequencies: 0.017654

      155500 -- (-474.879) (-475.680) (-474.821) [-475.067] * (-478.506) (-473.713) (-473.613) [-476.063] -- 0:00:59
      156000 -- (-476.023) (-473.727) (-474.346) [-476.283] * (-481.221) (-474.848) [-473.658] (-481.894) -- 0:00:59
      156500 -- [-474.482] (-474.158) (-476.208) (-474.918) * (-480.656) [-473.256] (-476.157) (-473.374) -- 0:00:59
      157000 -- (-474.174) [-473.119] (-473.253) (-474.411) * (-482.648) (-475.306) (-476.385) [-475.088] -- 0:00:59
      157500 -- (-474.885) (-474.707) [-473.538] (-473.455) * (-474.933) [-473.629] (-476.260) (-476.147) -- 0:00:58
      158000 -- [-474.449] (-475.265) (-474.545) (-478.096) * (-474.106) (-475.652) [-477.840] (-475.194) -- 0:00:58
      158500 -- (-474.256) [-473.562] (-474.663) (-476.484) * (-478.161) (-476.481) [-475.143] (-476.090) -- 0:00:58
      159000 -- [-473.140] (-476.300) (-474.210) (-474.222) * (-478.930) [-473.607] (-473.386) (-476.351) -- 0:00:58
      159500 -- (-473.155) (-474.021) [-477.463] (-477.904) * [-476.118] (-474.053) (-473.305) (-475.855) -- 0:00:57
      160000 -- (-474.291) [-473.333] (-474.917) (-478.765) * (-474.910) [-474.591] (-474.777) (-474.398) -- 0:00:57

      Average standard deviation of split frequencies: 0.018631

      160500 -- (-479.166) (-479.240) [-473.379] (-475.410) * (-475.582) (-475.959) [-473.685] (-473.900) -- 0:00:57
      161000 -- [-474.500] (-479.699) (-478.536) (-474.960) * [-475.947] (-478.229) (-474.216) (-474.758) -- 0:00:57
      161500 -- (-474.672) (-479.638) (-474.807) [-474.531] * (-476.423) [-481.676] (-474.522) (-473.333) -- 0:00:57
      162000 -- (-473.798) (-476.262) (-477.929) [-478.091] * (-476.164) [-476.136] (-475.981) (-475.482) -- 0:01:02
      162500 -- (-472.923) (-477.264) [-473.701] (-475.171) * (-478.752) (-476.116) [-473.682] (-477.606) -- 0:01:01
      163000 -- (-474.697) (-473.493) [-474.608] (-475.972) * (-477.592) (-474.800) (-472.948) [-481.378] -- 0:01:01
      163500 -- (-475.602) (-475.731) [-473.229] (-475.123) * (-477.387) (-475.346) [-473.767] (-476.177) -- 0:01:01
      164000 -- [-475.694] (-474.907) (-474.307) (-478.743) * [-475.275] (-475.867) (-478.521) (-475.685) -- 0:01:01
      164500 -- (-474.896) [-473.952] (-478.315) (-479.938) * (-475.387) [-480.902] (-477.587) (-475.806) -- 0:01:00
      165000 -- (-475.194) (-477.535) [-475.396] (-474.285) * (-475.633) [-474.338] (-478.084) (-479.238) -- 0:01:00

      Average standard deviation of split frequencies: 0.018601

      165500 -- (-477.143) (-478.683) [-474.306] (-481.790) * (-475.115) (-473.488) [-474.425] (-474.160) -- 0:01:00
      166000 -- (-476.019) (-476.454) [-473.349] (-474.166) * (-475.087) (-473.423) [-474.897] (-473.559) -- 0:01:00
      166500 -- [-477.658] (-478.730) (-477.228) (-474.127) * (-476.433) (-473.900) (-474.191) [-475.309] -- 0:01:00
      167000 -- (-474.802) (-475.032) (-476.917) [-476.053] * (-473.884) [-473.261] (-477.353) (-475.238) -- 0:00:59
      167500 -- (-473.677) [-474.056] (-475.959) (-476.586) * [-474.007] (-473.718) (-474.267) (-474.391) -- 0:00:59
      168000 -- (-477.979) (-475.136) (-475.212) [-478.920] * (-474.092) [-474.927] (-473.979) (-475.278) -- 0:00:59
      168500 -- (-475.293) (-473.825) (-475.264) [-475.383] * [-474.427] (-474.195) (-475.555) (-475.596) -- 0:00:59
      169000 -- (-475.587) [-473.516] (-478.131) (-475.286) * [-473.594] (-474.126) (-477.419) (-475.347) -- 0:00:59
      169500 -- (-476.597) [-474.797] (-483.284) (-473.402) * [-474.479] (-473.508) (-478.996) (-478.735) -- 0:00:58
      170000 -- (-476.687) (-475.944) [-477.447] (-474.109) * (-473.675) [-473.986] (-477.331) (-477.578) -- 0:00:58

      Average standard deviation of split frequencies: 0.017300

      170500 -- [-476.468] (-473.868) (-473.704) (-473.533) * (-474.680) [-473.710] (-476.704) (-479.532) -- 0:00:58
      171000 -- (-475.467) [-475.215] (-475.337) (-473.339) * (-475.463) (-474.035) [-476.198] (-475.840) -- 0:00:58
      171500 -- [-474.842] (-477.781) (-473.894) (-473.197) * (-474.550) [-473.673] (-477.275) (-473.590) -- 0:00:57
      172000 -- (-474.610) [-474.082] (-476.275) (-476.811) * (-477.937) [-473.194] (-475.912) (-476.044) -- 0:00:57
      172500 -- [-474.879] (-473.668) (-474.702) (-474.535) * (-475.247) [-473.899] (-475.264) (-474.363) -- 0:00:57
      173000 -- (-473.967) [-474.454] (-478.773) (-476.484) * (-476.165) [-474.794] (-474.588) (-475.929) -- 0:00:57
      173500 -- [-474.263] (-475.661) (-477.273) (-475.274) * (-474.209) [-474.786] (-474.855) (-477.158) -- 0:00:57
      174000 -- (-473.885) [-475.649] (-476.739) (-474.077) * (-475.942) (-478.295) [-474.038] (-476.899) -- 0:00:56
      174500 -- (-479.010) (-473.144) [-477.126] (-474.601) * (-474.359) (-475.100) (-478.064) [-473.960] -- 0:00:56
      175000 -- (-474.509) [-478.592] (-477.262) (-476.760) * (-476.518) (-474.084) [-477.995] (-474.488) -- 0:00:56

      Average standard deviation of split frequencies: 0.019595

      175500 -- [-475.145] (-475.768) (-475.640) (-479.956) * (-474.000) [-473.197] (-474.196) (-475.663) -- 0:00:56
      176000 -- (-478.190) (-478.162) [-475.341] (-477.920) * (-476.422) (-473.178) [-475.911] (-474.437) -- 0:01:00
      176500 -- [-474.210] (-475.269) (-476.937) (-478.260) * (-476.339) (-475.363) [-473.593] (-474.368) -- 0:01:00
      177000 -- (-474.838) [-476.658] (-477.818) (-476.232) * [-474.735] (-476.622) (-473.765) (-474.178) -- 0:01:00
      177500 -- [-475.311] (-475.585) (-477.674) (-475.379) * (-476.179) (-478.125) (-473.822) [-474.329] -- 0:01:00
      178000 -- (-474.322) [-479.323] (-480.184) (-474.075) * (-474.324) (-475.512) (-474.303) [-474.479] -- 0:01:00
      178500 -- (-473.628) [-475.426] (-474.835) (-474.561) * (-474.664) (-478.937) [-476.715] (-475.177) -- 0:00:59
      179000 -- (-474.944) [-473.660] (-475.731) (-473.973) * (-481.053) (-475.302) (-477.845) [-475.202] -- 0:00:59
      179500 -- (-478.111) [-474.860] (-476.570) (-475.302) * [-476.447] (-475.862) (-475.448) (-477.970) -- 0:00:59
      180000 -- (-476.017) (-477.904) (-476.756) [-475.093] * (-476.161) [-474.722] (-474.810) (-473.121) -- 0:00:59

      Average standard deviation of split frequencies: 0.018120

      180500 -- (-474.338) (-480.272) (-475.917) [-473.430] * (-474.764) (-474.312) (-473.471) [-473.923] -- 0:00:59
      181000 -- (-477.924) (-476.441) (-473.789) [-477.585] * (-475.985) (-477.125) [-474.977] (-473.516) -- 0:00:58
      181500 -- (-478.201) (-478.167) [-476.380] (-477.346) * (-474.201) (-473.789) [-475.448] (-474.345) -- 0:00:58
      182000 -- (-475.651) (-474.431) (-476.990) [-478.637] * (-473.263) (-476.017) [-475.390] (-476.969) -- 0:00:58
      182500 -- [-473.966] (-475.141) (-479.954) (-479.450) * (-478.715) (-474.032) (-474.248) [-475.422] -- 0:00:58
      183000 -- (-474.754) (-474.712) [-478.999] (-479.430) * (-476.554) (-475.210) [-473.602] (-476.149) -- 0:00:58
      183500 -- (-474.466) [-475.170] (-477.154) (-475.887) * (-474.321) [-473.854] (-474.470) (-474.454) -- 0:00:57
      184000 -- [-476.264] (-476.150) (-474.951) (-474.312) * (-476.228) (-478.184) (-477.759) [-474.710] -- 0:00:57
      184500 -- (-478.305) (-475.267) [-473.958] (-474.234) * (-473.656) (-479.490) (-473.659) [-474.117] -- 0:00:57
      185000 -- (-473.609) (-482.320) [-473.753] (-476.683) * [-473.827] (-474.209) (-473.520) (-474.011) -- 0:00:57

      Average standard deviation of split frequencies: 0.015740

      185500 -- (-473.547) (-479.558) [-478.621] (-478.338) * [-474.740] (-473.187) (-479.343) (-477.971) -- 0:00:57
      186000 -- [-474.575] (-475.376) (-474.548) (-474.435) * (-473.227) (-475.840) (-477.895) [-474.537] -- 0:00:56
      186500 -- (-474.271) (-474.215) [-473.932] (-476.197) * [-473.937] (-479.299) (-474.911) (-475.716) -- 0:00:56
      187000 -- (-475.621) (-476.414) [-477.639] (-475.459) * (-479.310) (-475.641) [-477.470] (-475.111) -- 0:00:56
      187500 -- (-474.809) (-474.724) (-477.547) [-475.096] * (-474.136) (-477.450) [-474.172] (-475.058) -- 0:00:56
      188000 -- (-473.941) (-478.887) (-474.432) [-474.105] * [-473.975] (-477.915) (-474.074) (-474.827) -- 0:00:56
      188500 -- (-474.962) (-475.932) [-473.594] (-474.499) * (-476.585) (-486.340) (-475.377) [-475.999] -- 0:00:55
      189000 -- (-476.422) (-478.526) (-475.835) [-478.526] * (-477.039) (-478.103) [-473.990] (-474.716) -- 0:00:55
      189500 -- (-474.811) [-475.094] (-474.909) (-477.339) * [-474.723] (-478.297) (-474.135) (-481.339) -- 0:00:55
      190000 -- (-476.345) [-473.261] (-473.972) (-475.994) * [-474.302] (-474.337) (-474.387) (-474.152) -- 0:00:55

      Average standard deviation of split frequencies: 0.014148

      190500 -- (-474.909) (-473.870) (-475.076) [-475.262] * [-474.093] (-479.855) (-476.385) (-474.053) -- 0:00:55
      191000 -- (-474.582) (-476.289) (-475.883) [-475.605] * (-478.095) (-475.179) [-476.834] (-475.799) -- 0:00:59
      191500 -- (-475.336) [-474.853] (-473.523) (-477.277) * (-475.622) (-475.102) (-476.286) [-478.479] -- 0:00:59
      192000 -- (-476.134) [-474.209] (-473.263) (-478.030) * (-473.184) [-474.357] (-477.675) (-476.319) -- 0:00:58
      192500 -- (-475.095) (-474.893) [-474.170] (-478.333) * (-474.250) [-474.929] (-473.895) (-476.298) -- 0:00:58
      193000 -- (-475.466) (-476.581) [-473.648] (-475.191) * (-474.702) (-477.880) (-473.148) [-477.290] -- 0:00:58
      193500 -- (-475.488) (-474.576) [-474.910] (-476.820) * (-473.798) (-476.328) [-473.818] (-478.767) -- 0:00:58
      194000 -- (-476.180) (-475.745) (-474.027) [-473.518] * (-476.144) (-476.199) [-474.477] (-477.018) -- 0:00:58
      194500 -- [-474.774] (-473.625) (-477.482) (-474.370) * [-475.367] (-475.326) (-476.973) (-476.259) -- 0:00:57
      195000 -- (-475.606) (-475.104) [-480.121] (-474.024) * [-475.888] (-475.764) (-474.275) (-474.925) -- 0:00:57

      Average standard deviation of split frequencies: 0.016270

      195500 -- (-474.524) (-475.303) [-475.033] (-478.677) * (-474.853) (-477.643) [-476.775] (-475.640) -- 0:00:57
      196000 -- (-474.327) (-475.724) [-475.428] (-474.723) * (-475.843) (-477.517) (-476.823) [-474.286] -- 0:00:57
      196500 -- [-473.256] (-475.312) (-477.119) (-476.149) * (-479.027) (-475.824) [-472.974] (-474.889) -- 0:00:57
      197000 -- (-475.799) [-475.633] (-476.423) (-477.480) * (-475.857) (-475.818) [-474.394] (-474.949) -- 0:00:57
      197500 -- [-474.354] (-474.612) (-474.892) (-475.494) * (-487.930) (-476.046) (-476.838) [-475.034] -- 0:00:56
      198000 -- (-473.681) (-474.385) [-473.773] (-475.611) * (-477.493) [-475.584] (-475.088) (-474.637) -- 0:00:56
      198500 -- (-476.646) (-474.823) (-474.729) [-476.998] * (-475.874) (-474.980) [-476.738] (-473.385) -- 0:00:56
      199000 -- (-475.652) (-474.142) [-475.614] (-475.420) * (-478.230) (-478.993) (-475.357) [-475.193] -- 0:00:56
      199500 -- (-477.636) (-474.885) (-473.034) [-473.912] * (-481.220) (-475.956) (-476.293) [-475.722] -- 0:00:56
      200000 -- (-477.715) (-473.764) (-473.879) [-476.660] * [-473.344] (-475.224) (-473.676) (-474.947) -- 0:00:55

      Average standard deviation of split frequencies: 0.016721

      200500 -- (-475.183) (-473.974) [-475.185] (-474.961) * (-475.013) (-475.147) [-474.261] (-474.871) -- 0:00:55
      201000 -- (-479.102) (-474.480) (-476.770) [-477.265] * [-473.651] (-474.897) (-473.879) (-474.129) -- 0:00:55
      201500 -- (-481.266) [-476.286] (-475.640) (-475.859) * (-476.618) [-474.767] (-474.084) (-474.968) -- 0:00:55
      202000 -- (-475.583) (-477.537) [-475.222] (-474.177) * [-476.027] (-476.721) (-476.018) (-474.322) -- 0:00:55
      202500 -- (-478.456) (-474.151) [-476.316] (-475.585) * (-474.304) [-474.280] (-476.169) (-475.419) -- 0:00:55
      203000 -- (-479.819) (-474.929) [-475.046] (-474.356) * (-478.101) (-474.237) (-477.730) [-474.607] -- 0:00:54
      203500 -- (-477.052) [-475.362] (-476.391) (-473.654) * (-474.403) (-474.452) [-474.329] (-474.773) -- 0:00:54
      204000 -- (-478.808) [-476.109] (-476.416) (-473.325) * (-477.119) (-474.794) [-474.328] (-473.325) -- 0:00:54
      204500 -- (-475.030) [-475.269] (-474.860) (-479.473) * (-478.552) (-473.723) [-476.309] (-476.454) -- 0:00:54
      205000 -- (-474.103) [-475.555] (-476.623) (-479.161) * (-476.001) [-475.274] (-475.680) (-478.895) -- 0:00:54

      Average standard deviation of split frequencies: 0.016288

      205500 -- (-481.409) (-474.316) (-476.529) [-476.020] * (-473.983) [-473.761] (-477.344) (-476.766) -- 0:00:54
      206000 -- (-476.003) (-474.257) [-474.798] (-475.782) * (-473.864) (-476.001) (-477.828) [-477.298] -- 0:00:53
      206500 -- (-476.553) (-474.712) [-480.275] (-473.558) * (-474.700) [-478.255] (-476.179) (-474.838) -- 0:00:57
      207000 -- (-473.989) (-480.951) [-474.867] (-476.233) * (-475.228) (-475.184) (-478.030) [-476.525] -- 0:00:57
      207500 -- [-473.595] (-483.698) (-473.908) (-474.644) * (-474.769) [-473.993] (-475.318) (-476.725) -- 0:00:57
      208000 -- [-473.268] (-477.869) (-480.697) (-474.812) * [-474.939] (-478.880) (-474.692) (-474.743) -- 0:00:57
      208500 -- [-477.008] (-475.238) (-474.264) (-474.319) * (-474.516) (-473.935) [-477.559] (-474.849) -- 0:00:56
      209000 -- [-474.675] (-475.049) (-473.822) (-473.810) * [-474.733] (-473.466) (-476.947) (-475.793) -- 0:00:56
      209500 -- (-475.618) (-474.841) (-481.958) [-474.447] * (-474.209) (-473.176) [-478.426] (-473.433) -- 0:00:56
      210000 -- (-476.132) [-475.312] (-475.513) (-476.469) * [-476.284] (-476.334) (-474.592) (-476.775) -- 0:00:56

      Average standard deviation of split frequencies: 0.015927

      210500 -- (-474.196) (-477.537) [-475.079] (-477.116) * (-474.830) (-475.029) [-474.631] (-474.533) -- 0:00:56
      211000 -- (-477.938) (-476.569) [-475.453] (-475.022) * (-475.434) (-476.067) [-474.216] (-474.815) -- 0:00:56
      211500 -- [-473.539] (-473.739) (-474.576) (-476.862) * (-474.756) [-476.682] (-475.735) (-474.973) -- 0:00:55
      212000 -- (-473.690) (-474.921) (-475.197) [-474.790] * (-473.461) [-475.294] (-475.914) (-475.021) -- 0:00:55
      212500 -- (-474.135) (-478.089) (-474.940) [-477.289] * [-473.631] (-475.491) (-473.099) (-474.644) -- 0:00:55
      213000 -- (-474.799) (-475.513) [-477.279] (-478.141) * (-476.616) [-474.077] (-473.241) (-475.895) -- 0:00:55
      213500 -- (-474.997) (-473.231) [-473.799] (-478.917) * (-479.327) [-474.477] (-478.486) (-475.039) -- 0:00:55
      214000 -- (-478.349) [-475.306] (-477.246) (-476.418) * [-478.083] (-478.214) (-477.047) (-474.225) -- 0:00:55
      214500 -- [-474.036] (-475.354) (-477.105) (-476.164) * (-475.099) (-478.618) (-477.306) [-473.200] -- 0:00:54
      215000 -- [-474.256] (-475.132) (-474.214) (-477.603) * (-476.156) (-474.977) (-476.956) [-475.902] -- 0:00:54

      Average standard deviation of split frequencies: 0.016818

      215500 -- (-473.306) [-473.536] (-474.064) (-475.789) * (-476.165) (-474.680) (-476.105) [-476.331] -- 0:00:54
      216000 -- (-474.527) [-473.730] (-473.096) (-475.408) * (-475.776) (-474.211) (-475.675) [-475.382] -- 0:00:54
      216500 -- [-474.825] (-473.878) (-474.239) (-473.788) * [-475.740] (-475.218) (-478.060) (-476.807) -- 0:00:54
      217000 -- (-474.097) (-475.135) (-473.892) [-473.822] * (-474.300) (-474.114) (-478.291) [-474.476] -- 0:00:54
      217500 -- [-473.987] (-475.898) (-473.314) (-473.727) * [-473.860] (-474.157) (-483.114) (-476.212) -- 0:00:53
      218000 -- (-474.353) (-476.311) (-475.062) [-475.159] * (-474.687) [-476.233] (-475.220) (-474.365) -- 0:00:53
      218500 -- (-479.436) (-477.831) [-474.270] (-477.240) * (-475.388) [-477.146] (-474.743) (-475.569) -- 0:00:53
      219000 -- (-476.362) (-476.705) [-473.983] (-477.020) * (-475.752) [-474.415] (-476.493) (-477.350) -- 0:00:53
      219500 -- (-474.495) (-475.978) (-476.022) [-474.630] * [-479.274] (-474.667) (-476.658) (-475.722) -- 0:00:53
      220000 -- [-475.030] (-475.943) (-475.940) (-474.067) * [-478.324] (-477.039) (-476.899) (-475.428) -- 0:00:53

      Average standard deviation of split frequencies: 0.015080

      220500 -- [-474.980] (-474.994) (-474.556) (-476.023) * (-474.732) (-478.417) [-474.198] (-473.402) -- 0:00:53
      221000 -- (-476.674) (-474.255) [-475.524] (-473.695) * (-475.137) (-473.855) [-473.488] (-477.787) -- 0:00:52
      221500 -- (-480.816) (-474.022) [-474.500] (-473.248) * (-473.801) (-474.160) (-474.752) [-475.420] -- 0:00:52
      222000 -- [-474.652] (-475.717) (-475.120) (-473.947) * [-475.279] (-473.779) (-476.819) (-476.309) -- 0:00:52
      222500 -- (-475.369) (-473.032) [-476.963] (-476.175) * [-475.480] (-476.283) (-473.769) (-476.095) -- 0:00:52
      223000 -- (-473.889) (-473.820) [-475.372] (-475.056) * (-475.014) (-475.699) (-474.791) [-473.943] -- 0:00:55
      223500 -- (-476.830) (-477.727) (-473.995) [-477.342] * (-475.119) [-474.550] (-474.716) (-473.313) -- 0:00:55
      224000 -- (-477.302) (-473.602) (-475.254) [-473.704] * (-474.769) [-474.788] (-474.000) (-475.925) -- 0:00:55
      224500 -- (-474.871) [-473.315] (-474.291) (-477.927) * (-477.240) (-474.153) (-474.109) [-474.149] -- 0:00:55
      225000 -- (-474.421) (-473.437) (-477.271) [-475.812] * (-474.733) (-474.851) [-475.843] (-474.794) -- 0:00:55

      Average standard deviation of split frequencies: 0.017266

      225500 -- [-479.401] (-473.046) (-474.251) (-473.953) * (-478.007) (-479.571) [-477.126] (-474.718) -- 0:00:54
      226000 -- (-480.574) (-473.564) (-474.372) [-477.207] * (-474.330) [-485.304] (-474.298) (-475.735) -- 0:00:54
      226500 -- [-475.230] (-474.620) (-476.307) (-474.893) * (-477.743) [-475.805] (-475.707) (-475.298) -- 0:00:54
      227000 -- (-480.092) [-477.165] (-478.512) (-477.822) * [-474.705] (-474.679) (-474.939) (-475.339) -- 0:00:54
      227500 -- (-476.890) [-476.083] (-476.564) (-476.182) * (-475.886) (-479.432) (-476.092) [-476.462] -- 0:00:54
      228000 -- [-473.792] (-477.599) (-477.611) (-473.520) * (-475.325) (-476.624) (-477.571) [-476.712] -- 0:00:54
      228500 -- (-474.779) (-476.030) [-477.207] (-474.730) * (-478.384) (-477.572) (-476.949) [-473.252] -- 0:00:54
      229000 -- [-475.339] (-477.236) (-477.510) (-476.898) * (-475.506) (-480.153) (-479.610) [-474.168] -- 0:00:53
      229500 -- [-475.234] (-476.745) (-476.301) (-474.372) * (-474.405) (-472.977) (-477.885) [-474.493] -- 0:00:53
      230000 -- [-474.853] (-481.125) (-477.016) (-473.717) * (-474.973) [-474.167] (-476.837) (-473.210) -- 0:00:53

      Average standard deviation of split frequencies: 0.016803

      230500 -- [-473.393] (-477.541) (-475.604) (-473.311) * (-476.115) (-477.516) [-473.340] (-475.598) -- 0:00:53
      231000 -- [-473.913] (-476.908) (-477.552) (-475.159) * (-475.155) [-476.169] (-474.412) (-473.652) -- 0:00:53
      231500 -- (-476.214) (-476.801) [-477.343] (-473.985) * (-477.351) (-476.526) (-475.845) [-474.600] -- 0:00:53
      232000 -- (-476.816) (-480.077) (-475.133) [-473.305] * [-473.810] (-473.976) (-474.360) (-474.471) -- 0:00:52
      232500 -- (-473.670) [-478.144] (-473.604) (-477.212) * (-474.733) (-474.655) (-475.041) [-474.945] -- 0:00:52
      233000 -- (-479.713) (-476.094) (-474.068) [-479.867] * (-474.167) (-474.241) [-474.008] (-477.084) -- 0:00:52
      233500 -- (-480.437) (-478.770) [-478.275] (-476.214) * (-473.518) [-473.220] (-475.999) (-475.413) -- 0:00:52
      234000 -- [-476.123] (-473.548) (-474.840) (-477.726) * [-479.362] (-478.290) (-473.928) (-477.300) -- 0:00:52
      234500 -- (-474.264) (-482.722) (-474.245) [-474.403] * (-472.944) [-476.696] (-475.957) (-476.634) -- 0:00:52
      235000 -- (-476.633) (-474.645) [-474.995] (-474.013) * (-474.801) (-474.233) [-475.236] (-479.880) -- 0:00:52

      Average standard deviation of split frequencies: 0.016332

      235500 -- (-474.560) [-475.302] (-479.484) (-479.698) * [-476.469] (-484.168) (-478.613) (-475.507) -- 0:00:51
      236000 -- (-474.739) (-474.799) (-475.848) [-476.907] * (-473.366) [-474.623] (-475.006) (-476.980) -- 0:00:51
      236500 -- (-476.901) (-476.131) (-477.423) [-476.444] * (-476.596) (-474.306) [-474.678] (-475.449) -- 0:00:51
      237000 -- (-475.430) (-475.701) (-475.068) [-474.341] * (-473.419) (-474.614) (-476.474) [-475.370] -- 0:00:51
      237500 -- (-475.142) (-475.930) (-476.381) [-477.098] * (-473.918) [-473.899] (-477.553) (-476.041) -- 0:00:51
      238000 -- (-476.737) [-473.155] (-478.721) (-475.622) * (-474.355) (-478.882) (-474.968) [-475.029] -- 0:00:51
      238500 -- (-476.161) (-476.510) [-477.818] (-474.356) * (-474.383) [-474.446] (-475.022) (-479.262) -- 0:00:54
      239000 -- (-474.019) (-477.857) [-474.749] (-475.700) * (-479.101) [-475.438] (-475.973) (-477.401) -- 0:00:54
      239500 -- (-475.295) (-478.201) [-474.436] (-474.117) * (-478.063) (-478.316) [-474.252] (-478.983) -- 0:00:53
      240000 -- [-473.435] (-479.770) (-474.053) (-478.584) * (-474.440) (-475.224) [-474.681] (-474.120) -- 0:00:53

      Average standard deviation of split frequencies: 0.015440

      240500 -- [-476.312] (-475.249) (-474.152) (-474.641) * (-477.946) (-475.043) [-475.015] (-474.991) -- 0:00:53
      241000 -- (-474.937) [-478.745] (-476.785) (-476.305) * (-474.048) (-473.947) [-473.106] (-477.056) -- 0:00:53
      241500 -- [-475.581] (-480.595) (-474.475) (-475.016) * [-474.606] (-475.054) (-474.815) (-475.899) -- 0:00:53
      242000 -- [-474.516] (-479.273) (-473.859) (-474.902) * (-475.608) (-475.825) (-476.457) [-474.344] -- 0:00:53
      242500 -- [-477.936] (-476.600) (-474.590) (-475.156) * (-475.248) (-474.367) (-475.200) [-474.834] -- 0:00:53
      243000 -- (-474.217) (-475.143) [-473.864] (-477.588) * (-475.869) (-474.440) (-475.399) [-473.502] -- 0:00:52
      243500 -- [-474.443] (-474.173) (-475.797) (-478.330) * [-480.117] (-473.252) (-478.399) (-474.041) -- 0:00:52
      244000 -- (-475.786) [-474.949] (-482.023) (-478.136) * [-475.445] (-479.357) (-475.163) (-475.516) -- 0:00:52
      244500 -- (-476.168) (-474.744) (-475.586) [-473.397] * [-474.787] (-475.224) (-475.346) (-474.446) -- 0:00:52
      245000 -- [-473.941] (-475.376) (-477.432) (-472.986) * [-473.519] (-475.666) (-476.354) (-474.107) -- 0:00:52

      Average standard deviation of split frequencies: 0.015330

      245500 -- (-474.537) (-474.310) (-476.249) [-474.115] * (-475.209) [-475.798] (-478.101) (-476.263) -- 0:00:52
      246000 -- [-475.839] (-477.397) (-474.530) (-477.091) * (-475.206) (-475.882) (-479.919) [-478.218] -- 0:00:52
      246500 -- (-477.704) (-480.110) (-475.863) [-476.506] * (-475.217) (-475.212) [-474.153] (-476.916) -- 0:00:51
      247000 -- (-476.866) (-475.318) [-472.933] (-480.469) * (-475.046) [-477.220] (-474.555) (-473.544) -- 0:00:51
      247500 -- (-476.012) [-473.901] (-473.786) (-476.745) * (-474.521) (-477.084) (-475.076) [-474.358] -- 0:00:51
      248000 -- (-476.282) (-473.154) (-473.575) [-475.590] * (-474.629) (-476.902) (-474.795) [-473.600] -- 0:00:51
      248500 -- (-475.816) (-474.971) [-474.047] (-475.531) * (-482.125) [-476.270] (-479.431) (-474.891) -- 0:00:51
      249000 -- (-474.866) (-474.678) (-474.755) [-475.330] * [-475.385] (-477.190) (-474.103) (-474.377) -- 0:00:51
      249500 -- (-476.660) (-475.053) [-477.906] (-476.836) * (-474.888) (-478.305) [-474.310] (-475.622) -- 0:00:51
      250000 -- (-475.145) (-475.632) (-476.421) [-474.773] * (-474.360) [-475.200] (-473.193) (-478.397) -- 0:00:51

      Average standard deviation of split frequencies: 0.014627

      250500 -- (-478.833) [-477.022] (-476.928) (-474.454) * [-472.998] (-477.166) (-474.287) (-473.565) -- 0:00:50
      251000 -- (-475.758) (-475.625) [-476.388] (-474.236) * (-474.309) (-478.932) [-473.706] (-474.541) -- 0:00:50
      251500 -- [-477.663] (-474.673) (-476.678) (-474.749) * [-473.957] (-476.097) (-482.470) (-474.836) -- 0:00:50
      252000 -- (-477.608) (-477.354) (-477.998) [-476.287] * (-473.436) (-474.594) [-476.669] (-475.323) -- 0:00:50
      252500 -- (-477.291) (-474.970) (-475.979) [-473.926] * (-474.173) (-476.728) [-474.072] (-474.682) -- 0:00:50
      253000 -- (-475.392) [-474.814] (-475.140) (-475.496) * (-474.709) (-474.660) [-474.503] (-476.270) -- 0:00:50
      253500 -- [-478.452] (-475.733) (-475.647) (-476.919) * (-473.720) [-474.063] (-475.085) (-475.108) -- 0:00:50
      254000 -- (-474.932) (-474.236) (-474.426) [-473.207] * (-474.295) [-474.288] (-475.340) (-475.620) -- 0:00:49
      254500 -- (-474.911) (-474.529) [-474.280] (-473.456) * (-476.136) [-474.789] (-474.220) (-474.811) -- 0:00:52
      255000 -- (-474.181) (-474.286) (-476.086) [-473.977] * (-476.587) [-474.319] (-476.436) (-478.663) -- 0:00:52

      Average standard deviation of split frequencies: 0.013865

      255500 -- (-474.850) (-475.988) (-475.256) [-474.147] * (-478.270) (-474.238) [-474.359] (-474.234) -- 0:00:52
      256000 -- (-476.185) [-474.539] (-476.249) (-475.627) * (-477.420) (-474.169) (-473.739) [-475.462] -- 0:00:52
      256500 -- (-478.177) (-476.007) [-473.122] (-473.301) * (-474.509) (-474.703) [-479.055] (-476.568) -- 0:00:52
      257000 -- (-474.636) (-476.310) [-475.294] (-475.284) * [-473.425] (-473.509) (-475.356) (-475.530) -- 0:00:52
      257500 -- (-476.142) [-473.834] (-474.564) (-474.909) * (-474.286) (-473.554) (-474.136) [-473.735] -- 0:00:51
      258000 -- (-476.676) (-477.121) [-474.840] (-474.364) * (-474.274) [-474.057] (-474.989) (-475.033) -- 0:00:51
      258500 -- (-475.594) (-475.003) [-473.619] (-474.669) * (-474.467) (-476.133) [-473.751] (-477.890) -- 0:00:51
      259000 -- [-475.488] (-474.873) (-473.321) (-477.022) * (-478.609) (-477.624) (-473.360) [-473.066] -- 0:00:51
      259500 -- [-475.473] (-478.597) (-477.190) (-476.344) * (-477.076) [-475.651] (-473.436) (-475.657) -- 0:00:51
      260000 -- [-474.172] (-475.250) (-474.633) (-475.184) * (-474.489) (-475.538) (-474.722) [-475.255] -- 0:00:51

      Average standard deviation of split frequencies: 0.012659

      260500 -- [-474.795] (-475.599) (-477.174) (-474.241) * (-477.485) (-477.633) (-475.011) [-474.960] -- 0:00:51
      261000 -- [-475.761] (-475.352) (-474.709) (-476.122) * (-476.360) (-477.596) (-478.366) [-473.661] -- 0:00:50
      261500 -- (-476.878) [-476.927] (-474.057) (-475.770) * (-476.318) [-475.111] (-475.697) (-474.156) -- 0:00:50
      262000 -- (-476.667) (-473.040) (-473.945) [-475.559] * (-479.748) (-475.151) (-475.425) [-473.928] -- 0:00:50
      262500 -- [-474.514] (-474.717) (-476.013) (-475.759) * (-474.739) (-477.418) (-473.313) [-472.917] -- 0:00:50
      263000 -- (-475.298) (-474.440) [-477.527] (-476.534) * (-475.171) (-477.694) [-473.900] (-474.228) -- 0:00:50
      263500 -- (-474.156) [-474.158] (-475.351) (-476.730) * (-474.147) [-475.902] (-473.737) (-476.730) -- 0:00:50
      264000 -- [-473.682] (-476.051) (-476.309) (-473.505) * (-477.492) (-476.384) [-474.546] (-475.796) -- 0:00:50
      264500 -- (-476.338) (-474.052) (-477.753) [-474.146] * (-473.003) (-474.227) [-476.515] (-474.912) -- 0:00:50
      265000 -- (-474.495) (-474.586) [-473.633] (-475.455) * [-474.291] (-473.767) (-473.291) (-473.966) -- 0:00:49

      Average standard deviation of split frequencies: 0.012093

      265500 -- (-474.580) [-475.826] (-474.849) (-475.147) * [-474.927] (-475.348) (-473.553) (-476.018) -- 0:00:49
      266000 -- (-473.810) (-476.148) (-475.447) [-474.161] * (-473.911) [-474.573] (-474.936) (-475.755) -- 0:00:49
      266500 -- (-475.579) (-474.680) (-475.963) [-474.140] * (-474.247) (-474.722) [-474.945] (-474.217) -- 0:00:49
      267000 -- (-477.659) (-473.467) (-480.108) [-474.829] * (-475.266) [-474.559] (-475.762) (-475.447) -- 0:00:49
      267500 -- (-481.757) [-476.344] (-475.171) (-475.091) * (-476.242) (-473.157) (-480.345) [-473.862] -- 0:00:49
      268000 -- (-473.532) (-473.434) [-473.595] (-474.798) * (-476.050) (-474.539) [-475.489] (-473.358) -- 0:00:49
      268500 -- (-473.710) (-475.583) (-475.376) [-473.269] * [-473.864] (-475.858) (-477.232) (-474.227) -- 0:00:49
      269000 -- (-476.576) [-475.771] (-474.070) (-480.305) * (-473.706) [-474.560] (-476.480) (-475.221) -- 0:00:48
      269500 -- (-477.046) (-476.926) (-476.042) [-474.238] * (-473.739) (-475.232) [-475.613] (-477.433) -- 0:00:48
      270000 -- [-476.692] (-477.061) (-474.971) (-473.024) * (-473.288) [-475.052] (-474.211) (-476.073) -- 0:00:51

      Average standard deviation of split frequencies: 0.011884

      270500 -- (-476.199) (-478.443) [-474.148] (-474.911) * (-474.826) (-474.019) (-475.721) [-473.864] -- 0:00:51
      271000 -- (-474.220) (-477.079) (-475.919) [-474.670] * [-475.305] (-474.519) (-475.589) (-473.949) -- 0:00:51
      271500 -- (-477.179) (-478.737) [-474.633] (-478.319) * (-474.447) (-473.524) (-474.769) [-475.428] -- 0:00:50
      272000 -- (-474.422) [-473.854] (-473.909) (-483.159) * (-474.418) (-474.522) (-477.033) [-474.548] -- 0:00:50
      272500 -- (-475.240) [-473.732] (-475.838) (-475.103) * (-473.957) (-477.487) [-477.342] (-476.555) -- 0:00:50
      273000 -- [-475.210] (-475.664) (-475.682) (-474.960) * (-475.573) (-476.237) (-477.440) [-474.140] -- 0:00:50
      273500 -- (-476.226) (-475.082) [-475.007] (-476.996) * (-474.362) (-476.208) [-476.245] (-474.083) -- 0:00:50
      274000 -- (-477.008) (-474.123) [-475.259] (-475.471) * (-473.882) (-476.170) (-478.070) [-477.783] -- 0:00:50
      274500 -- (-475.414) (-478.447) [-476.223] (-472.938) * [-473.762] (-474.946) (-475.304) (-474.846) -- 0:00:50
      275000 -- (-475.174) [-475.410] (-473.650) (-474.427) * (-473.545) [-476.947] (-481.273) (-473.438) -- 0:00:50

      Average standard deviation of split frequencies: 0.012860

      275500 -- (-481.065) (-476.356) (-475.968) [-473.550] * (-474.135) (-477.622) [-475.065] (-473.275) -- 0:00:49
      276000 -- (-475.994) [-474.034] (-475.119) (-474.984) * (-474.679) [-475.376] (-474.497) (-473.079) -- 0:00:49
      276500 -- [-474.655] (-475.056) (-473.899) (-475.689) * (-474.055) (-475.916) (-475.026) [-475.134] -- 0:00:49
      277000 -- (-475.259) (-474.640) (-475.241) [-473.653] * (-475.497) (-473.469) (-474.196) [-477.191] -- 0:00:49
      277500 -- (-475.703) [-476.443] (-473.926) (-473.480) * [-478.319] (-473.193) (-475.085) (-479.181) -- 0:00:49
      278000 -- (-472.963) (-478.848) (-476.592) [-474.423] * [-477.655] (-476.556) (-476.407) (-476.266) -- 0:00:49
      278500 -- (-473.694) (-475.845) [-474.638] (-476.514) * [-476.911] (-476.411) (-473.941) (-476.345) -- 0:00:49
      279000 -- (-476.390) [-479.433] (-479.674) (-476.249) * [-478.003] (-476.133) (-474.546) (-475.467) -- 0:00:49
      279500 -- (-475.170) (-474.384) (-476.157) [-473.472] * (-479.187) (-474.920) [-473.804] (-474.987) -- 0:00:48
      280000 -- (-478.891) [-473.043] (-477.382) (-475.117) * (-473.679) (-474.290) (-477.102) [-476.953] -- 0:00:48

      Average standard deviation of split frequencies: 0.013623

      280500 -- (-475.778) [-474.084] (-476.083) (-478.973) * [-479.564] (-475.068) (-474.788) (-477.707) -- 0:00:48
      281000 -- [-473.718] (-473.542) (-474.667) (-473.968) * (-475.657) (-475.114) (-473.492) [-474.425] -- 0:00:48
      281500 -- (-473.880) [-475.442] (-474.114) (-475.007) * (-474.379) (-473.931) [-473.424] (-475.326) -- 0:00:48
      282000 -- (-473.641) (-474.152) (-475.789) [-474.103] * (-473.449) (-475.441) [-476.799] (-474.389) -- 0:00:48
      282500 -- [-476.802] (-476.541) (-477.793) (-476.877) * [-473.696] (-475.091) (-475.779) (-474.485) -- 0:00:48
      283000 -- (-477.659) [-475.766] (-478.604) (-478.098) * [-476.654] (-474.460) (-478.234) (-475.812) -- 0:00:48
      283500 -- (-474.691) (-473.879) (-474.242) [-474.303] * [-476.924] (-474.113) (-473.257) (-474.907) -- 0:00:48
      284000 -- (-472.926) (-476.354) (-479.964) [-478.018] * (-474.540) (-473.739) (-476.835) [-474.045] -- 0:00:47
      284500 -- (-478.484) (-478.162) (-476.615) [-474.186] * (-473.985) (-476.019) [-476.934] (-476.773) -- 0:00:50
      285000 -- (-478.087) [-476.655] (-475.637) (-474.105) * (-475.346) (-480.742) [-477.559] (-474.082) -- 0:00:50

      Average standard deviation of split frequencies: 0.013461

      285500 -- (-476.579) [-474.298] (-474.691) (-478.621) * [-474.218] (-477.009) (-474.401) (-476.928) -- 0:00:50
      286000 -- (-476.314) (-477.816) [-474.115] (-477.889) * (-476.244) (-477.759) (-474.499) [-475.745] -- 0:00:49
      286500 -- (-474.881) (-474.213) [-474.515] (-475.048) * (-478.310) (-474.897) [-476.486] (-475.759) -- 0:00:49
      287000 -- [-475.474] (-476.379) (-476.471) (-478.485) * (-474.973) (-473.696) (-473.893) [-477.806] -- 0:00:49
      287500 -- (-477.344) [-474.483] (-474.633) (-477.326) * (-477.223) [-476.181] (-473.309) (-475.732) -- 0:00:49
      288000 -- (-474.163) (-479.385) (-477.481) [-476.835] * (-473.675) (-476.352) [-473.439] (-474.370) -- 0:00:49
      288500 -- (-473.332) [-476.264] (-474.658) (-476.356) * [-474.116] (-474.520) (-474.566) (-474.074) -- 0:00:49
      289000 -- [-474.043] (-476.854) (-473.525) (-474.186) * [-474.344] (-476.378) (-477.574) (-473.616) -- 0:00:49
      289500 -- (-473.576) (-475.702) [-473.456] (-476.175) * (-474.529) [-476.616] (-474.283) (-474.726) -- 0:00:49
      290000 -- (-477.419) (-475.561) (-474.638) [-474.859] * [-473.562] (-473.003) (-479.817) (-475.855) -- 0:00:48

      Average standard deviation of split frequencies: 0.012434

      290500 -- (-474.287) (-476.882) (-475.378) [-474.176] * (-473.791) [-473.106] (-475.202) (-473.882) -- 0:00:48
      291000 -- [-473.643] (-480.055) (-476.566) (-477.364) * (-475.953) [-474.847] (-474.944) (-475.547) -- 0:00:48
      291500 -- (-474.092) (-473.332) (-475.978) [-473.922] * (-474.021) (-473.149) [-473.668] (-476.729) -- 0:00:48
      292000 -- (-474.157) (-473.974) [-474.074] (-474.398) * (-473.996) (-479.037) [-474.944] (-480.720) -- 0:00:48
      292500 -- (-476.564) (-473.550) [-475.923] (-474.747) * (-473.122) [-478.864] (-474.782) (-478.121) -- 0:00:48
      293000 -- (-477.721) (-483.074) (-474.070) [-478.039] * (-473.272) (-476.242) [-474.894] (-474.243) -- 0:00:48
      293500 -- [-473.529] (-475.041) (-473.640) (-473.044) * (-475.449) (-475.830) (-477.471) [-474.738] -- 0:00:48
      294000 -- (-475.556) [-475.414] (-483.246) (-473.598) * (-475.397) (-474.078) (-478.447) [-478.761] -- 0:00:48
      294500 -- [-475.835] (-475.749) (-483.524) (-477.594) * (-475.025) (-473.183) (-473.529) [-476.146] -- 0:00:47
      295000 -- (-476.894) [-473.580] (-475.521) (-475.821) * (-475.395) (-473.081) [-478.842] (-475.474) -- 0:00:47

      Average standard deviation of split frequencies: 0.011856

      295500 -- (-475.712) (-479.787) [-474.485] (-475.152) * (-475.663) [-473.252] (-476.926) (-477.296) -- 0:00:47
      296000 -- (-474.790) [-476.197] (-478.803) (-473.435) * (-479.255) [-473.390] (-478.602) (-474.539) -- 0:00:47
      296500 -- (-479.331) (-477.430) [-475.002] (-473.962) * (-479.565) (-477.906) [-476.739] (-477.556) -- 0:00:47
      297000 -- (-475.875) (-475.670) (-476.056) [-473.663] * [-478.449] (-475.179) (-474.823) (-475.526) -- 0:00:47
      297500 -- (-475.603) (-475.595) [-474.926] (-476.580) * [-476.189] (-475.373) (-474.645) (-474.223) -- 0:00:47
      298000 -- (-475.911) (-477.866) [-475.060] (-476.123) * [-477.517] (-477.522) (-474.753) (-473.663) -- 0:00:47
      298500 -- (-474.914) (-478.204) [-474.083] (-474.375) * (-474.217) [-474.069] (-474.994) (-477.388) -- 0:00:47
      299000 -- (-474.057) (-476.079) (-475.351) [-477.341] * (-474.108) [-476.087] (-480.543) (-475.394) -- 0:00:46
      299500 -- (-474.359) (-475.347) [-474.318] (-476.125) * (-479.613) (-475.975) [-474.855] (-475.397) -- 0:00:46
      300000 -- (-475.593) (-475.533) [-475.362] (-475.456) * [-474.854] (-478.340) (-474.914) (-475.999) -- 0:00:46

      Average standard deviation of split frequencies: 0.012630

      300500 -- (-475.430) (-474.891) (-477.090) [-473.489] * [-475.204] (-476.167) (-474.020) (-477.398) -- 0:00:48
      301000 -- (-478.185) [-473.151] (-476.732) (-473.614) * (-476.176) [-477.119] (-475.172) (-478.448) -- 0:00:48
      301500 -- (-478.618) (-474.042) (-475.961) [-474.294] * (-476.404) [-477.066] (-476.154) (-475.464) -- 0:00:48
      302000 -- (-480.195) (-473.671) (-478.448) [-476.997] * [-475.624] (-476.544) (-475.023) (-476.592) -- 0:00:48
      302500 -- [-476.650] (-473.683) (-478.086) (-476.939) * (-477.991) (-475.965) [-478.790] (-476.300) -- 0:00:48
      303000 -- (-473.695) (-473.250) [-474.524] (-474.006) * [-474.379] (-478.336) (-477.121) (-479.205) -- 0:00:48
      303500 -- [-473.884] (-476.073) (-475.721) (-475.098) * [-473.948] (-473.928) (-476.700) (-473.882) -- 0:00:48
      304000 -- (-473.456) (-474.468) (-474.079) [-473.314] * [-474.227] (-476.585) (-475.199) (-473.378) -- 0:00:48
      304500 -- [-474.054] (-474.702) (-476.133) (-474.448) * (-477.170) (-473.933) (-475.491) [-475.668] -- 0:00:47
      305000 -- [-473.876] (-475.650) (-474.967) (-480.180) * (-474.006) (-477.368) (-473.223) [-473.804] -- 0:00:47

      Average standard deviation of split frequencies: 0.012068

      305500 -- (-476.754) [-473.421] (-476.516) (-474.603) * (-473.951) (-476.083) [-473.157] (-473.941) -- 0:00:47
      306000 -- (-475.923) (-474.203) [-476.550] (-474.189) * (-474.291) (-477.496) [-474.911] (-479.902) -- 0:00:47
      306500 -- (-477.185) [-473.680] (-480.298) (-473.830) * (-475.084) [-475.854] (-475.967) (-474.293) -- 0:00:47
      307000 -- (-473.871) (-475.552) [-474.093] (-481.244) * (-474.527) (-474.620) [-473.495] (-476.015) -- 0:00:47
      307500 -- (-473.801) (-475.076) (-474.501) [-479.978] * (-473.751) (-478.099) (-473.645) [-476.283] -- 0:00:47
      308000 -- (-477.383) (-475.489) (-480.978) [-473.987] * (-475.208) (-476.328) (-476.740) [-474.320] -- 0:00:47
      308500 -- (-477.488) [-479.961] (-476.056) (-478.036) * (-475.982) (-474.593) [-473.213] (-475.378) -- 0:00:47
      309000 -- [-474.503] (-477.679) (-473.440) (-481.218) * (-474.320) (-473.203) (-474.377) [-473.799] -- 0:00:46
      309500 -- (-476.699) (-476.417) (-474.374) [-473.739] * (-474.371) (-475.462) [-475.754] (-475.195) -- 0:00:46
      310000 -- (-474.627) (-474.518) [-474.079] (-473.957) * (-476.485) (-475.108) (-476.101) [-478.508] -- 0:00:46

      Average standard deviation of split frequencies: 0.012476

      310500 -- (-475.056) (-475.000) [-477.158] (-475.506) * [-475.256] (-474.913) (-477.531) (-475.151) -- 0:00:46
      311000 -- (-476.430) (-477.051) [-474.735] (-473.673) * (-477.330) [-475.162] (-473.806) (-474.663) -- 0:00:46
      311500 -- [-476.485] (-478.303) (-474.157) (-473.626) * (-473.911) (-474.701) [-478.336] (-474.609) -- 0:00:46
      312000 -- (-475.769) [-478.991] (-474.168) (-477.443) * (-474.220) (-474.999) (-474.650) [-474.562] -- 0:00:46
      312500 -- (-474.898) (-475.106) (-474.544) [-476.201] * (-473.435) [-474.771] (-475.384) (-477.817) -- 0:00:46
      313000 -- [-475.678] (-475.694) (-474.523) (-474.604) * (-476.524) (-476.844) [-473.523] (-478.073) -- 0:00:46
      313500 -- [-474.074] (-473.503) (-474.544) (-476.904) * (-476.636) [-473.396] (-474.624) (-476.792) -- 0:00:45
      314000 -- (-476.367) (-475.269) [-474.712] (-480.631) * (-476.378) (-476.482) (-476.198) [-475.128] -- 0:00:45
      314500 -- (-473.147) (-474.822) (-479.448) [-475.292] * (-476.042) [-476.062] (-474.920) (-474.780) -- 0:00:45
      315000 -- (-473.444) (-477.399) (-475.974) [-476.157] * (-475.769) [-475.361] (-476.640) (-477.963) -- 0:00:45

      Average standard deviation of split frequencies: 0.013343

      315500 -- (-476.068) (-481.813) [-476.645] (-475.130) * (-474.953) (-473.912) [-475.100] (-475.847) -- 0:00:45
      316000 -- (-479.563) (-476.832) [-477.028] (-475.784) * (-475.157) (-475.261) [-473.886] (-479.674) -- 0:00:45
      316500 -- (-474.424) (-475.361) [-479.748] (-480.545) * (-480.804) (-476.143) [-476.852] (-479.400) -- 0:00:45
      317000 -- [-473.562] (-474.772) (-473.815) (-480.447) * (-475.935) [-475.781] (-474.513) (-475.406) -- 0:00:45
      317500 -- (-476.074) (-478.285) (-473.812) [-477.387] * (-476.044) [-472.998] (-475.471) (-473.439) -- 0:00:47
      318000 -- [-475.279] (-474.799) (-475.335) (-473.533) * (-475.570) (-479.017) (-475.827) [-474.537] -- 0:00:47
      318500 -- [-475.562] (-475.404) (-477.337) (-473.329) * (-477.000) [-475.876] (-475.268) (-476.286) -- 0:00:47
      319000 -- (-475.442) [-475.844] (-475.687) (-474.024) * (-475.341) (-475.044) (-479.597) [-473.268] -- 0:00:46
      319500 -- (-475.379) [-474.352] (-475.693) (-473.130) * (-475.962) (-474.328) [-474.858] (-480.229) -- 0:00:46
      320000 -- (-479.826) (-476.017) [-476.817] (-479.609) * (-478.084) (-476.633) (-475.933) [-475.956] -- 0:00:46

      Average standard deviation of split frequencies: 0.013884

      320500 -- (-474.348) (-473.471) [-474.710] (-479.583) * (-480.814) (-474.575) (-474.051) [-475.487] -- 0:00:46
      321000 -- (-476.222) (-475.343) [-476.249] (-476.938) * [-476.057] (-474.750) (-474.959) (-475.053) -- 0:00:46
      321500 -- (-477.446) (-475.150) [-474.351] (-478.073) * [-477.287] (-475.504) (-473.931) (-474.621) -- 0:00:46
      322000 -- (-482.993) (-475.282) (-473.505) [-474.408] * [-478.434] (-476.725) (-477.562) (-474.688) -- 0:00:46
      322500 -- (-474.209) [-475.381] (-473.588) (-474.741) * (-475.801) (-476.932) (-479.472) [-475.181] -- 0:00:46
      323000 -- (-475.339) (-474.174) [-474.052] (-477.381) * [-475.139] (-476.000) (-478.405) (-472.926) -- 0:00:46
      323500 -- [-476.609] (-475.890) (-475.170) (-476.385) * [-475.113] (-477.680) (-474.605) (-477.782) -- 0:00:46
      324000 -- [-475.695] (-480.600) (-474.178) (-475.857) * [-473.433] (-474.680) (-475.345) (-474.373) -- 0:00:45
      324500 -- (-477.780) (-473.808) (-483.528) [-474.523] * (-476.134) (-476.546) [-473.259] (-474.949) -- 0:00:45
      325000 -- (-476.655) (-481.138) [-477.456] (-474.483) * (-474.665) (-477.714) [-475.197] (-474.634) -- 0:00:45

      Average standard deviation of split frequencies: 0.012710

      325500 -- (-474.820) [-473.519] (-474.660) (-478.139) * (-474.848) (-478.562) [-476.656] (-476.511) -- 0:00:45
      326000 -- (-476.268) (-475.888) (-475.262) [-478.774] * [-476.451] (-476.141) (-477.259) (-478.421) -- 0:00:45
      326500 -- (-474.507) (-477.227) (-473.707) [-475.797] * (-473.344) (-476.856) [-474.404] (-474.315) -- 0:00:45
      327000 -- [-474.123] (-473.515) (-477.840) (-477.709) * (-474.074) [-476.295] (-475.179) (-475.323) -- 0:00:45
      327500 -- (-475.583) (-475.114) [-476.073] (-474.555) * (-474.550) [-478.292] (-473.558) (-477.247) -- 0:00:45
      328000 -- (-473.717) [-477.741] (-475.749) (-474.798) * (-475.170) (-475.519) [-477.299] (-476.089) -- 0:00:45
      328500 -- (-474.186) (-478.420) [-475.421] (-475.030) * (-474.946) [-474.832] (-477.491) (-475.674) -- 0:00:44
      329000 -- (-484.498) (-473.996) (-477.004) [-476.863] * [-475.286] (-475.783) (-478.277) (-473.973) -- 0:00:44
      329500 -- (-476.513) (-473.576) [-475.824] (-477.735) * (-474.187) (-474.543) (-476.785) [-475.829] -- 0:00:44
      330000 -- (-475.609) (-475.817) (-477.618) [-478.164] * (-474.857) [-477.693] (-476.777) (-473.690) -- 0:00:44

      Average standard deviation of split frequencies: 0.014731

      330500 -- (-475.724) [-473.933] (-476.056) (-473.562) * (-475.136) [-476.547] (-475.012) (-476.974) -- 0:00:44
      331000 -- (-476.739) [-476.458] (-473.904) (-473.309) * (-474.794) (-478.919) [-475.985] (-474.124) -- 0:00:44
      331500 -- (-476.396) (-476.251) [-474.212] (-476.645) * (-473.822) [-476.577] (-474.272) (-479.125) -- 0:00:44
      332000 -- (-476.017) (-473.428) [-474.621] (-478.996) * (-474.758) (-473.996) [-474.334] (-479.762) -- 0:00:44
      332500 -- (-475.465) [-474.807] (-474.371) (-476.944) * (-474.896) [-473.388] (-474.811) (-479.452) -- 0:00:44
      333000 -- (-479.922) (-476.420) [-475.891] (-474.612) * (-477.037) (-473.300) [-477.701] (-478.851) -- 0:00:44
      333500 -- [-475.611] (-475.344) (-474.461) (-476.795) * (-476.247) (-474.260) [-473.800] (-477.077) -- 0:00:45
      334000 -- (-478.213) (-477.047) (-475.536) [-473.312] * (-476.980) (-474.010) [-473.894] (-474.644) -- 0:00:45
      334500 -- [-477.790] (-477.759) (-475.308) (-476.634) * (-475.452) (-475.017) [-474.164] (-477.595) -- 0:00:45
      335000 -- [-473.778] (-474.278) (-474.731) (-475.939) * (-476.720) [-475.724] (-476.662) (-475.657) -- 0:00:45

      Average standard deviation of split frequencies: 0.014653

      335500 -- (-473.574) (-475.158) [-474.905] (-474.416) * (-480.093) [-476.713] (-474.871) (-474.763) -- 0:00:45
      336000 -- [-473.363] (-477.348) (-478.165) (-474.077) * [-475.721] (-475.107) (-479.568) (-476.958) -- 0:00:45
      336500 -- [-473.729] (-473.777) (-479.207) (-474.731) * (-476.463) [-474.970] (-474.874) (-473.874) -- 0:00:45
      337000 -- [-473.447] (-478.667) (-481.077) (-474.271) * (-476.161) [-475.103] (-475.914) (-475.797) -- 0:00:45
      337500 -- (-474.886) [-477.385] (-476.506) (-474.283) * (-474.790) (-474.915) (-474.880) [-474.820] -- 0:00:45
      338000 -- (-475.855) (-474.876) (-477.533) [-477.015] * (-479.778) (-476.166) [-478.055] (-478.082) -- 0:00:45
      338500 -- (-475.047) (-477.362) [-476.493] (-476.002) * (-473.588) (-475.466) [-478.707] (-476.546) -- 0:00:44
      339000 -- (-478.126) [-474.048] (-475.402) (-478.247) * (-478.455) [-473.789] (-474.358) (-474.092) -- 0:00:44
      339500 -- (-473.752) (-474.561) [-474.262] (-474.045) * (-474.904) [-475.807] (-477.483) (-473.788) -- 0:00:44
      340000 -- (-476.952) (-475.266) (-473.164) [-473.631] * (-474.820) (-474.005) (-474.640) [-475.399] -- 0:00:44

      Average standard deviation of split frequencies: 0.014914

      340500 -- (-475.037) (-474.121) (-475.260) [-475.218] * [-478.573] (-474.648) (-476.982) (-475.803) -- 0:00:44
      341000 -- (-474.238) [-476.951] (-475.122) (-478.057) * (-474.838) (-475.114) (-477.976) [-475.682] -- 0:00:44
      341500 -- [-476.372] (-476.449) (-477.969) (-478.458) * (-473.767) [-475.968] (-475.163) (-473.396) -- 0:00:44
      342000 -- [-477.256] (-473.852) (-477.700) (-475.950) * (-474.815) [-476.115] (-475.229) (-475.638) -- 0:00:44
      342500 -- (-473.879) (-474.767) [-475.332] (-473.756) * (-477.227) [-475.643] (-476.971) (-477.201) -- 0:00:44
      343000 -- [-474.162] (-474.579) (-478.353) (-476.925) * (-475.930) (-481.508) (-474.434) [-474.739] -- 0:00:44
      343500 -- (-480.645) [-476.723] (-473.171) (-475.708) * (-479.519) [-476.976] (-475.387) (-475.441) -- 0:00:43
      344000 -- (-477.405) (-475.718) [-475.883] (-474.041) * (-477.041) [-473.745] (-474.781) (-475.035) -- 0:00:43
      344500 -- (-477.534) (-475.339) [-480.913] (-476.475) * (-475.066) [-473.755] (-479.013) (-474.236) -- 0:00:43
      345000 -- (-474.136) (-475.549) (-476.020) [-474.608] * (-474.741) [-481.040] (-475.846) (-477.736) -- 0:00:43

      Average standard deviation of split frequencies: 0.014154

      345500 -- (-476.177) (-474.497) (-473.714) [-480.979] * (-476.148) (-476.366) (-476.375) [-474.670] -- 0:00:43
      346000 -- (-474.581) (-473.038) (-473.242) [-474.903] * [-475.207] (-477.645) (-475.173) (-476.027) -- 0:00:43
      346500 -- [-475.444] (-474.489) (-478.874) (-474.263) * [-475.106] (-478.616) (-474.167) (-477.614) -- 0:00:43
      347000 -- [-475.637] (-475.189) (-475.119) (-480.020) * (-476.131) [-474.777] (-475.311) (-473.976) -- 0:00:43
      347500 -- (-476.419) [-474.019] (-475.251) (-476.232) * (-478.606) [-474.295] (-475.288) (-473.873) -- 0:00:43
      348000 -- (-474.627) [-473.907] (-482.091) (-473.863) * (-479.138) (-476.709) (-474.779) [-475.327] -- 0:00:43
      348500 -- (-475.568) (-473.836) [-475.191] (-475.226) * (-476.284) (-476.063) [-475.536] (-477.526) -- 0:00:42
      349000 -- (-476.028) (-477.354) (-477.620) [-475.646] * (-475.103) [-476.693] (-474.648) (-479.721) -- 0:00:42
      349500 -- (-475.119) (-477.960) [-474.571] (-474.129) * (-475.425) (-475.087) [-475.130] (-476.551) -- 0:00:42
      350000 -- [-476.444] (-479.599) (-475.179) (-473.587) * [-473.271] (-473.997) (-475.685) (-476.601) -- 0:00:42

      Average standard deviation of split frequencies: 0.013667

      350500 -- (-475.617) (-476.693) [-474.407] (-476.422) * (-478.531) [-474.461] (-476.172) (-477.588) -- 0:00:44
      351000 -- [-482.344] (-478.801) (-475.489) (-475.834) * (-478.148) (-474.094) [-474.444] (-475.077) -- 0:00:44
      351500 -- (-478.971) (-474.966) (-474.111) [-477.491] * (-474.717) (-474.115) [-474.536] (-477.259) -- 0:00:44
      352000 -- (-480.861) [-474.786] (-478.141) (-474.333) * (-475.493) (-475.461) [-475.325] (-477.084) -- 0:00:44
      352500 -- (-477.438) [-473.932] (-478.609) (-476.534) * (-473.331) [-479.147] (-474.551) (-474.881) -- 0:00:44
      353000 -- (-474.798) [-479.213] (-473.868) (-475.168) * (-477.513) [-477.131] (-473.960) (-474.336) -- 0:00:43
      353500 -- (-476.696) [-474.712] (-473.750) (-474.065) * (-477.336) (-476.750) (-473.662) [-473.317] -- 0:00:43
      354000 -- [-473.631] (-474.440) (-474.294) (-474.050) * (-473.538) (-475.536) [-474.635] (-475.534) -- 0:00:43
      354500 -- (-475.490) (-474.902) (-480.073) [-475.220] * [-473.616] (-475.164) (-476.546) (-475.491) -- 0:00:43
      355000 -- (-476.065) (-473.679) [-479.165] (-479.367) * (-474.721) [-475.146] (-479.010) (-479.925) -- 0:00:43

      Average standard deviation of split frequencies: 0.013904

      355500 -- (-475.999) [-474.780] (-473.704) (-477.474) * (-475.948) (-474.469) [-475.408] (-474.407) -- 0:00:43
      356000 -- [-475.539] (-475.891) (-473.438) (-473.673) * (-474.655) [-474.209] (-478.920) (-476.516) -- 0:00:43
      356500 -- (-474.597) (-477.008) [-476.340] (-473.912) * (-474.436) [-475.371] (-475.215) (-473.468) -- 0:00:43
      357000 -- (-475.817) (-481.520) (-476.118) [-475.251] * (-474.804) (-474.519) [-475.587] (-478.253) -- 0:00:43
      357500 -- (-475.443) (-480.318) (-474.503) [-478.347] * (-475.628) [-475.460] (-475.564) (-475.341) -- 0:00:43
      358000 -- [-476.048] (-477.171) (-473.721) (-476.166) * (-478.073) [-473.466] (-478.206) (-475.430) -- 0:00:43
      358500 -- (-474.238) [-474.268] (-474.955) (-474.248) * (-477.539) [-473.836] (-477.362) (-475.196) -- 0:00:42
      359000 -- (-475.359) (-477.810) [-474.445] (-475.839) * (-475.049) [-476.186] (-475.153) (-473.737) -- 0:00:42
      359500 -- [-473.168] (-476.400) (-477.658) (-474.778) * (-477.264) (-476.796) (-473.888) [-474.904] -- 0:00:42
      360000 -- [-474.911] (-475.754) (-476.725) (-475.654) * [-476.082] (-479.011) (-473.746) (-473.247) -- 0:00:42

      Average standard deviation of split frequencies: 0.013506

      360500 -- (-475.120) (-475.085) (-475.593) [-474.276] * (-476.559) (-474.158) [-476.015] (-473.855) -- 0:00:42
      361000 -- (-476.344) (-475.759) [-475.550] (-475.103) * (-475.107) [-477.216] (-478.443) (-478.821) -- 0:00:42
      361500 -- [-477.799] (-477.496) (-479.502) (-473.022) * (-476.987) (-477.057) (-475.864) [-473.481] -- 0:00:42
      362000 -- [-478.374] (-478.128) (-474.235) (-473.454) * [-478.162] (-474.282) (-476.401) (-473.912) -- 0:00:42
      362500 -- [-474.611] (-476.173) (-475.195) (-473.147) * [-473.160] (-475.559) (-475.728) (-475.814) -- 0:00:42
      363000 -- (-473.474) (-475.244) (-474.976) [-473.799] * (-475.729) (-475.765) (-481.550) [-474.626] -- 0:00:42
      363500 -- [-473.143] (-480.198) (-475.805) (-475.698) * (-477.395) [-474.896] (-480.641) (-475.890) -- 0:00:42
      364000 -- (-473.557) (-474.740) (-473.646) [-473.965] * (-474.718) [-473.888] (-478.273) (-480.124) -- 0:00:41
      364500 -- [-474.732] (-475.414) (-473.982) (-479.680) * (-473.973) [-477.053] (-474.613) (-473.217) -- 0:00:41
      365000 -- (-474.775) (-473.719) (-476.158) [-475.850] * (-476.215) (-475.161) (-474.448) [-478.764] -- 0:00:41

      Average standard deviation of split frequencies: 0.012880

      365500 -- (-476.391) (-477.042) (-474.272) [-474.464] * (-480.058) (-477.696) (-476.123) [-477.373] -- 0:00:41
      366000 -- (-476.750) (-478.294) [-477.094] (-475.776) * (-475.868) (-475.489) (-474.044) [-475.708] -- 0:00:41
      366500 -- [-476.594] (-477.289) (-475.514) (-473.719) * [-474.479] (-474.305) (-476.366) (-474.114) -- 0:00:41
      367000 -- (-478.652) [-475.859] (-476.272) (-474.608) * [-476.510] (-475.889) (-474.017) (-474.022) -- 0:00:41
      367500 -- (-476.776) [-477.080] (-474.716) (-477.900) * (-475.054) (-476.841) (-473.167) [-475.879] -- 0:00:43
      368000 -- (-475.066) (-474.140) (-473.787) [-474.799] * (-480.474) (-477.991) [-473.397] (-476.842) -- 0:00:42
      368500 -- [-476.308] (-474.735) (-473.860) (-477.962) * (-477.185) (-476.098) (-474.894) [-473.192] -- 0:00:42
      369000 -- (-475.429) (-474.548) (-474.663) [-476.869] * (-474.310) [-480.267] (-475.062) (-473.840) -- 0:00:42
      369500 -- (-474.568) (-473.883) (-474.854) [-475.428] * (-474.970) (-474.850) [-476.098] (-475.587) -- 0:00:42
      370000 -- [-474.380] (-475.994) (-474.684) (-474.407) * (-473.375) (-474.877) (-476.352) [-475.849] -- 0:00:42

      Average standard deviation of split frequencies: 0.013354

      370500 -- (-474.206) (-474.023) [-474.305] (-473.775) * (-473.964) (-475.447) (-477.084) [-473.339] -- 0:00:42
      371000 -- (-475.475) (-475.224) [-473.083] (-474.261) * (-477.721) (-475.143) [-479.986] (-474.065) -- 0:00:42
      371500 -- [-474.863] (-474.906) (-474.970) (-474.071) * (-474.873) [-474.988] (-476.069) (-475.039) -- 0:00:42
      372000 -- (-473.932) (-476.279) [-473.926] (-476.156) * (-474.818) (-479.027) (-475.913) [-473.891] -- 0:00:42
      372500 -- (-474.451) [-473.656] (-473.562) (-475.090) * [-473.880] (-475.396) (-478.802) (-478.201) -- 0:00:42
      373000 -- (-477.756) (-476.858) (-473.553) [-473.901] * (-474.366) (-477.768) [-477.269] (-474.536) -- 0:00:42
      373500 -- (-474.916) (-476.816) [-473.442] (-476.217) * (-475.038) [-473.989] (-481.450) (-475.043) -- 0:00:41
      374000 -- (-475.341) (-474.151) [-474.176] (-476.244) * (-476.317) [-475.185] (-479.324) (-475.118) -- 0:00:41
      374500 -- [-473.289] (-473.528) (-473.483) (-474.189) * (-477.414) (-474.125) [-477.585] (-476.931) -- 0:00:41
      375000 -- (-476.577) (-473.769) (-475.467) [-477.893] * [-475.119] (-476.190) (-477.493) (-477.685) -- 0:00:41

      Average standard deviation of split frequencies: 0.013304

      375500 -- (-474.154) [-474.957] (-475.091) (-473.609) * [-477.031] (-473.636) (-474.570) (-477.250) -- 0:00:41
      376000 -- (-476.760) [-475.514] (-475.562) (-473.121) * (-475.188) (-475.062) [-475.409] (-476.905) -- 0:00:41
      376500 -- [-474.148] (-474.249) (-476.498) (-476.192) * (-476.559) [-473.507] (-474.909) (-476.895) -- 0:00:41
      377000 -- (-474.301) (-473.517) (-473.544) [-474.585] * (-477.458) (-477.490) [-477.177] (-474.287) -- 0:00:41
      377500 -- (-473.649) (-474.458) (-474.054) [-476.397] * [-478.687] (-472.906) (-477.921) (-474.374) -- 0:00:41
      378000 -- (-475.757) (-476.337) [-477.295] (-476.112) * (-479.808) [-473.764] (-477.644) (-481.777) -- 0:00:41
      378500 -- (-474.632) (-474.238) [-475.659] (-480.907) * [-477.230] (-474.736) (-479.397) (-475.098) -- 0:00:41
      379000 -- (-475.812) (-473.519) (-479.397) [-474.817] * (-475.392) (-480.031) [-478.770] (-478.355) -- 0:00:40
      379500 -- [-475.745] (-475.056) (-477.330) (-475.290) * (-473.397) [-476.163] (-475.824) (-477.861) -- 0:00:40
      380000 -- (-473.295) [-474.517] (-479.049) (-479.829) * (-476.843) (-475.813) [-475.606] (-474.981) -- 0:00:40

      Average standard deviation of split frequencies: 0.014172

      380500 -- (-481.962) (-474.638) (-476.604) [-476.203] * (-475.378) [-477.161] (-476.850) (-475.923) -- 0:00:40
      381000 -- (-474.896) (-474.308) (-476.197) [-475.568] * (-479.414) (-475.651) (-478.154) [-477.097] -- 0:00:40
      381500 -- (-475.086) [-474.979] (-478.104) (-475.685) * [-473.833] (-475.659) (-479.807) (-475.367) -- 0:00:40
      382000 -- [-475.980] (-474.335) (-476.479) (-476.135) * [-475.844] (-474.297) (-476.169) (-475.400) -- 0:00:40
      382500 -- (-475.865) (-475.666) (-474.951) [-473.677] * (-475.631) (-479.342) (-475.274) [-476.416] -- 0:00:40
      383000 -- (-473.889) (-475.174) [-477.355] (-476.288) * (-476.194) (-478.505) [-474.979] (-478.494) -- 0:00:40
      383500 -- (-474.053) (-476.167) [-473.563] (-479.215) * [-475.079] (-473.151) (-475.452) (-475.442) -- 0:00:40
      384000 -- (-480.149) (-478.507) [-473.336] (-474.554) * (-477.751) (-475.573) (-475.059) [-476.591] -- 0:00:40
      384500 -- (-476.913) (-479.141) [-474.107] (-476.194) * (-478.179) (-481.454) [-475.114] (-476.995) -- 0:00:41
      385000 -- [-474.697] (-474.430) (-474.859) (-474.942) * [-474.657] (-474.559) (-475.860) (-476.959) -- 0:00:41

      Average standard deviation of split frequencies: 0.014591

      385500 -- [-476.316] (-479.561) (-473.704) (-474.409) * (-476.436) [-474.562] (-476.500) (-475.262) -- 0:00:41
      386000 -- (-481.002) [-475.570] (-474.301) (-475.391) * [-476.449] (-473.242) (-478.479) (-474.011) -- 0:00:41
      386500 -- (-480.315) [-473.745] (-476.412) (-475.658) * (-477.355) (-476.805) [-476.445] (-473.488) -- 0:00:41
      387000 -- (-474.666) [-475.565] (-473.929) (-473.679) * (-476.544) (-475.877) [-474.103] (-474.464) -- 0:00:41
      387500 -- (-473.988) (-479.380) (-474.812) [-473.568] * (-476.179) (-473.760) (-474.967) [-473.335] -- 0:00:41
      388000 -- (-473.320) (-479.062) (-474.223) [-473.973] * (-474.430) (-473.230) (-475.826) [-479.013] -- 0:00:41
      388500 -- (-476.782) [-478.084] (-474.683) (-474.742) * [-475.822] (-475.996) (-475.096) (-477.822) -- 0:00:40
      389000 -- (-474.797) [-474.751] (-474.074) (-479.966) * [-474.928] (-475.157) (-475.721) (-475.658) -- 0:00:40
      389500 -- (-475.027) (-475.748) [-475.612] (-479.582) * [-474.327] (-478.093) (-474.490) (-475.942) -- 0:00:40
      390000 -- [-474.192] (-474.579) (-475.108) (-475.356) * (-476.297) (-477.227) (-474.626) [-475.570] -- 0:00:40

      Average standard deviation of split frequencies: 0.013527

      390500 -- [-475.893] (-474.576) (-475.717) (-476.245) * (-476.825) (-473.521) [-475.444] (-476.197) -- 0:00:40
      391000 -- (-477.928) [-474.206] (-474.159) (-475.142) * (-477.006) (-473.635) (-473.354) [-475.492] -- 0:00:40
      391500 -- (-476.837) (-476.436) (-477.293) [-474.911] * (-474.192) (-476.930) [-475.803] (-473.840) -- 0:00:40
      392000 -- (-473.589) (-476.154) (-475.084) [-473.025] * (-473.330) (-473.131) (-473.915) [-474.682] -- 0:00:40
      392500 -- (-477.241) [-475.326] (-477.345) (-478.570) * (-473.728) [-473.151] (-474.508) (-474.873) -- 0:00:40
      393000 -- (-477.656) (-474.709) [-473.138] (-476.140) * [-473.854] (-476.789) (-474.258) (-475.451) -- 0:00:40
      393500 -- (-474.164) (-475.435) [-474.789] (-477.529) * (-473.659) (-478.278) (-475.486) [-474.008] -- 0:00:40
      394000 -- (-474.433) [-474.907] (-477.741) (-475.476) * [-474.160] (-476.611) (-476.830) (-475.839) -- 0:00:39
      394500 -- (-475.470) (-476.387) (-476.491) [-476.142] * (-474.077) (-476.732) [-475.047] (-474.329) -- 0:00:39
      395000 -- [-479.519] (-479.895) (-475.408) (-482.753) * (-478.963) [-477.522] (-478.935) (-476.285) -- 0:00:39

      Average standard deviation of split frequencies: 0.013470

      395500 -- (-477.990) (-476.818) (-474.813) [-473.192] * (-475.239) [-473.689] (-473.717) (-480.036) -- 0:00:39
      396000 -- (-475.965) (-478.941) [-474.914] (-474.384) * [-476.326] (-478.382) (-474.577) (-479.245) -- 0:00:39
      396500 -- (-475.397) (-478.194) (-476.474) [-474.565] * (-477.261) [-475.250] (-473.739) (-474.153) -- 0:00:39
      397000 -- [-474.687] (-473.169) (-474.680) (-479.003) * (-478.810) [-474.737] (-473.533) (-475.511) -- 0:00:39
      397500 -- (-476.860) [-474.457] (-473.353) (-477.960) * [-473.153] (-482.573) (-476.418) (-477.735) -- 0:00:39
      398000 -- (-475.603) (-474.396) (-473.459) [-475.833] * (-474.441) (-474.995) (-477.979) [-473.905] -- 0:00:39
      398500 -- (-474.107) [-477.548] (-473.444) (-475.531) * [-474.768] (-473.875) (-475.969) (-474.451) -- 0:00:39
      399000 -- (-474.175) [-477.266] (-477.756) (-474.526) * (-474.653) [-475.574] (-477.016) (-475.045) -- 0:00:39
      399500 -- (-475.816) [-474.426] (-481.092) (-474.568) * [-475.265] (-478.021) (-478.750) (-475.842) -- 0:00:39
      400000 -- (-475.251) (-477.226) (-479.497) [-475.666] * (-474.148) [-474.316] (-478.445) (-475.241) -- 0:00:39

      Average standard deviation of split frequencies: 0.013066

      400500 -- [-474.536] (-477.221) (-480.185) (-473.622) * [-477.873] (-475.339) (-473.589) (-476.307) -- 0:00:38
      401000 -- (-475.205) (-475.837) [-476.826] (-473.513) * (-475.531) (-476.287) (-474.479) [-474.486] -- 0:00:38
      401500 -- (-475.211) (-475.635) [-475.421] (-475.262) * (-473.135) (-474.183) (-473.768) [-473.546] -- 0:00:40
      402000 -- [-474.512] (-477.214) (-475.346) (-476.656) * (-475.826) (-475.578) [-475.371] (-474.987) -- 0:00:40
      402500 -- (-474.661) (-474.607) (-475.419) [-472.940] * (-474.912) (-475.910) (-475.931) [-476.278] -- 0:00:40
      403000 -- [-474.018] (-474.069) (-476.103) (-473.698) * (-475.364) [-475.135] (-475.366) (-476.151) -- 0:00:39
      403500 -- [-476.734] (-473.737) (-476.226) (-473.652) * (-473.948) (-474.611) [-478.898] (-475.129) -- 0:00:39
      404000 -- (-476.533) [-474.178] (-475.458) (-473.683) * (-474.853) (-474.104) (-482.181) [-474.154] -- 0:00:39
      404500 -- (-475.412) (-478.760) (-474.018) [-474.399] * (-474.624) (-474.917) (-474.441) [-474.882] -- 0:00:39
      405000 -- (-474.151) (-474.174) (-475.909) [-475.296] * [-477.859] (-474.160) (-474.417) (-477.666) -- 0:00:39

      Average standard deviation of split frequencies: 0.012466

      405500 -- [-476.555] (-474.347) (-474.760) (-475.417) * (-480.443) [-474.599] (-475.199) (-477.423) -- 0:00:39
      406000 -- (-473.665) [-480.443] (-475.830) (-474.672) * [-474.223] (-475.111) (-475.977) (-474.121) -- 0:00:39
      406500 -- (-474.593) (-473.300) (-473.961) [-473.296] * (-475.527) (-478.034) [-475.959] (-478.417) -- 0:00:39
      407000 -- (-474.337) (-477.168) (-474.281) [-475.550] * [-476.490] (-476.179) (-474.857) (-475.805) -- 0:00:39
      407500 -- (-475.139) (-476.201) [-474.597] (-476.039) * [-476.834] (-474.677) (-473.664) (-476.732) -- 0:00:39
      408000 -- (-474.080) [-473.095] (-476.450) (-474.890) * [-476.074] (-475.059) (-473.650) (-475.612) -- 0:00:39
      408500 -- [-478.761] (-476.672) (-474.717) (-476.763) * [-474.997] (-473.395) (-476.166) (-475.705) -- 0:00:39
      409000 -- (-480.116) (-475.118) (-474.505) [-476.959] * (-474.223) (-476.638) [-473.470] (-473.902) -- 0:00:39
      409500 -- (-475.455) (-473.388) [-473.898] (-477.253) * (-476.586) [-474.392] (-474.584) (-475.334) -- 0:00:38
      410000 -- (-483.490) (-476.253) (-473.972) [-474.900] * [-473.558] (-474.765) (-473.926) (-475.528) -- 0:00:38

      Average standard deviation of split frequencies: 0.012687

      410500 -- (-476.708) (-474.832) [-474.705] (-475.105) * (-474.102) (-474.330) (-473.392) [-473.124] -- 0:00:38
      411000 -- (-475.327) (-474.896) [-476.952] (-476.725) * (-473.711) (-473.745) [-474.566] (-474.054) -- 0:00:38
      411500 -- (-474.918) (-474.493) [-476.453] (-475.177) * (-475.747) (-476.302) [-473.596] (-473.064) -- 0:00:38
      412000 -- [-474.618] (-479.675) (-475.628) (-476.316) * (-474.105) (-477.991) [-476.607] (-473.537) -- 0:00:38
      412500 -- (-475.094) (-481.597) [-475.264] (-474.828) * [-477.307] (-476.320) (-474.966) (-475.866) -- 0:00:38
      413000 -- (-474.696) [-477.712] (-475.054) (-475.168) * [-475.352] (-474.223) (-474.610) (-473.828) -- 0:00:38
      413500 -- [-474.077] (-474.321) (-475.835) (-476.915) * (-474.240) (-474.301) [-477.028] (-475.318) -- 0:00:38
      414000 -- (-476.979) (-473.583) (-478.062) [-475.853] * (-475.494) (-473.924) [-476.249] (-476.111) -- 0:00:38
      414500 -- (-476.272) [-473.559] (-473.471) (-473.736) * (-474.106) (-475.474) (-474.694) [-474.829] -- 0:00:38
      415000 -- (-475.165) [-475.438] (-474.919) (-475.986) * (-475.234) (-473.850) (-476.063) [-475.340] -- 0:00:38

      Average standard deviation of split frequencies: 0.012465

      415500 -- (-474.766) (-474.816) (-476.596) [-476.727] * (-474.920) [-478.426] (-475.256) (-473.823) -- 0:00:37
      416000 -- (-475.501) [-474.817] (-475.714) (-477.415) * (-477.487) (-474.240) [-474.770] (-474.566) -- 0:00:37
      416500 -- (-475.519) [-476.131] (-475.256) (-474.506) * (-477.694) (-475.735) [-474.637] (-476.665) -- 0:00:37
      417000 -- (-475.148) (-478.311) (-475.142) [-475.578] * (-477.346) (-475.199) [-473.697] (-477.346) -- 0:00:37
      417500 -- (-476.523) (-476.095) [-475.681] (-475.684) * (-475.317) (-475.430) [-475.561] (-476.129) -- 0:00:37
      418000 -- (-475.431) [-478.879] (-473.458) (-476.681) * (-479.296) (-475.534) (-474.705) [-475.359] -- 0:00:38
      418500 -- [-474.047] (-480.139) (-482.516) (-476.898) * (-475.108) (-476.601) (-474.153) [-478.100] -- 0:00:38
      419000 -- (-473.484) (-475.822) [-480.217] (-475.062) * (-475.435) (-474.592) [-477.368] (-474.755) -- 0:00:38
      419500 -- (-474.107) (-480.410) (-476.038) [-477.509] * (-474.193) (-474.106) (-483.012) [-474.452] -- 0:00:38
      420000 -- [-475.196] (-485.807) (-475.531) (-476.995) * [-475.960] (-479.325) (-479.659) (-474.784) -- 0:00:38

      Average standard deviation of split frequencies: 0.012078

      420500 -- (-475.652) (-480.291) [-475.708] (-477.979) * (-475.264) [-478.446] (-476.024) (-474.993) -- 0:00:38
      421000 -- [-473.467] (-475.684) (-479.176) (-479.146) * (-479.356) [-479.401] (-474.279) (-476.177) -- 0:00:38
      421500 -- (-475.840) (-474.690) [-476.324] (-478.686) * [-476.630] (-474.687) (-478.387) (-474.379) -- 0:00:38
      422000 -- (-477.869) (-482.260) [-475.236] (-476.996) * (-474.148) (-473.179) [-475.232] (-474.356) -- 0:00:38
      422500 -- (-474.767) (-477.228) (-474.943) [-474.901] * (-473.407) (-475.748) [-473.802] (-475.283) -- 0:00:38
      423000 -- (-474.284) [-474.262] (-475.368) (-477.781) * (-475.833) [-475.698] (-476.993) (-474.737) -- 0:00:38
      423500 -- (-474.136) (-475.305) [-477.373] (-479.433) * (-477.866) (-476.083) (-478.431) [-480.173] -- 0:00:38
      424000 -- (-475.368) (-474.882) (-477.648) [-473.759] * (-475.242) (-475.337) (-477.928) [-474.585] -- 0:00:38
      424500 -- (-473.074) (-474.746) (-474.871) [-475.940] * (-474.294) [-473.287] (-478.872) (-474.507) -- 0:00:37
      425000 -- (-473.948) (-475.365) (-474.881) [-473.632] * [-477.092] (-475.015) (-478.684) (-475.903) -- 0:00:37

      Average standard deviation of split frequencies: 0.011435

      425500 -- (-473.291) [-474.514] (-473.495) (-473.783) * [-475.968] (-476.822) (-474.011) (-474.506) -- 0:00:37
      426000 -- (-475.924) [-474.126] (-474.027) (-475.282) * (-475.398) (-474.738) (-474.970) [-473.604] -- 0:00:37
      426500 -- (-479.687) (-474.543) [-473.311] (-475.000) * (-475.178) (-479.355) [-476.888] (-475.392) -- 0:00:37
      427000 -- (-478.056) (-477.116) [-474.557] (-474.168) * [-479.749] (-474.883) (-478.030) (-473.878) -- 0:00:37
      427500 -- (-473.871) (-475.950) [-476.392] (-478.226) * (-478.580) (-479.757) (-476.474) [-477.028] -- 0:00:37
      428000 -- (-479.321) (-474.664) (-475.004) [-476.690] * (-476.353) (-474.536) [-474.409] (-476.689) -- 0:00:37
      428500 -- [-475.463] (-474.427) (-473.726) (-474.765) * (-476.825) [-472.980] (-475.173) (-473.399) -- 0:00:37
      429000 -- (-482.472) (-474.182) [-473.153] (-473.622) * (-473.475) (-473.730) [-476.113] (-473.532) -- 0:00:37
      429500 -- [-476.899] (-474.740) (-474.115) (-478.453) * (-477.026) [-476.525] (-478.869) (-478.046) -- 0:00:37
      430000 -- (-477.799) [-476.574] (-479.878) (-475.510) * (-481.363) (-475.726) [-478.712] (-474.688) -- 0:00:37

      Average standard deviation of split frequencies: 0.011432

      430500 -- (-473.533) (-479.434) [-478.209] (-474.808) * (-477.994) (-476.121) [-475.472] (-474.778) -- 0:00:37
      431000 -- (-474.898) (-473.892) (-478.097) [-478.963] * [-474.790] (-479.513) (-475.954) (-477.396) -- 0:00:36
      431500 -- [-473.683] (-473.691) (-476.397) (-478.562) * (-475.312) (-476.028) [-477.066] (-477.711) -- 0:00:36
      432000 -- (-474.194) (-474.202) [-475.617] (-476.672) * (-484.297) (-477.260) [-474.651] (-477.271) -- 0:00:36
      432500 -- (-473.740) (-474.343) (-476.673) [-475.209] * (-474.800) [-475.125] (-475.603) (-475.302) -- 0:00:36
      433000 -- (-477.089) (-475.945) (-478.634) [-478.158] * (-473.962) [-474.977] (-474.259) (-478.992) -- 0:00:36
      433500 -- [-474.219] (-474.821) (-473.695) (-478.619) * [-476.197] (-475.583) (-474.405) (-473.456) -- 0:00:36
      434000 -- (-474.653) [-474.574] (-473.876) (-476.089) * (-474.582) (-477.231) (-473.936) [-473.102] -- 0:00:36
      434500 -- (-478.094) (-476.135) [-477.228] (-480.873) * (-475.038) [-473.239] (-473.861) (-474.317) -- 0:00:37
      435000 -- (-479.112) [-477.195] (-473.558) (-473.962) * (-474.492) [-475.425] (-474.617) (-474.872) -- 0:00:37

      Average standard deviation of split frequencies: 0.012013

      435500 -- [-475.179] (-476.920) (-476.968) (-474.560) * [-476.280] (-477.417) (-475.115) (-475.516) -- 0:00:37
      436000 -- (-474.734) (-476.547) (-475.471) [-474.681] * [-474.305] (-477.078) (-475.318) (-474.355) -- 0:00:37
      436500 -- [-475.376] (-476.403) (-476.884) (-475.582) * (-476.548) [-475.025] (-475.024) (-472.863) -- 0:00:37
      437000 -- [-475.381] (-477.165) (-475.932) (-473.516) * (-474.554) [-474.087] (-476.493) (-475.632) -- 0:00:37
      437500 -- (-476.121) (-477.941) [-474.808] (-473.399) * [-476.001] (-476.187) (-474.624) (-476.756) -- 0:00:37
      438000 -- (-478.312) (-479.307) (-473.418) [-476.092] * [-475.150] (-476.641) (-475.975) (-476.479) -- 0:00:37
      438500 -- (-477.410) (-475.086) (-473.984) [-477.254] * (-473.129) (-474.806) [-475.351] (-474.433) -- 0:00:37
      439000 -- (-476.958) (-473.241) [-474.669] (-473.976) * (-473.518) (-473.986) (-475.691) [-474.648] -- 0:00:37
      439500 -- (-475.676) (-482.105) [-473.223] (-475.514) * [-474.352] (-474.453) (-475.701) (-476.868) -- 0:00:36
      440000 -- (-475.825) [-474.486] (-474.674) (-476.361) * (-476.427) (-474.699) (-475.041) [-477.497] -- 0:00:36

      Average standard deviation of split frequencies: 0.012480

      440500 -- (-475.511) [-475.932] (-474.969) (-480.810) * (-477.133) (-474.869) [-479.530] (-474.146) -- 0:00:36
      441000 -- [-477.793] (-476.730) (-475.243) (-474.582) * (-476.526) [-472.977] (-476.450) (-473.357) -- 0:00:36
      441500 -- (-475.199) [-474.208] (-474.247) (-474.978) * (-476.870) (-474.724) [-475.445] (-473.956) -- 0:00:36
      442000 -- (-476.522) (-473.635) (-473.934) [-479.000] * [-476.494] (-478.592) (-478.633) (-473.386) -- 0:00:36
      442500 -- (-477.090) (-479.502) (-473.472) [-478.032] * (-473.498) (-474.746) (-475.364) [-474.606] -- 0:00:36
      443000 -- [-476.365] (-473.873) (-476.138) (-473.939) * (-473.645) (-475.823) (-474.624) [-475.577] -- 0:00:36
      443500 -- (-473.142) [-478.269] (-475.534) (-475.094) * (-477.255) [-475.250] (-473.344) (-479.675) -- 0:00:36
      444000 -- (-473.293) (-474.979) (-475.313) [-475.295] * [-475.224] (-475.844) (-477.535) (-474.553) -- 0:00:36
      444500 -- (-474.409) (-479.356) [-475.273] (-476.124) * (-473.695) [-475.478] (-477.747) (-475.403) -- 0:00:36
      445000 -- (-475.437) (-478.346) (-475.311) [-473.982] * [-473.793] (-477.404) (-475.189) (-474.419) -- 0:00:36

      Average standard deviation of split frequencies: 0.012625

      445500 -- (-474.669) (-474.519) (-476.461) [-475.840] * (-475.972) [-474.708] (-473.929) (-475.973) -- 0:00:36
      446000 -- (-475.474) [-473.820] (-475.743) (-473.432) * (-478.263) (-475.164) [-476.121] (-476.773) -- 0:00:36
      446500 -- (-479.052) (-476.953) [-475.180] (-479.775) * (-475.209) (-473.376) (-478.570) [-476.604] -- 0:00:35
      447000 -- (-477.454) (-480.165) [-473.531] (-475.880) * [-474.095] (-475.288) (-475.846) (-474.601) -- 0:00:35
      447500 -- (-476.113) (-475.530) (-477.365) [-474.343] * (-478.144) (-474.273) [-474.705] (-473.887) -- 0:00:35
      448000 -- (-477.642) [-475.937] (-477.559) (-474.614) * (-474.928) (-480.709) [-477.552] (-474.909) -- 0:00:35
      448500 -- (-473.892) (-477.487) (-479.741) [-473.120] * (-476.204) (-475.359) (-475.231) [-475.524] -- 0:00:35
      449000 -- (-473.556) (-473.922) (-475.480) [-475.280] * (-474.073) (-476.982) (-474.514) [-474.014] -- 0:00:35
      449500 -- (-480.488) (-477.160) (-477.115) [-476.947] * (-477.299) (-477.380) (-473.868) [-474.186] -- 0:00:35
      450000 -- (-475.531) (-474.369) (-474.242) [-479.752] * (-475.343) [-474.289] (-473.688) (-476.847) -- 0:00:35

      Average standard deviation of split frequencies: 0.012494

      450500 -- (-473.520) (-476.988) [-473.447] (-477.510) * [-480.139] (-476.911) (-476.300) (-476.667) -- 0:00:35
      451000 -- (-473.340) [-477.091] (-477.060) (-476.117) * [-475.069] (-474.129) (-475.451) (-475.874) -- 0:00:36
      451500 -- [-474.530] (-474.516) (-477.446) (-474.188) * [-474.953] (-474.299) (-477.225) (-474.562) -- 0:00:36
      452000 -- [-474.761] (-476.621) (-475.260) (-478.542) * (-475.660) [-475.322] (-475.354) (-474.954) -- 0:00:36
      452500 -- [-475.773] (-475.632) (-474.042) (-477.254) * (-473.791) [-475.621] (-476.679) (-473.551) -- 0:00:36
      453000 -- (-476.193) (-473.883) [-479.693] (-475.646) * (-477.247) (-476.173) [-474.766] (-476.276) -- 0:00:36
      453500 -- (-478.125) (-476.735) (-473.731) [-476.257] * (-474.574) (-473.801) [-477.197] (-476.135) -- 0:00:36
      454000 -- (-476.296) (-475.635) [-473.605] (-475.454) * (-478.150) (-473.658) [-474.978] (-475.147) -- 0:00:36
      454500 -- (-476.556) [-475.298] (-476.134) (-473.576) * (-476.970) (-473.722) (-476.569) [-475.905] -- 0:00:36
      455000 -- (-475.802) [-478.071] (-473.580) (-473.809) * (-474.485) [-474.232] (-475.058) (-474.129) -- 0:00:35

      Average standard deviation of split frequencies: 0.011601

      455500 -- (-475.465) [-478.134] (-475.083) (-476.429) * (-478.116) (-478.957) [-473.434] (-474.504) -- 0:00:35
      456000 -- (-474.598) (-475.715) [-476.633] (-473.483) * [-475.198] (-480.792) (-473.656) (-474.383) -- 0:00:35
      456500 -- [-474.744] (-476.322) (-474.020) (-481.393) * (-478.414) (-473.421) [-474.501] (-475.287) -- 0:00:35
      457000 -- (-475.735) [-474.212] (-477.334) (-477.874) * (-478.075) (-474.711) (-474.346) [-477.469] -- 0:00:35
      457500 -- (-475.422) (-474.701) [-475.554] (-477.572) * (-473.048) (-475.770) (-478.390) [-477.104] -- 0:00:35
      458000 -- [-479.931] (-475.049) (-473.060) (-478.864) * [-476.227] (-475.633) (-476.521) (-476.783) -- 0:00:35
      458500 -- (-478.108) [-476.619] (-477.092) (-482.406) * (-474.970) [-474.663] (-478.890) (-474.138) -- 0:00:35
      459000 -- (-478.205) [-473.785] (-480.334) (-475.632) * (-474.030) [-475.710] (-474.693) (-474.649) -- 0:00:35
      459500 -- [-476.550] (-474.977) (-479.473) (-474.648) * (-474.401) (-479.571) (-474.418) [-473.987] -- 0:00:35
      460000 -- (-478.074) [-474.102] (-478.165) (-474.651) * (-474.750) [-475.137] (-478.110) (-474.301) -- 0:00:35

      Average standard deviation of split frequencies: 0.012507

      460500 -- (-477.918) (-474.628) (-474.705) [-475.008] * [-476.100] (-476.099) (-476.460) (-475.035) -- 0:00:35
      461000 -- (-474.300) [-474.749] (-476.582) (-477.441) * (-475.720) (-480.983) (-476.286) [-479.743] -- 0:00:35
      461500 -- (-474.823) (-474.274) [-473.352] (-477.761) * [-476.745] (-477.007) (-473.555) (-475.688) -- 0:00:35
      462000 -- (-477.082) (-477.205) [-476.619] (-474.151) * (-475.589) [-475.870] (-474.389) (-474.486) -- 0:00:34
      462500 -- [-474.088] (-474.992) (-476.012) (-475.979) * (-474.624) (-473.598) [-477.791] (-477.329) -- 0:00:34
      463000 -- (-475.113) [-477.771] (-477.088) (-473.621) * (-475.493) (-473.627) (-477.022) [-474.968] -- 0:00:34
      463500 -- (-478.533) [-477.380] (-475.603) (-475.150) * (-480.246) (-474.342) (-474.317) [-474.990] -- 0:00:34
      464000 -- (-476.034) (-473.251) (-474.154) [-475.362] * (-477.662) (-474.097) [-477.059] (-477.717) -- 0:00:34
      464500 -- (-473.397) [-473.502] (-477.951) (-475.588) * (-477.015) (-473.819) [-474.785] (-480.330) -- 0:00:34
      465000 -- [-474.814] (-473.502) (-476.005) (-475.229) * (-475.171) (-474.353) (-474.825) [-477.008] -- 0:00:34

      Average standard deviation of split frequencies: 0.012870

      465500 -- (-475.805) (-473.035) [-474.345] (-477.467) * [-473.072] (-474.688) (-475.990) (-479.223) -- 0:00:34
      466000 -- (-476.063) (-473.997) [-475.428] (-480.431) * (-474.658) (-477.326) [-476.394] (-475.626) -- 0:00:34
      466500 -- (-477.814) [-475.970] (-473.286) (-479.080) * (-476.305) (-480.065) (-475.947) [-474.019] -- 0:00:34
      467000 -- (-475.525) [-475.864] (-473.823) (-476.330) * [-474.949] (-480.449) (-478.144) (-474.745) -- 0:00:34
      467500 -- (-477.953) [-478.135] (-477.521) (-473.357) * (-475.470) (-478.846) [-476.241] (-475.829) -- 0:00:34
      468000 -- (-480.025) [-478.054] (-475.195) (-477.403) * (-474.755) (-473.465) (-476.757) [-475.721] -- 0:00:35
      468500 -- [-474.988] (-477.950) (-477.023) (-473.929) * (-478.611) (-474.676) (-473.626) [-475.829] -- 0:00:35
      469000 -- [-476.666] (-474.854) (-478.046) (-475.331) * [-474.618] (-476.280) (-476.767) (-478.439) -- 0:00:35
      469500 -- (-475.978) (-476.751) [-476.785] (-475.521) * (-474.999) [-474.100] (-481.494) (-478.103) -- 0:00:35
      470000 -- (-476.451) [-473.721] (-473.505) (-475.579) * (-475.076) [-474.245] (-476.882) (-478.095) -- 0:00:34

      Average standard deviation of split frequencies: 0.012078

      470500 -- (-477.885) (-476.628) [-474.179] (-473.139) * [-475.190] (-473.831) (-482.300) (-475.784) -- 0:00:34
      471000 -- [-474.792] (-476.352) (-474.274) (-474.264) * [-474.459] (-476.702) (-473.978) (-478.753) -- 0:00:34
      471500 -- (-476.028) [-472.960] (-475.910) (-474.695) * [-479.851] (-475.900) (-475.446) (-479.197) -- 0:00:34
      472000 -- (-474.545) [-475.229] (-477.811) (-480.867) * [-475.643] (-474.960) (-474.187) (-474.716) -- 0:00:34
      472500 -- (-475.020) [-474.343] (-474.233) (-477.502) * (-481.629) (-474.862) (-477.655) [-475.106] -- 0:00:34
      473000 -- [-475.056] (-473.810) (-474.738) (-480.575) * (-476.834) [-473.866] (-476.728) (-475.644) -- 0:00:34
      473500 -- [-476.993] (-474.910) (-474.276) (-476.114) * (-476.013) (-475.703) [-474.650] (-478.661) -- 0:00:34
      474000 -- (-474.357) (-477.295) (-476.123) [-476.315] * (-474.024) (-477.444) (-480.556) [-475.490] -- 0:00:34
      474500 -- (-475.576) [-476.597] (-475.105) (-477.489) * [-474.935] (-477.711) (-476.076) (-474.241) -- 0:00:34
      475000 -- (-474.074) (-474.195) [-475.738] (-477.456) * (-475.293) [-474.824] (-474.343) (-475.019) -- 0:00:34

      Average standard deviation of split frequencies: 0.011651

      475500 -- (-474.371) (-477.729) [-475.000] (-476.078) * [-478.843] (-475.413) (-478.627) (-473.653) -- 0:00:34
      476000 -- [-477.207] (-482.397) (-475.212) (-478.143) * [-476.450] (-483.375) (-479.268) (-476.427) -- 0:00:34
      476500 -- [-475.408] (-473.630) (-474.798) (-474.821) * (-477.158) (-473.785) (-475.643) [-475.098] -- 0:00:34
      477000 -- (-478.595) [-474.290] (-477.047) (-477.361) * [-476.355] (-473.689) (-476.646) (-476.867) -- 0:00:33
      477500 -- (-478.221) (-473.387) [-479.897] (-477.837) * (-473.874) (-476.210) [-473.539] (-477.948) -- 0:00:33
      478000 -- (-476.070) (-476.247) [-473.624] (-473.843) * (-475.029) [-477.664] (-478.502) (-473.860) -- 0:00:33
      478500 -- [-478.940] (-476.624) (-474.322) (-474.973) * (-474.802) (-475.540) (-474.518) [-473.955] -- 0:00:33
      479000 -- (-477.939) (-474.745) (-476.029) [-478.614] * (-475.470) (-475.816) [-474.893] (-474.327) -- 0:00:33
      479500 -- (-482.603) [-473.428] (-473.458) (-478.770) * (-475.588) (-480.996) (-476.201) [-474.605] -- 0:00:33
      480000 -- (-480.479) (-476.125) (-474.601) [-475.784] * (-473.627) (-479.346) [-474.905] (-479.876) -- 0:00:33

      Average standard deviation of split frequencies: 0.011019

      480500 -- (-476.627) (-477.526) [-473.855] (-475.920) * (-480.777) (-475.419) [-474.052] (-478.675) -- 0:00:33
      481000 -- (-475.700) (-473.755) (-477.226) [-474.157] * [-476.449] (-474.080) (-475.904) (-476.906) -- 0:00:33
      481500 -- (-479.422) (-474.993) (-473.456) [-474.487] * (-474.387) (-474.148) (-473.702) [-474.463] -- 0:00:33
      482000 -- (-477.720) (-475.848) (-473.548) [-474.267] * (-475.330) [-474.768] (-476.327) (-479.543) -- 0:00:33
      482500 -- (-477.798) [-476.564] (-474.248) (-473.303) * (-473.135) (-476.144) (-480.986) [-477.180] -- 0:00:33
      483000 -- (-477.726) [-474.115] (-477.832) (-473.558) * (-481.705) (-476.037) (-477.487) [-475.172] -- 0:00:33
      483500 -- (-475.079) [-473.707] (-474.233) (-475.287) * (-475.831) (-474.590) [-474.160] (-477.940) -- 0:00:33
      484000 -- (-473.387) (-476.031) (-475.773) [-476.793] * [-474.273] (-475.419) (-474.537) (-474.669) -- 0:00:33
      484500 -- (-475.974) (-478.140) (-476.758) [-477.041] * [-473.227] (-475.351) (-474.331) (-474.126) -- 0:00:32
      485000 -- [-473.561] (-474.701) (-477.263) (-475.321) * (-474.740) (-474.613) [-474.683] (-474.279) -- 0:00:33

      Average standard deviation of split frequencies: 0.011126

      485500 -- (-473.885) [-474.592] (-473.634) (-476.590) * (-474.038) [-475.663] (-476.556) (-476.504) -- 0:00:33
      486000 -- [-474.424] (-473.493) (-474.122) (-476.409) * (-475.430) (-477.131) [-474.151] (-476.030) -- 0:00:33
      486500 -- [-473.111] (-475.733) (-475.237) (-474.698) * (-475.528) (-474.768) [-473.977] (-474.998) -- 0:00:33
      487000 -- (-474.333) [-474.631] (-476.979) (-474.110) * [-474.979] (-477.793) (-476.214) (-476.003) -- 0:00:33
      487500 -- (-473.122) [-473.701] (-475.577) (-477.247) * (-474.147) [-476.496] (-474.478) (-474.943) -- 0:00:33
      488000 -- (-474.350) (-476.680) [-474.218] (-475.218) * (-487.155) [-474.489] (-473.573) (-473.297) -- 0:00:33
      488500 -- (-478.959) (-475.088) (-475.623) [-476.391] * (-477.356) [-474.674] (-477.763) (-474.529) -- 0:00:33
      489000 -- (-478.165) [-474.792] (-474.331) (-478.545) * (-480.730) (-474.875) (-475.848) [-475.587] -- 0:00:33
      489500 -- (-478.755) [-475.027] (-475.644) (-479.027) * (-478.666) [-475.168] (-476.761) (-475.786) -- 0:00:33
      490000 -- (-477.199) [-475.940] (-474.570) (-473.160) * (-479.519) (-476.147) (-477.202) [-475.065] -- 0:00:33

      Average standard deviation of split frequencies: 0.011303

      490500 -- (-477.422) [-474.639] (-473.889) (-481.418) * (-473.596) [-474.990] (-478.548) (-478.308) -- 0:00:33
      491000 -- [-475.803] (-475.498) (-473.682) (-475.444) * (-474.414) (-474.014) (-473.881) [-476.424] -- 0:00:33
      491500 -- [-474.648] (-475.666) (-476.565) (-477.122) * (-475.736) [-475.612] (-478.492) (-486.904) -- 0:00:33
      492000 -- (-474.829) (-477.938) (-474.690) [-474.510] * (-476.001) [-473.616] (-475.252) (-475.762) -- 0:00:33
      492500 -- (-474.746) (-474.094) (-475.976) [-474.816] * (-474.613) (-473.961) [-476.069] (-473.636) -- 0:00:32
      493000 -- (-474.188) [-473.658] (-476.354) (-476.488) * [-474.302] (-473.653) (-473.449) (-474.524) -- 0:00:32
      493500 -- [-474.733] (-473.490) (-477.269) (-475.784) * (-474.811) (-476.694) [-474.739] (-474.665) -- 0:00:32
      494000 -- (-474.277) (-475.209) (-474.545) [-473.177] * [-474.285] (-477.005) (-477.157) (-477.839) -- 0:00:32
      494500 -- (-474.174) [-482.652] (-476.579) (-475.809) * (-477.110) (-479.879) [-475.262] (-475.390) -- 0:00:32
      495000 -- (-475.890) (-478.568) (-475.170) [-475.209] * (-474.913) [-476.254] (-480.960) (-477.425) -- 0:00:32

      Average standard deviation of split frequencies: 0.011237

      495500 -- (-475.165) (-478.881) (-475.326) [-475.437] * [-474.537] (-475.008) (-476.701) (-476.303) -- 0:00:32
      496000 -- (-475.349) [-475.495] (-475.464) (-474.802) * (-474.595) (-484.173) [-476.105] (-474.945) -- 0:00:32
      496500 -- (-474.713) (-474.305) (-474.035) [-475.177] * (-473.599) (-477.522) (-477.312) [-477.673] -- 0:00:32
      497000 -- (-476.218) (-478.896) (-474.431) [-474.248] * [-476.094] (-479.536) (-476.282) (-477.950) -- 0:00:32
      497500 -- [-480.221] (-476.747) (-477.157) (-479.771) * [-474.295] (-481.816) (-476.084) (-476.160) -- 0:00:32
      498000 -- (-482.912) (-474.482) (-475.139) [-478.823] * (-472.996) (-474.076) (-475.217) [-475.134] -- 0:00:32
      498500 -- (-473.919) (-478.463) [-475.513] (-473.742) * [-473.351] (-473.780) (-475.830) (-477.194) -- 0:00:32
      499000 -- (-474.216) (-476.868) (-473.807) [-474.586] * (-473.397) (-474.162) (-477.573) [-474.455] -- 0:00:32
      499500 -- [-474.812] (-475.431) (-475.148) (-476.429) * (-473.650) (-474.277) [-474.098] (-476.236) -- 0:00:32
      500000 -- (-474.476) [-474.469] (-477.652) (-474.038) * (-473.147) [-474.914] (-473.031) (-477.546) -- 0:00:32

      Average standard deviation of split frequencies: 0.011077

      500500 -- (-475.804) (-475.337) [-479.128] (-473.443) * [-474.630] (-474.686) (-478.964) (-473.607) -- 0:00:31
      501000 -- (-479.990) (-474.393) (-474.392) [-475.534] * (-475.530) [-475.429] (-475.033) (-475.163) -- 0:00:31
      501500 -- (-480.043) (-474.142) [-475.209] (-476.280) * [-477.727] (-474.349) (-473.363) (-475.578) -- 0:00:31
      502000 -- [-478.505] (-473.428) (-477.677) (-476.802) * (-475.178) (-474.919) (-472.993) [-474.512] -- 0:00:32
      502500 -- (-476.432) [-475.108] (-476.159) (-477.351) * (-479.395) [-474.764] (-473.543) (-474.123) -- 0:00:32
      503000 -- (-478.291) (-476.253) [-475.949] (-475.726) * (-476.680) (-474.439) (-474.432) [-474.315] -- 0:00:32
      503500 -- (-476.590) [-474.865] (-475.962) (-473.688) * (-476.091) (-474.632) [-474.960] (-477.184) -- 0:00:32
      504000 -- [-475.115] (-476.770) (-473.419) (-473.571) * (-476.569) (-473.977) [-475.195] (-474.163) -- 0:00:32
      504500 -- (-479.332) [-477.554] (-477.932) (-474.000) * (-476.272) [-475.987] (-475.148) (-474.431) -- 0:00:32
      505000 -- (-476.360) [-475.753] (-476.753) (-475.282) * (-473.540) [-473.741] (-473.838) (-478.423) -- 0:00:32

      Average standard deviation of split frequencies: 0.010851

      505500 -- [-475.460] (-475.565) (-476.317) (-473.549) * [-473.599] (-474.927) (-475.940) (-475.198) -- 0:00:32
      506000 -- (-475.087) (-479.461) [-476.562] (-474.086) * (-476.149) (-477.060) (-474.851) [-474.627] -- 0:00:32
      506500 -- (-475.327) (-475.663) [-476.438] (-473.764) * (-477.492) (-476.632) [-474.236] (-479.716) -- 0:00:32
      507000 -- (-477.074) (-478.740) [-474.347] (-476.000) * [-474.750] (-473.729) (-475.962) (-477.006) -- 0:00:32
      507500 -- [-474.995] (-475.908) (-473.659) (-476.779) * (-477.907) (-477.478) (-476.357) [-476.401] -- 0:00:32
      508000 -- [-475.864] (-478.024) (-474.115) (-474.936) * (-479.875) [-473.298] (-475.708) (-473.539) -- 0:00:31
      508500 -- (-474.843) (-474.787) [-474.197] (-474.874) * (-476.503) (-475.290) [-473.453] (-478.075) -- 0:00:31
      509000 -- [-474.268] (-473.823) (-474.516) (-473.705) * (-476.151) [-473.973] (-478.501) (-477.462) -- 0:00:31
      509500 -- (-475.585) (-474.187) (-476.442) [-476.841] * (-474.768) [-474.250] (-476.318) (-477.294) -- 0:00:31
      510000 -- (-475.474) [-477.615] (-475.335) (-473.365) * (-474.603) (-485.243) (-475.063) [-475.071] -- 0:00:31

      Average standard deviation of split frequencies: 0.010317

      510500 -- (-473.605) [-474.209] (-474.138) (-473.218) * (-475.117) [-476.649] (-475.776) (-475.888) -- 0:00:31
      511000 -- (-473.664) (-475.033) (-475.111) [-475.141] * [-475.749] (-473.509) (-480.066) (-477.111) -- 0:00:31
      511500 -- [-475.849] (-473.128) (-476.327) (-476.742) * (-476.609) (-476.895) (-476.170) [-475.312] -- 0:00:31
      512000 -- (-475.191) (-473.296) [-474.918] (-474.421) * [-473.758] (-477.197) (-474.200) (-477.185) -- 0:00:31
      512500 -- (-476.155) (-474.469) (-477.590) [-474.576] * (-474.499) (-477.611) (-474.587) [-474.457] -- 0:00:31
      513000 -- [-474.226] (-475.846) (-477.566) (-473.926) * (-474.771) [-477.640] (-473.618) (-474.954) -- 0:00:31
      513500 -- (-476.861) (-474.252) [-480.441] (-474.470) * (-474.938) (-476.830) (-474.871) [-474.124] -- 0:00:31
      514000 -- [-474.197] (-478.565) (-476.431) (-478.255) * (-473.943) (-475.524) [-473.897] (-481.290) -- 0:00:31
      514500 -- (-474.623) (-475.883) (-476.307) [-474.899] * (-476.850) (-476.849) [-473.983] (-475.446) -- 0:00:31
      515000 -- [-473.548] (-473.743) (-477.280) (-475.136) * [-476.977] (-473.807) (-476.813) (-476.339) -- 0:00:31

      Average standard deviation of split frequencies: 0.009996

      515500 -- (-476.757) (-473.715) (-477.680) [-474.792] * (-475.856) [-480.344] (-477.326) (-476.857) -- 0:00:31
      516000 -- (-475.070) (-473.222) (-474.975) [-475.658] * (-475.214) (-476.488) [-474.941] (-476.107) -- 0:00:30
      516500 -- [-473.557] (-475.926) (-476.153) (-474.055) * (-475.797) [-477.251] (-475.349) (-474.567) -- 0:00:30
      517000 -- (-475.048) (-479.145) (-473.559) [-473.847] * (-476.151) [-478.986] (-476.811) (-474.660) -- 0:00:30
      517500 -- [-477.410] (-473.939) (-474.447) (-474.654) * [-476.245] (-473.929) (-474.074) (-477.371) -- 0:00:30
      518000 -- (-473.485) (-475.251) (-474.909) [-474.706] * (-476.964) (-474.366) [-474.775] (-474.726) -- 0:00:30
      518500 -- [-474.374] (-473.942) (-474.335) (-474.255) * (-474.451) (-476.269) (-474.989) [-474.709] -- 0:00:31
      519000 -- (-473.998) (-478.012) (-474.526) [-474.264] * (-476.261) [-474.734] (-476.049) (-475.887) -- 0:00:31
      519500 -- (-475.112) [-475.495] (-473.786) (-473.692) * (-477.031) (-474.335) (-474.256) [-474.635] -- 0:00:31
      520000 -- (-474.669) [-481.416] (-473.674) (-476.781) * (-476.390) (-474.426) (-478.286) [-476.114] -- 0:00:31

      Average standard deviation of split frequencies: 0.010439

      520500 -- [-474.219] (-478.475) (-476.366) (-475.253) * [-475.590] (-473.973) (-477.947) (-475.866) -- 0:00:31
      521000 -- (-475.559) (-473.738) (-474.045) [-474.217] * (-477.080) (-474.548) (-475.720) [-474.611] -- 0:00:31
      521500 -- (-475.334) [-476.499] (-476.029) (-476.020) * [-474.404] (-474.691) (-480.295) (-473.331) -- 0:00:31
      522000 -- (-474.194) (-474.644) (-478.371) [-475.681] * (-475.657) (-474.816) (-476.159) [-473.926] -- 0:00:31
      522500 -- [-480.559] (-475.448) (-477.430) (-474.484) * (-477.942) (-476.890) [-476.172] (-476.044) -- 0:00:31
      523000 -- (-476.991) (-482.083) [-477.627] (-477.204) * (-474.474) (-475.479) [-473.625] (-475.208) -- 0:00:31
      523500 -- [-475.653] (-476.204) (-478.193) (-480.886) * (-474.380) (-476.382) (-474.835) [-474.182] -- 0:00:30
      524000 -- (-473.653) (-473.718) [-475.378] (-480.034) * (-478.318) (-475.544) [-474.507] (-475.235) -- 0:00:30
      524500 -- (-473.142) (-474.349) [-476.623] (-479.133) * (-474.850) (-477.592) (-479.566) [-476.233] -- 0:00:30
      525000 -- (-473.550) (-475.050) [-473.311] (-481.265) * (-476.569) (-473.719) [-473.561] (-475.048) -- 0:00:30

      Average standard deviation of split frequencies: 0.010069

      525500 -- (-479.075) (-474.553) (-474.467) [-474.714] * (-477.014) (-477.410) [-474.034] (-476.214) -- 0:00:30
      526000 -- [-475.653] (-473.247) (-475.326) (-475.438) * (-475.188) (-478.507) [-476.764] (-474.864) -- 0:00:30
      526500 -- (-480.756) (-474.024) (-474.757) [-475.769] * (-475.995) [-475.200] (-473.936) (-476.010) -- 0:00:30
      527000 -- (-479.865) (-475.582) (-476.104) [-474.606] * (-474.558) [-474.027] (-474.777) (-476.131) -- 0:00:30
      527500 -- [-477.196] (-475.934) (-473.817) (-474.131) * (-475.377) (-473.660) (-474.932) [-475.560] -- 0:00:30
      528000 -- [-475.167] (-474.625) (-475.988) (-475.321) * [-474.787] (-473.774) (-473.955) (-476.613) -- 0:00:30
      528500 -- (-474.852) [-473.420] (-479.670) (-474.825) * [-477.283] (-476.369) (-477.968) (-477.181) -- 0:00:30
      529000 -- [-475.063] (-474.367) (-479.809) (-475.008) * (-478.352) [-475.083] (-477.929) (-475.116) -- 0:00:30
      529500 -- (-473.339) (-475.928) (-476.112) [-474.304] * (-476.200) (-476.255) (-481.359) [-476.293] -- 0:00:30
      530000 -- (-473.263) [-473.186] (-475.364) (-474.461) * (-473.593) [-474.668] (-480.088) (-476.720) -- 0:00:30

      Average standard deviation of split frequencies: 0.010826

      530500 -- (-474.706) (-475.604) (-478.177) [-474.391] * (-473.941) (-476.457) [-473.673] (-480.045) -- 0:00:30
      531000 -- (-477.584) (-474.174) (-478.601) [-477.193] * (-473.103) [-477.447] (-477.856) (-476.897) -- 0:00:30
      531500 -- (-477.920) [-473.872] (-476.755) (-474.611) * (-477.666) [-475.069] (-473.977) (-476.154) -- 0:00:29
      532000 -- (-474.004) (-475.185) [-475.675] (-473.290) * (-474.983) [-473.692] (-473.774) (-474.227) -- 0:00:29
      532500 -- [-473.675] (-475.763) (-475.550) (-473.796) * (-475.653) [-475.516] (-475.509) (-474.390) -- 0:00:29
      533000 -- (-475.072) (-477.487) (-475.895) [-473.943] * (-475.006) (-475.542) [-477.078] (-473.933) -- 0:00:29
      533500 -- (-474.071) [-474.335] (-477.054) (-474.997) * (-475.465) (-478.792) (-474.504) [-474.739] -- 0:00:29
      534000 -- [-474.198] (-475.152) (-474.633) (-473.413) * (-475.928) (-480.413) [-473.353] (-474.066) -- 0:00:29
      534500 -- (-473.108) (-473.788) [-474.240] (-479.995) * (-475.370) (-473.928) (-478.334) [-474.765] -- 0:00:29
      535000 -- (-473.385) [-473.680] (-473.201) (-476.126) * (-475.823) (-480.335) (-475.986) [-476.498] -- 0:00:29

      Average standard deviation of split frequencies: 0.010554

      535500 -- [-474.563] (-474.013) (-474.087) (-476.899) * (-475.800) [-473.901] (-473.492) (-473.520) -- 0:00:30
      536000 -- (-476.045) (-474.327) (-476.839) [-475.585] * (-479.591) [-473.841] (-476.879) (-476.807) -- 0:00:30
      536500 -- (-474.140) [-474.691] (-475.645) (-476.635) * (-476.781) [-473.457] (-474.940) (-475.573) -- 0:00:30
      537000 -- [-475.566] (-477.430) (-474.634) (-482.052) * (-475.949) (-476.725) (-475.043) [-473.492] -- 0:00:30
      537500 -- [-473.523] (-477.570) (-474.581) (-476.141) * (-478.659) (-473.819) [-475.729] (-474.261) -- 0:00:30
      538000 -- (-475.572) (-475.459) [-475.221] (-479.722) * (-475.631) (-475.181) [-475.726] (-474.947) -- 0:00:30
      538500 -- (-474.441) [-475.090] (-478.227) (-475.596) * (-473.728) (-473.901) (-473.753) [-476.519] -- 0:00:29
      539000 -- (-479.510) (-476.756) [-473.575] (-475.633) * (-473.049) [-474.446] (-475.038) (-474.561) -- 0:00:29
      539500 -- [-475.364] (-474.333) (-474.812) (-478.294) * (-473.049) (-474.047) (-473.181) [-477.447] -- 0:00:29
      540000 -- (-477.865) (-476.956) (-474.563) [-474.593] * [-474.707] (-475.399) (-475.868) (-477.183) -- 0:00:29

      Average standard deviation of split frequencies: 0.010408

      540500 -- (-474.187) (-477.606) [-473.337] (-477.499) * [-474.556] (-474.073) (-476.403) (-474.320) -- 0:00:29
      541000 -- (-474.669) (-474.446) [-474.833] (-474.986) * (-474.631) (-476.154) [-476.429] (-475.319) -- 0:00:29
      541500 -- (-474.467) [-474.794] (-476.143) (-479.212) * (-475.163) (-473.078) (-476.936) [-477.427] -- 0:00:29
      542000 -- (-475.296) (-474.150) (-474.971) [-475.035] * (-475.294) (-475.499) (-473.221) [-473.757] -- 0:00:29
      542500 -- (-475.141) (-474.254) (-473.171) [-474.421] * (-474.249) (-473.805) [-476.067] (-475.170) -- 0:00:29
      543000 -- (-477.029) (-477.203) [-475.930] (-475.808) * [-474.307] (-473.706) (-479.105) (-473.653) -- 0:00:29
      543500 -- (-473.424) (-473.880) [-474.359] (-475.915) * (-474.414) (-473.920) [-476.272] (-474.678) -- 0:00:29
      544000 -- (-473.433) (-474.836) (-474.299) [-476.449] * [-474.686] (-475.510) (-473.988) (-474.816) -- 0:00:29
      544500 -- (-476.544) (-477.132) (-475.292) [-473.419] * (-475.963) (-475.546) (-476.820) [-473.278] -- 0:00:29
      545000 -- [-473.601] (-475.064) (-474.830) (-473.375) * (-476.827) (-475.731) [-476.063] (-474.879) -- 0:00:29

      Average standard deviation of split frequencies: 0.010145

      545500 -- (-474.269) (-476.275) [-476.108] (-481.371) * (-476.728) [-476.307] (-474.829) (-473.603) -- 0:00:29
      546000 -- (-477.418) [-473.416] (-477.005) (-474.487) * (-474.550) (-476.452) (-475.047) [-474.257] -- 0:00:29
      546500 -- (-478.162) (-473.938) [-477.493] (-476.304) * (-474.903) (-479.633) (-475.369) [-474.783] -- 0:00:29
      547000 -- [-474.592] (-475.441) (-476.052) (-477.708) * (-474.683) (-477.101) (-473.777) [-475.108] -- 0:00:28
      547500 -- (-475.310) [-475.777] (-475.863) (-476.128) * (-474.230) (-476.035) [-474.935] (-474.281) -- 0:00:28
      548000 -- (-475.062) (-475.357) (-477.132) [-473.192] * (-474.560) (-475.548) (-475.711) [-475.371] -- 0:00:28
      548500 -- [-473.463] (-476.347) (-475.521) (-474.574) * (-475.175) [-475.259] (-477.587) (-475.384) -- 0:00:28
      549000 -- (-473.243) (-481.475) [-474.648] (-474.114) * (-477.153) [-473.351] (-475.881) (-473.877) -- 0:00:28
      549500 -- (-473.805) (-476.435) [-474.765] (-478.984) * [-476.515] (-475.683) (-474.059) (-476.244) -- 0:00:28
      550000 -- [-474.383] (-476.175) (-474.838) (-477.216) * (-477.884) (-476.985) (-476.643) [-475.044] -- 0:00:28

      Average standard deviation of split frequencies: 0.009517

      550500 -- (-474.578) (-475.030) (-476.173) [-476.249] * (-475.207) (-479.136) [-476.423] (-474.867) -- 0:00:28
      551000 -- (-477.339) [-474.526] (-473.290) (-475.876) * (-474.178) [-475.999] (-478.860) (-474.163) -- 0:00:28
      551500 -- [-475.011] (-473.564) (-473.846) (-474.256) * (-477.127) [-475.228] (-474.130) (-475.092) -- 0:00:28
      552000 -- (-478.220) (-475.576) (-475.533) [-475.560] * (-479.018) [-473.314] (-475.606) (-476.557) -- 0:00:28
      552500 -- (-474.678) (-476.021) (-476.100) [-473.770] * (-474.900) [-474.184] (-475.507) (-473.738) -- 0:00:29
      553000 -- (-473.959) [-474.223] (-477.905) (-479.836) * (-476.435) (-473.345) (-473.278) [-475.952] -- 0:00:29
      553500 -- (-479.014) (-473.325) (-477.816) [-473.934] * (-476.059) (-474.617) [-474.251] (-477.614) -- 0:00:29
      554000 -- [-473.247] (-475.176) (-477.686) (-477.895) * (-474.292) (-474.015) (-473.694) [-474.982] -- 0:00:28
      554500 -- (-476.055) (-476.065) (-475.300) [-474.476] * [-474.896] (-473.276) (-474.366) (-475.568) -- 0:00:28
      555000 -- [-476.506] (-476.477) (-477.211) (-473.375) * (-475.436) [-475.923] (-477.202) (-475.774) -- 0:00:28

      Average standard deviation of split frequencies: 0.009703

      555500 -- [-473.671] (-475.509) (-475.508) (-473.618) * (-476.446) [-475.388] (-473.712) (-479.118) -- 0:00:28
      556000 -- [-477.511] (-477.527) (-474.113) (-475.704) * (-475.432) (-474.200) (-478.375) [-476.617] -- 0:00:28
      556500 -- (-474.365) (-477.128) (-476.268) [-475.335] * (-473.862) (-474.326) (-474.500) [-473.821] -- 0:00:28
      557000 -- (-474.365) (-475.613) [-473.750] (-474.147) * (-480.402) (-477.852) [-474.625] (-476.230) -- 0:00:28
      557500 -- (-473.261) (-479.407) [-476.786] (-475.173) * (-474.962) (-477.727) (-474.409) [-476.000] -- 0:00:28
      558000 -- (-474.336) (-473.998) [-475.925] (-480.822) * [-475.332] (-474.866) (-478.695) (-474.170) -- 0:00:28
      558500 -- (-476.941) (-476.108) [-473.022] (-475.949) * (-475.243) (-474.699) (-473.632) [-473.644] -- 0:00:28
      559000 -- (-476.020) (-473.736) (-475.813) [-473.638] * [-474.622] (-474.398) (-473.948) (-479.041) -- 0:00:28
      559500 -- [-474.023] (-475.122) (-477.178) (-476.266) * (-477.395) (-475.614) (-475.512) [-473.425] -- 0:00:28
      560000 -- (-475.322) [-478.167] (-476.295) (-473.753) * [-479.179] (-473.870) (-474.940) (-475.388) -- 0:00:28

      Average standard deviation of split frequencies: 0.009617

      560500 -- (-480.316) [-477.555] (-477.999) (-475.480) * (-476.975) (-474.188) [-475.318] (-475.265) -- 0:00:28
      561000 -- (-476.976) (-473.774) (-476.219) [-476.213] * (-473.614) [-475.160] (-476.661) (-473.215) -- 0:00:28
      561500 -- [-475.474] (-474.994) (-478.708) (-479.781) * (-475.347) (-475.509) (-476.692) [-473.240] -- 0:00:28
      562000 -- (-473.904) (-476.882) (-477.260) [-477.489] * (-474.041) (-476.280) [-473.581] (-475.651) -- 0:00:28
      562500 -- (-480.313) [-475.801] (-474.141) (-475.156) * [-474.251] (-474.251) (-483.426) (-477.129) -- 0:00:28
      563000 -- (-473.881) [-475.179] (-477.926) (-473.320) * [-475.243] (-479.007) (-483.235) (-474.098) -- 0:00:27
      563500 -- (-474.005) [-476.105] (-476.632) (-474.628) * (-474.467) [-474.818] (-477.195) (-474.046) -- 0:00:27
      564000 -- (-473.471) (-473.927) (-474.898) [-475.239] * (-474.340) (-475.671) [-475.736] (-476.108) -- 0:00:27
      564500 -- (-473.622) [-473.973] (-475.002) (-476.091) * (-473.536) (-477.461) (-474.153) [-476.182] -- 0:00:27
      565000 -- (-474.515) (-475.484) [-474.354] (-476.473) * (-476.245) (-477.666) [-473.387] (-476.261) -- 0:00:27

      Average standard deviation of split frequencies: 0.008560

      565500 -- (-475.468) (-474.882) [-474.540] (-479.297) * [-478.664] (-474.603) (-473.943) (-475.024) -- 0:00:27
      566000 -- (-476.475) [-475.553] (-477.011) (-474.312) * (-477.717) (-476.806) [-473.881] (-475.113) -- 0:00:27
      566500 -- (-474.482) [-473.331] (-473.141) (-475.032) * (-479.323) (-476.472) (-475.338) [-475.043] -- 0:00:27
      567000 -- (-477.918) (-473.548) (-473.224) [-475.104] * (-476.739) (-478.552) (-475.326) [-474.534] -- 0:00:27
      567500 -- (-475.150) (-474.512) (-473.779) [-475.082] * (-477.914) [-473.463] (-479.463) (-477.711) -- 0:00:27
      568000 -- (-476.495) (-474.984) [-474.084] (-473.163) * (-478.576) [-473.386] (-474.330) (-474.796) -- 0:00:27
      568500 -- (-475.004) (-476.831) [-473.266] (-474.827) * [-475.198] (-474.286) (-473.671) (-476.180) -- 0:00:27
      569000 -- (-478.087) [-473.398] (-473.750) (-476.625) * [-474.680] (-474.737) (-474.985) (-476.823) -- 0:00:27
      569500 -- (-477.821) (-475.723) (-476.135) [-474.143] * (-476.072) (-478.419) [-475.887] (-477.361) -- 0:00:27
      570000 -- (-473.589) (-476.037) [-476.174] (-476.640) * (-475.814) [-474.540] (-479.157) (-474.914) -- 0:00:27

      Average standard deviation of split frequencies: 0.009135

      570500 -- (-473.601) [-478.163] (-474.345) (-476.761) * [-474.606] (-474.103) (-476.458) (-475.360) -- 0:00:27
      571000 -- (-475.470) (-473.346) (-473.321) [-474.289] * (-474.453) (-480.606) [-473.873] (-476.300) -- 0:00:27
      571500 -- (-474.427) [-477.083] (-475.049) (-473.933) * (-477.032) [-474.208] (-479.477) (-479.781) -- 0:00:27
      572000 -- (-474.831) (-476.054) [-474.147] (-475.620) * (-481.382) (-475.627) [-473.500] (-477.742) -- 0:00:27
      572500 -- (-476.209) (-475.045) [-475.798] (-478.693) * (-473.204) [-476.351] (-473.161) (-473.976) -- 0:00:27
      573000 -- (-475.526) [-474.938] (-474.181) (-474.679) * (-476.652) [-475.824] (-475.286) (-474.927) -- 0:00:27
      573500 -- (-473.590) (-475.507) [-474.567] (-474.296) * (-477.727) (-479.734) [-475.148] (-477.113) -- 0:00:27
      574000 -- (-474.430) [-476.106] (-474.690) (-474.906) * (-476.840) (-476.432) [-473.953] (-477.352) -- 0:00:27
      574500 -- (-474.166) (-477.684) (-474.974) [-474.438] * (-474.082) (-475.482) [-473.170] (-476.851) -- 0:00:27
      575000 -- (-475.861) [-476.254] (-475.680) (-474.615) * (-474.714) (-474.555) [-478.415] (-475.786) -- 0:00:27

      Average standard deviation of split frequencies: 0.008457

      575500 -- (-474.426) (-476.126) [-473.875] (-474.728) * (-477.872) (-473.310) [-476.816] (-473.387) -- 0:00:27
      576000 -- [-474.172] (-474.417) (-484.112) (-473.548) * (-474.546) [-474.560] (-473.656) (-474.787) -- 0:00:27
      576500 -- (-474.247) [-474.523] (-480.343) (-473.916) * (-474.715) (-474.163) (-475.384) [-476.481] -- 0:00:27
      577000 -- [-473.825] (-475.896) (-474.636) (-476.203) * (-473.442) [-475.281] (-476.282) (-475.181) -- 0:00:27
      577500 -- (-477.165) (-476.842) (-475.853) [-473.070] * (-473.277) (-474.256) (-475.463) [-476.148] -- 0:00:27
      578000 -- (-477.623) (-476.733) [-476.963] (-475.286) * [-474.320] (-473.992) (-479.467) (-475.806) -- 0:00:27
      578500 -- [-474.870] (-477.086) (-475.446) (-473.430) * (-476.663) (-474.097) (-473.869) [-475.549] -- 0:00:26
      579000 -- (-474.498) [-473.998] (-477.179) (-474.113) * (-475.367) [-474.912] (-475.444) (-476.885) -- 0:00:26
      579500 -- [-474.422] (-475.897) (-475.134) (-473.222) * (-475.888) (-473.871) [-474.217] (-475.249) -- 0:00:26
      580000 -- (-473.143) (-474.172) (-479.067) [-473.257] * (-473.853) (-475.704) [-475.444] (-474.092) -- 0:00:26

      Average standard deviation of split frequencies: 0.008262

      580500 -- (-474.138) (-478.859) [-476.801] (-478.162) * (-480.089) [-475.082] (-477.275) (-475.836) -- 0:00:26
      581000 -- [-473.905] (-476.697) (-477.635) (-473.506) * (-473.705) [-473.499] (-478.168) (-477.139) -- 0:00:26
      581500 -- [-474.414] (-474.219) (-477.630) (-474.543) * (-477.678) (-474.746) (-474.961) [-478.057] -- 0:00:26
      582000 -- (-477.330) (-477.445) (-477.396) [-474.672] * (-475.964) (-474.846) [-474.589] (-473.539) -- 0:00:26
      582500 -- (-476.483) [-474.627] (-475.415) (-475.568) * (-475.764) (-477.512) [-476.146] (-475.454) -- 0:00:26
      583000 -- [-475.091] (-475.484) (-476.778) (-475.839) * (-479.587) (-476.047) [-473.946] (-475.741) -- 0:00:26
      583500 -- [-473.938] (-478.491) (-476.767) (-473.711) * [-476.039] (-477.762) (-476.385) (-473.822) -- 0:00:26
      584000 -- (-475.098) (-475.831) (-479.008) [-474.252] * (-475.955) (-476.021) (-477.399) [-476.403] -- 0:00:26
      584500 -- [-477.619] (-475.026) (-477.770) (-475.471) * (-473.629) (-473.424) [-477.266] (-474.493) -- 0:00:26
      585000 -- (-474.192) (-479.665) [-475.854] (-474.754) * (-473.519) [-474.713] (-474.828) (-479.976) -- 0:00:26

      Average standard deviation of split frequencies: 0.008423

      585500 -- [-473.226] (-474.479) (-476.591) (-477.417) * [-473.291] (-474.261) (-475.165) (-473.654) -- 0:00:26
      586000 -- [-474.159] (-474.561) (-474.390) (-479.017) * (-481.922) [-476.461] (-473.763) (-475.571) -- 0:00:26
      586500 -- (-476.347) [-476.973] (-474.051) (-476.042) * (-476.190) [-473.179] (-474.908) (-474.498) -- 0:00:26
      587000 -- (-475.808) [-475.912] (-475.905) (-473.573) * (-476.197) (-475.125) [-474.886] (-475.721) -- 0:00:26
      587500 -- [-473.951] (-474.934) (-474.830) (-474.475) * (-474.846) (-478.273) (-477.464) [-474.023] -- 0:00:26
      588000 -- (-479.269) [-474.978] (-474.801) (-478.557) * (-473.341) (-474.341) (-473.853) [-474.369] -- 0:00:26
      588500 -- (-480.901) (-478.703) [-474.187] (-477.006) * (-476.844) (-473.829) [-478.414] (-476.444) -- 0:00:26
      589000 -- (-478.073) (-475.756) [-474.284] (-479.074) * [-476.049] (-474.015) (-475.357) (-475.666) -- 0:00:26
      589500 -- [-474.631] (-475.841) (-475.128) (-472.936) * (-473.722) [-474.962] (-477.189) (-474.701) -- 0:00:26
      590000 -- (-474.139) (-474.940) [-474.572] (-475.433) * (-474.980) [-474.271] (-477.440) (-474.421) -- 0:00:26

      Average standard deviation of split frequencies: 0.008735

      590500 -- (-474.915) (-477.465) [-474.080] (-473.222) * (-473.228) [-476.498] (-476.166) (-474.633) -- 0:00:26
      591000 -- (-477.022) (-474.004) [-477.224] (-474.355) * (-475.515) (-476.735) (-482.715) [-473.639] -- 0:00:26
      591500 -- (-478.226) (-475.548) [-476.684] (-473.907) * (-479.206) (-478.921) (-474.708) [-474.102] -- 0:00:26
      592000 -- (-475.287) [-475.822] (-473.418) (-474.150) * [-474.939] (-479.994) (-474.470) (-473.531) -- 0:00:26
      592500 -- (-475.681) (-476.108) (-475.350) [-473.564] * (-476.731) [-476.026] (-474.885) (-476.471) -- 0:00:26
      593000 -- (-476.082) [-475.162] (-478.666) (-473.966) * (-478.353) (-474.539) (-475.596) [-474.027] -- 0:00:26
      593500 -- (-475.523) [-476.183] (-480.013) (-476.828) * (-475.344) (-474.419) [-476.047] (-474.789) -- 0:00:26
      594000 -- (-477.458) (-476.477) (-474.850) [-474.845] * (-474.847) (-473.924) [-474.297] (-475.535) -- 0:00:25
      594500 -- (-476.652) [-478.730] (-474.159) (-478.625) * (-476.799) (-473.857) (-473.207) [-476.521] -- 0:00:25
      595000 -- (-480.274) [-473.639] (-474.955) (-478.284) * (-474.512) (-473.667) [-480.427] (-475.107) -- 0:00:25

      Average standard deviation of split frequencies: 0.008876

      595500 -- (-473.479) [-473.697] (-478.376) (-474.693) * (-476.124) (-475.496) (-477.703) [-474.125] -- 0:00:25
      596000 -- [-474.382] (-478.793) (-477.619) (-473.821) * (-478.249) (-476.760) [-476.139] (-475.304) -- 0:00:25
      596500 -- (-475.343) (-477.572) (-475.216) [-473.532] * (-473.765) [-475.182] (-473.700) (-475.657) -- 0:00:25
      597000 -- (-476.292) (-474.055) (-475.163) [-474.974] * [-474.693] (-475.058) (-475.335) (-474.910) -- 0:00:25
      597500 -- (-478.739) (-477.772) [-477.308] (-476.302) * (-475.713) [-476.661] (-473.624) (-475.615) -- 0:00:25
      598000 -- (-475.612) (-475.845) (-477.401) [-474.724] * (-474.773) (-474.492) [-474.289] (-474.223) -- 0:00:25
      598500 -- (-476.991) [-476.428] (-479.623) (-474.343) * (-474.256) (-476.207) [-473.672] (-480.376) -- 0:00:25
      599000 -- [-474.962] (-477.340) (-476.218) (-477.003) * (-475.907) (-477.129) (-474.323) [-476.559] -- 0:00:25
      599500 -- (-477.296) (-476.342) (-481.175) [-476.322] * (-474.707) (-475.146) [-475.863] (-475.232) -- 0:00:25
      600000 -- (-479.140) [-474.972] (-475.384) (-476.911) * (-478.564) [-477.299] (-473.573) (-475.227) -- 0:00:25

      Average standard deviation of split frequencies: 0.009418

      600500 -- (-478.118) (-480.442) (-474.443) [-474.420] * (-475.398) (-476.471) (-473.877) [-475.575] -- 0:00:25
      601000 -- (-477.394) (-476.365) (-475.798) [-476.076] * [-473.429] (-475.268) (-475.434) (-474.674) -- 0:00:25
      601500 -- (-479.028) (-477.274) (-477.666) [-476.359] * (-476.708) [-474.294] (-479.925) (-479.744) -- 0:00:25
      602000 -- [-474.878] (-474.590) (-474.225) (-476.115) * [-474.071] (-476.645) (-479.105) (-475.285) -- 0:00:25
      602500 -- (-475.926) (-475.962) [-474.900] (-474.218) * [-474.588] (-475.504) (-477.208) (-474.787) -- 0:00:25
      603000 -- (-476.414) (-473.569) [-474.523] (-474.739) * (-476.658) (-476.594) [-476.214] (-475.562) -- 0:00:25
      603500 -- (-474.225) (-474.559) [-475.264] (-476.217) * (-478.145) (-475.377) [-476.082] (-477.198) -- 0:00:25
      604000 -- (-476.104) (-475.180) [-477.470] (-474.517) * [-474.501] (-473.798) (-476.962) (-474.341) -- 0:00:25
      604500 -- (-475.453) [-477.061] (-474.387) (-473.865) * [-477.280] (-473.781) (-477.247) (-473.696) -- 0:00:25
      605000 -- [-472.985] (-473.435) (-478.174) (-474.018) * (-474.682) [-473.657] (-475.160) (-473.836) -- 0:00:25

      Average standard deviation of split frequencies: 0.009680

      605500 -- (-476.274) (-473.746) (-473.839) [-474.647] * (-474.177) (-475.440) [-482.261] (-476.668) -- 0:00:25
      606000 -- (-473.275) [-474.009] (-476.419) (-478.010) * (-474.997) (-477.101) (-477.418) [-476.158] -- 0:00:25
      606500 -- (-474.913) [-475.671] (-476.420) (-475.170) * (-478.221) (-473.942) (-475.103) [-474.892] -- 0:00:25
      607000 -- (-476.532) [-476.730] (-474.977) (-473.899) * [-476.053] (-478.831) (-473.912) (-473.986) -- 0:00:25
      607500 -- (-474.751) [-474.709] (-474.132) (-474.656) * [-473.085] (-475.015) (-476.239) (-474.530) -- 0:00:25
      608000 -- (-474.756) (-473.545) (-476.555) [-473.623] * (-473.828) [-476.502] (-475.544) (-475.191) -- 0:00:25
      608500 -- (-473.253) (-478.302) [-477.043] (-477.724) * [-473.973] (-476.497) (-476.227) (-480.657) -- 0:00:25
      609000 -- (-473.242) (-473.304) [-479.629] (-473.915) * [-474.172] (-474.766) (-476.511) (-477.362) -- 0:00:25
      609500 -- [-473.507] (-475.708) (-477.897) (-474.404) * (-473.270) [-473.859] (-473.944) (-474.507) -- 0:00:24
      610000 -- [-474.380] (-478.404) (-476.201) (-475.550) * (-474.103) [-473.901] (-477.054) (-473.725) -- 0:00:24

      Average standard deviation of split frequencies: 0.009049

      610500 -- (-478.838) [-473.487] (-475.035) (-475.139) * (-477.528) (-478.578) (-477.863) [-474.268] -- 0:00:24
      611000 -- (-474.989) [-479.809] (-478.796) (-474.520) * (-476.969) (-482.039) [-474.985] (-474.089) -- 0:00:24
      611500 -- (-477.449) [-477.064] (-489.158) (-474.530) * (-474.250) (-481.325) (-477.562) [-478.753] -- 0:00:24
      612000 -- (-476.334) (-474.917) (-489.405) [-474.249] * [-474.248] (-475.439) (-475.796) (-481.773) -- 0:00:24
      612500 -- [-481.098] (-473.272) (-479.721) (-473.233) * [-475.384] (-475.684) (-475.353) (-477.567) -- 0:00:24
      613000 -- [-475.336] (-474.747) (-477.978) (-475.252) * (-475.257) (-476.710) [-475.488] (-475.857) -- 0:00:24
      613500 -- (-476.472) [-473.710] (-480.277) (-473.109) * [-474.395] (-488.196) (-473.579) (-478.595) -- 0:00:24
      614000 -- (-478.619) (-477.024) (-474.564) [-473.487] * (-473.656) (-478.575) (-474.277) [-475.244] -- 0:00:24
      614500 -- (-477.447) (-478.763) (-477.496) [-473.502] * (-473.811) (-476.276) (-474.055) [-473.573] -- 0:00:24
      615000 -- [-476.407] (-475.416) (-474.484) (-478.837) * (-475.444) [-476.614] (-474.138) (-474.151) -- 0:00:24

      Average standard deviation of split frequencies: 0.008631

      615500 -- (-476.248) (-475.555) [-474.753] (-475.995) * (-476.959) (-474.991) [-474.291] (-476.738) -- 0:00:24
      616000 -- (-477.630) [-475.734] (-479.054) (-479.286) * (-474.105) (-473.157) [-474.288] (-476.006) -- 0:00:24
      616500 -- [-475.034] (-476.282) (-477.127) (-478.997) * (-475.359) [-474.779] (-477.191) (-474.504) -- 0:00:24
      617000 -- [-475.377] (-475.195) (-475.184) (-473.536) * (-475.204) (-476.028) (-474.269) [-475.592] -- 0:00:24
      617500 -- [-477.969] (-475.598) (-476.725) (-473.536) * (-475.544) (-477.431) [-473.939] (-475.721) -- 0:00:24
      618000 -- (-474.958) (-476.179) [-475.140] (-477.448) * (-478.780) (-478.274) [-473.866] (-475.658) -- 0:00:24
      618500 -- (-475.517) (-475.272) [-476.563] (-479.663) * (-476.376) (-474.125) [-474.013] (-474.986) -- 0:00:24
      619000 -- (-474.658) (-474.898) (-478.481) [-474.574] * (-479.237) (-474.932) (-481.046) [-474.072] -- 0:00:24
      619500 -- [-475.171] (-475.493) (-473.477) (-474.350) * (-474.823) [-474.958] (-479.196) (-475.500) -- 0:00:23
      620000 -- (-480.097) (-474.037) [-475.087] (-473.867) * [-474.480] (-477.323) (-477.535) (-474.337) -- 0:00:23

      Average standard deviation of split frequencies: 0.009072

      620500 -- (-476.209) [-475.368] (-473.371) (-475.109) * (-475.130) [-474.117] (-475.020) (-474.556) -- 0:00:24
      621000 -- [-474.906] (-476.577) (-476.625) (-477.477) * (-475.826) (-475.900) [-476.477] (-476.681) -- 0:00:24
      621500 -- (-473.924) (-474.101) [-476.533] (-475.814) * [-473.983] (-474.256) (-474.849) (-475.685) -- 0:00:24
      622000 -- (-475.240) (-476.206) (-474.596) [-475.416] * [-473.647] (-474.574) (-474.338) (-476.758) -- 0:00:24
      622500 -- (-473.766) [-475.715] (-474.195) (-477.532) * (-476.927) (-483.115) [-475.300] (-477.691) -- 0:00:24
      623000 -- (-475.984) [-473.181] (-474.592) (-473.986) * (-475.332) [-476.679] (-477.115) (-480.745) -- 0:00:24
      623500 -- (-477.609) [-473.755] (-473.285) (-477.848) * (-475.012) (-475.819) (-476.099) [-474.422] -- 0:00:24
      624000 -- (-474.312) [-474.008] (-474.320) (-474.859) * [-473.253] (-475.111) (-476.255) (-479.541) -- 0:00:24
      624500 -- (-478.724) [-473.874] (-475.541) (-477.019) * (-478.737) (-475.928) [-474.721] (-475.805) -- 0:00:24
      625000 -- [-477.485] (-477.582) (-480.201) (-474.705) * (-478.199) [-474.949] (-477.774) (-473.905) -- 0:00:24

      Average standard deviation of split frequencies: 0.009037

      625500 -- (-475.747) [-473.012] (-477.236) (-474.547) * (-476.736) (-475.030) [-473.179] (-473.366) -- 0:00:23
      626000 -- (-473.874) [-473.334] (-473.876) (-473.731) * (-477.198) (-475.035) (-474.005) [-473.819] -- 0:00:23
      626500 -- (-474.322) (-476.511) (-474.229) [-478.752] * (-478.557) (-476.450) [-474.969] (-474.863) -- 0:00:23
      627000 -- (-476.581) [-479.075] (-479.512) (-478.454) * (-476.369) (-476.154) [-475.707] (-474.879) -- 0:00:23
      627500 -- (-473.960) [-476.014] (-476.458) (-474.020) * (-477.485) [-473.959] (-473.199) (-476.826) -- 0:00:23
      628000 -- (-476.991) [-477.265] (-475.858) (-477.855) * [-474.009] (-473.717) (-474.261) (-474.124) -- 0:00:23
      628500 -- (-475.304) [-475.031] (-477.938) (-473.661) * [-475.459] (-477.360) (-477.603) (-474.987) -- 0:00:23
      629000 -- (-473.940) (-473.851) [-473.383] (-474.294) * [-474.362] (-479.688) (-475.121) (-473.350) -- 0:00:23
      629500 -- (-475.705) [-475.403] (-478.365) (-473.236) * (-473.911) (-476.960) (-476.908) [-474.037] -- 0:00:23
      630000 -- (-474.550) [-474.489] (-475.461) (-475.895) * [-475.081] (-474.539) (-478.204) (-473.571) -- 0:00:23

      Average standard deviation of split frequencies: 0.009673

      630500 -- [-479.530] (-474.794) (-479.942) (-477.566) * [-474.849] (-481.514) (-474.856) (-475.959) -- 0:00:23
      631000 -- (-476.475) [-474.603] (-479.259) (-475.518) * [-476.090] (-475.454) (-475.975) (-473.974) -- 0:00:23
      631500 -- (-475.394) (-476.613) (-475.969) [-474.628] * (-475.505) [-478.950] (-478.949) (-473.405) -- 0:00:23
      632000 -- (-474.219) [-474.712] (-474.039) (-474.157) * (-475.823) (-477.819) (-476.737) [-474.829] -- 0:00:23
      632500 -- (-475.308) (-475.203) [-473.918] (-476.214) * (-474.295) (-474.289) [-473.919] (-475.050) -- 0:00:23
      633000 -- (-474.403) [-474.502] (-474.880) (-474.647) * [-475.252] (-475.579) (-474.967) (-474.559) -- 0:00:23
      633500 -- (-473.430) (-476.441) [-475.065] (-476.711) * [-473.547] (-475.722) (-474.955) (-474.303) -- 0:00:23
      634000 -- [-476.014] (-473.736) (-476.883) (-474.966) * [-474.365] (-477.199) (-479.944) (-473.826) -- 0:00:23
      634500 -- [-473.797] (-477.185) (-485.878) (-474.277) * (-476.708) (-475.062) [-476.253] (-474.155) -- 0:00:23
      635000 -- [-474.262] (-477.679) (-475.908) (-475.219) * [-474.176] (-475.038) (-474.353) (-474.907) -- 0:00:22

      Average standard deviation of split frequencies: 0.009033

      635500 -- (-473.353) [-476.576] (-475.645) (-477.897) * [-475.116] (-477.744) (-478.790) (-477.076) -- 0:00:22
      636000 -- (-474.143) [-475.942] (-475.252) (-473.468) * (-476.004) [-477.171] (-481.643) (-475.493) -- 0:00:22
      636500 -- (-474.473) (-474.938) [-473.117] (-473.648) * (-480.078) [-475.958] (-478.486) (-473.968) -- 0:00:22
      637000 -- (-474.388) (-476.242) (-478.039) [-476.542] * (-482.687) [-476.868] (-474.798) (-473.490) -- 0:00:23
      637500 -- [-475.024] (-474.416) (-475.435) (-480.122) * [-476.848] (-474.463) (-473.901) (-474.282) -- 0:00:23
      638000 -- (-475.640) (-473.563) [-474.812] (-473.998) * (-477.636) (-477.158) (-478.137) [-477.446] -- 0:00:23
      638500 -- (-477.636) (-475.720) [-474.195] (-479.412) * [-478.515] (-473.741) (-475.347) (-477.386) -- 0:00:23
      639000 -- (-473.630) (-474.505) [-475.521] (-474.660) * [-476.837] (-475.519) (-475.217) (-476.688) -- 0:00:23
      639500 -- (-474.572) [-476.628] (-475.919) (-476.444) * (-476.659) [-473.268] (-473.955) (-476.067) -- 0:00:23
      640000 -- (-476.024) (-476.030) (-473.470) [-474.789] * (-474.426) (-474.563) (-474.441) [-476.999] -- 0:00:23

      Average standard deviation of split frequencies: 0.008968

      640500 -- (-476.607) (-476.168) [-473.572] (-476.226) * [-477.753] (-474.564) (-474.277) (-478.494) -- 0:00:23
      641000 -- (-475.187) (-475.731) (-475.918) [-477.504] * (-474.424) [-473.462] (-473.556) (-479.187) -- 0:00:22
      641500 -- (-476.145) (-475.654) [-476.874] (-480.533) * (-477.067) [-473.858] (-475.062) (-476.361) -- 0:00:22
      642000 -- [-477.800] (-473.479) (-475.980) (-477.312) * (-475.186) (-480.742) [-474.447] (-475.971) -- 0:00:22
      642500 -- (-475.724) [-474.255] (-474.467) (-478.614) * (-476.537) [-478.562] (-474.386) (-475.825) -- 0:00:22
      643000 -- (-475.922) (-476.179) [-475.392] (-476.643) * (-476.321) (-473.968) (-475.581) [-476.165] -- 0:00:22
      643500 -- (-477.392) (-476.130) (-476.272) [-474.148] * [-477.823] (-474.278) (-477.028) (-473.273) -- 0:00:22
      644000 -- [-475.362] (-475.932) (-474.877) (-476.677) * (-479.277) [-473.557] (-478.946) (-474.246) -- 0:00:22
      644500 -- [-474.824] (-473.721) (-475.392) (-477.389) * (-475.844) [-473.080] (-477.761) (-473.540) -- 0:00:22
      645000 -- (-473.770) (-475.233) (-474.328) [-475.530] * [-473.727] (-477.243) (-477.135) (-473.672) -- 0:00:22

      Average standard deviation of split frequencies: 0.008939

      645500 -- (-476.197) (-474.501) [-474.354] (-475.787) * (-476.933) (-478.229) (-473.610) [-476.621] -- 0:00:22
      646000 -- [-475.311] (-481.335) (-477.354) (-473.776) * (-474.693) (-474.522) (-473.419) [-474.224] -- 0:00:22
      646500 -- (-475.493) (-476.343) (-475.710) [-473.699] * (-474.287) (-475.180) [-480.149] (-473.292) -- 0:00:22
      647000 -- [-474.465] (-475.773) (-474.450) (-472.959) * (-474.228) (-477.825) (-478.248) [-474.527] -- 0:00:22
      647500 -- (-476.947) (-477.728) (-478.358) [-476.849] * (-475.473) (-475.565) [-474.357] (-474.271) -- 0:00:22
      648000 -- (-474.027) (-475.106) (-474.233) [-475.072] * (-474.771) (-475.236) (-474.327) [-474.729] -- 0:00:22
      648500 -- [-472.898] (-474.253) (-474.639) (-475.786) * [-473.586] (-473.336) (-475.211) (-477.497) -- 0:00:22
      649000 -- (-475.217) (-474.106) [-474.497] (-474.224) * (-474.330) [-474.886] (-477.487) (-479.390) -- 0:00:22
      649500 -- (-475.328) (-475.910) (-476.691) [-476.147] * [-475.825] (-473.808) (-475.659) (-476.119) -- 0:00:22
      650000 -- (-473.370) (-475.990) (-477.118) [-475.883] * (-476.680) (-476.286) (-473.868) [-474.968] -- 0:00:22

      Average standard deviation of split frequencies: 0.010271

      650500 -- (-474.733) (-475.424) [-474.243] (-475.518) * [-475.456] (-478.536) (-474.072) (-477.856) -- 0:00:22
      651000 -- (-476.228) (-474.542) (-477.084) [-474.775] * (-475.353) [-475.953] (-475.213) (-474.379) -- 0:00:21
      651500 -- [-475.179] (-476.042) (-475.444) (-477.633) * (-473.601) [-475.178] (-473.808) (-474.480) -- 0:00:21
      652000 -- (-474.517) (-473.627) [-473.220] (-473.864) * (-474.432) (-479.385) [-474.336] (-473.837) -- 0:00:21
      652500 -- (-474.098) (-475.189) [-474.745] (-473.852) * [-473.732] (-477.592) (-477.079) (-474.790) -- 0:00:21
      653000 -- [-473.013] (-475.949) (-474.818) (-473.776) * (-482.516) [-473.213] (-475.465) (-474.925) -- 0:00:22
      653500 -- (-473.890) (-475.989) (-476.558) [-477.434] * (-476.639) (-473.049) (-477.491) [-474.026] -- 0:00:22
      654000 -- (-476.012) [-476.690] (-476.139) (-477.678) * (-473.665) [-474.412] (-474.379) (-473.768) -- 0:00:22
      654500 -- [-475.902] (-476.072) (-473.855) (-473.416) * (-473.809) [-473.229] (-476.692) (-475.187) -- 0:00:22
      655000 -- (-474.284) (-473.365) (-475.565) [-474.510] * (-473.883) (-475.228) (-476.686) [-477.527] -- 0:00:22

      Average standard deviation of split frequencies: 0.009553

      655500 -- (-474.646) [-475.853] (-473.197) (-475.311) * (-476.712) [-475.131] (-477.584) (-476.147) -- 0:00:22
      656000 -- (-475.955) (-472.940) [-474.683] (-479.310) * (-476.240) [-474.379] (-476.393) (-477.476) -- 0:00:22
      656500 -- (-477.074) (-475.085) [-473.410] (-475.155) * [-477.708] (-476.338) (-474.908) (-478.460) -- 0:00:21
      657000 -- (-473.630) (-473.811) (-474.199) [-475.321] * [-480.152] (-476.186) (-475.259) (-474.527) -- 0:00:21
      657500 -- [-474.382] (-475.444) (-475.064) (-475.118) * (-473.046) [-474.376] (-475.528) (-474.651) -- 0:00:21
      658000 -- (-474.095) [-473.806] (-475.068) (-475.318) * (-476.145) (-474.252) (-475.115) [-474.496] -- 0:00:21
      658500 -- [-475.272] (-478.118) (-473.634) (-478.221) * [-479.125] (-473.126) (-473.233) (-474.185) -- 0:00:21
      659000 -- [-477.457] (-474.413) (-479.011) (-474.683) * (-481.485) [-475.478] (-473.679) (-474.498) -- 0:00:21
      659500 -- [-476.112] (-474.021) (-477.261) (-478.178) * (-476.443) (-474.905) [-473.515] (-474.908) -- 0:00:21
      660000 -- [-475.853] (-478.543) (-475.541) (-474.103) * (-481.657) (-474.341) [-474.630] (-475.584) -- 0:00:21

      Average standard deviation of split frequencies: 0.008429

      660500 -- (-480.196) (-474.652) [-477.492] (-475.012) * [-473.783] (-474.743) (-474.549) (-475.186) -- 0:00:21
      661000 -- [-474.281] (-476.321) (-479.191) (-478.481) * [-473.648] (-475.408) (-477.183) (-476.324) -- 0:00:21
      661500 -- (-473.158) (-477.020) (-477.008) [-473.457] * (-474.677) (-474.743) (-474.892) [-476.479] -- 0:00:21
      662000 -- [-475.063] (-474.129) (-481.938) (-473.294) * (-473.574) (-474.414) (-476.530) [-475.349] -- 0:00:21
      662500 -- [-475.338] (-476.313) (-477.548) (-474.915) * (-473.266) (-476.089) (-476.177) [-475.794] -- 0:00:21
      663000 -- [-474.977] (-480.319) (-474.144) (-475.657) * [-473.161] (-479.009) (-480.775) (-473.682) -- 0:00:21
      663500 -- (-473.288) (-474.598) (-476.958) [-474.455] * [-474.778] (-477.876) (-479.574) (-474.324) -- 0:00:21
      664000 -- (-474.388) [-476.231] (-476.765) (-477.206) * (-474.815) (-476.302) [-475.765] (-475.000) -- 0:00:21
      664500 -- [-475.932] (-475.825) (-480.068) (-474.257) * [-476.861] (-477.607) (-475.241) (-477.873) -- 0:00:21
      665000 -- (-475.791) [-475.165] (-475.192) (-473.610) * (-476.713) (-475.389) [-476.758] (-476.142) -- 0:00:21

      Average standard deviation of split frequencies: 0.008184

      665500 -- (-474.125) (-474.448) (-473.313) [-474.617] * (-475.643) [-475.021] (-474.190) (-477.233) -- 0:00:21
      666000 -- (-474.040) (-475.934) [-477.793] (-474.423) * (-474.000) (-476.498) [-473.498] (-475.848) -- 0:00:21
      666500 -- (-475.948) (-473.994) (-479.328) [-474.549] * (-475.705) [-474.361] (-474.887) (-479.550) -- 0:00:21
      667000 -- [-477.740] (-473.328) (-477.839) (-473.324) * (-476.477) (-474.091) (-473.780) [-477.325] -- 0:00:20
      667500 -- (-474.758) (-473.328) [-478.682] (-473.838) * (-475.700) (-474.015) (-474.485) [-474.805] -- 0:00:20
      668000 -- (-476.130) (-474.442) (-477.581) [-475.296] * (-477.821) (-476.302) (-478.452) [-473.215] -- 0:00:20
      668500 -- (-480.155) [-474.421] (-473.424) (-475.034) * (-474.765) [-476.956] (-476.392) (-474.379) -- 0:00:20
      669000 -- (-475.481) (-478.153) [-476.132] (-474.443) * (-474.902) (-477.317) (-476.797) [-474.508] -- 0:00:20
      669500 -- (-475.589) [-474.253] (-477.983) (-477.640) * (-475.660) (-483.568) (-475.686) [-476.055] -- 0:00:21
      670000 -- (-476.550) (-476.198) (-476.274) [-475.172] * (-476.908) (-478.484) (-476.653) [-476.437] -- 0:00:21

      Average standard deviation of split frequencies: 0.008039

      670500 -- [-476.028] (-474.648) (-474.568) (-480.564) * (-476.806) [-477.301] (-475.623) (-476.059) -- 0:00:21
      671000 -- [-475.415] (-474.887) (-475.644) (-476.905) * (-477.356) (-479.072) (-474.433) [-475.170] -- 0:00:21
      671500 -- (-474.932) [-474.970] (-474.757) (-476.125) * (-476.159) (-476.629) [-474.139] (-474.005) -- 0:00:21
      672000 -- (-474.643) (-475.819) [-475.537] (-473.323) * (-475.544) (-476.758) [-473.837] (-479.116) -- 0:00:20
      672500 -- (-474.824) (-475.190) (-474.795) [-477.229] * (-475.841) (-476.505) [-475.048] (-478.504) -- 0:00:20
      673000 -- (-473.205) (-473.781) (-479.210) [-473.766] * (-477.827) (-478.416) [-476.155] (-475.741) -- 0:00:20
      673500 -- (-474.045) (-474.918) [-477.973] (-476.867) * (-479.146) [-478.587] (-474.466) (-473.643) -- 0:00:20
      674000 -- (-474.111) [-474.441] (-477.949) (-479.464) * (-478.345) (-479.294) [-474.174] (-477.735) -- 0:00:20
      674500 -- (-479.159) [-474.747] (-478.516) (-478.415) * (-481.977) (-475.257) (-477.878) [-477.238] -- 0:00:20
      675000 -- (-478.215) [-472.960] (-476.349) (-474.289) * [-475.765] (-478.650) (-474.839) (-476.933) -- 0:00:20

      Average standard deviation of split frequencies: 0.007584

      675500 -- (-476.204) [-472.983] (-479.590) (-473.932) * (-474.672) (-476.698) (-477.936) [-474.991] -- 0:00:20
      676000 -- (-473.932) (-474.400) [-477.747] (-475.508) * (-474.385) [-479.242] (-475.527) (-474.314) -- 0:00:20
      676500 -- [-475.888] (-474.354) (-481.375) (-476.722) * (-481.415) [-473.756] (-475.010) (-473.589) -- 0:00:20
      677000 -- (-474.399) (-474.693) (-476.048) [-473.799] * (-478.643) (-474.149) [-474.485] (-479.200) -- 0:00:20
      677500 -- (-475.874) (-476.381) [-474.905] (-477.184) * (-476.936) (-475.455) [-474.475] (-474.853) -- 0:00:20
      678000 -- [-473.830] (-474.507) (-474.300) (-473.707) * [-476.237] (-474.336) (-474.443) (-475.025) -- 0:00:20
      678500 -- [-477.614] (-474.316) (-478.537) (-476.787) * [-475.110] (-473.972) (-473.837) (-477.350) -- 0:00:20
      679000 -- (-476.736) (-474.088) (-476.648) [-473.737] * (-479.604) (-473.501) (-475.817) [-475.125] -- 0:00:20
      679500 -- (-476.010) (-480.738) [-474.861] (-475.099) * (-474.430) (-479.038) (-476.623) [-474.749] -- 0:00:20
      680000 -- (-475.206) [-482.217] (-480.041) (-477.678) * (-474.142) (-478.937) (-474.676) [-474.448] -- 0:00:20

      Average standard deviation of split frequencies: 0.007358

      680500 -- [-473.801] (-474.918) (-475.129) (-475.560) * (-473.386) (-477.736) (-475.016) [-473.498] -- 0:00:20
      681000 -- (-473.281) (-473.397) (-476.737) [-475.529] * (-478.921) (-480.476) [-474.441] (-473.746) -- 0:00:20
      681500 -- [-478.023] (-473.534) (-474.989) (-474.475) * [-476.944] (-478.505) (-474.364) (-474.779) -- 0:00:20
      682000 -- (-474.797) (-474.032) [-475.844] (-474.905) * (-475.092) (-477.189) (-476.101) [-474.150] -- 0:00:20
      682500 -- (-475.463) (-474.812) (-473.612) [-474.889] * (-474.554) [-478.394] (-473.651) (-474.797) -- 0:00:20
      683000 -- [-476.799] (-473.369) (-475.884) (-475.267) * (-476.232) [-474.966] (-473.969) (-476.495) -- 0:00:19
      683500 -- (-477.088) (-474.427) [-474.279] (-478.035) * (-477.020) (-477.237) (-473.307) [-479.190] -- 0:00:19
      684000 -- (-476.548) (-476.623) (-475.122) [-474.571] * (-477.319) [-473.992] (-476.060) (-474.677) -- 0:00:19
      684500 -- [-477.245] (-476.626) (-475.556) (-474.686) * (-478.172) [-475.129] (-478.393) (-475.371) -- 0:00:19
      685000 -- (-476.467) [-476.875] (-474.029) (-475.084) * (-476.647) (-474.443) (-478.488) [-476.677] -- 0:00:19

      Average standard deviation of split frequencies: 0.008772

      685500 -- [-476.395] (-476.686) (-473.826) (-476.307) * [-475.248] (-477.579) (-475.322) (-484.950) -- 0:00:19
      686000 -- (-473.818) (-478.188) (-475.482) [-473.636] * (-476.227) (-473.786) (-474.213) [-477.159] -- 0:00:20
      686500 -- [-476.390] (-474.474) (-474.318) (-473.673) * (-477.146) (-476.752) (-476.927) [-474.792] -- 0:00:20
      687000 -- (-474.831) (-473.661) [-474.113] (-475.066) * (-474.697) [-478.057] (-474.440) (-475.455) -- 0:00:20
      687500 -- [-475.287] (-476.699) (-476.647) (-473.812) * [-475.519] (-476.062) (-473.908) (-474.717) -- 0:00:20
      688000 -- (-475.310) [-476.146] (-475.885) (-475.291) * (-478.665) [-473.943] (-474.589) (-478.308) -- 0:00:19
      688500 -- (-474.451) (-474.068) (-475.928) [-476.143] * (-475.457) (-476.894) [-474.184] (-474.680) -- 0:00:19
      689000 -- [-476.400] (-475.147) (-477.064) (-475.234) * [-475.205] (-474.482) (-476.981) (-476.692) -- 0:00:19
      689500 -- (-473.262) (-474.970) (-479.760) [-474.997] * (-475.968) (-474.072) [-475.089] (-474.071) -- 0:00:19
      690000 -- (-473.677) (-474.263) (-480.450) [-479.238] * (-473.753) (-474.888) (-474.421) [-475.902] -- 0:00:19

      Average standard deviation of split frequencies: 0.008702

      690500 -- [-478.331] (-476.728) (-475.737) (-474.370) * (-473.932) [-474.117] (-475.135) (-476.399) -- 0:00:19
      691000 -- [-479.115] (-473.927) (-477.785) (-474.335) * (-476.313) [-474.302] (-476.512) (-474.488) -- 0:00:19
      691500 -- (-479.885) [-478.437] (-474.087) (-474.606) * (-473.036) (-474.857) [-475.431] (-474.226) -- 0:00:19
      692000 -- [-474.774] (-485.367) (-474.737) (-473.727) * (-474.617) [-474.221] (-475.358) (-473.901) -- 0:00:19
      692500 -- (-477.021) [-481.795] (-474.988) (-473.373) * (-474.329) [-475.264] (-475.905) (-474.456) -- 0:00:19
      693000 -- (-473.889) (-476.113) [-478.061] (-474.044) * (-475.065) (-474.190) [-473.531] (-475.739) -- 0:00:19
      693500 -- (-473.782) (-478.162) [-477.919] (-478.223) * (-473.791) (-476.426) (-474.366) [-475.564] -- 0:00:19
      694000 -- [-473.663] (-474.673) (-476.350) (-473.724) * (-475.028) (-475.224) [-476.613] (-475.584) -- 0:00:19
      694500 -- (-474.992) [-474.633] (-478.293) (-476.120) * [-474.812] (-476.877) (-477.307) (-477.612) -- 0:00:19
      695000 -- (-474.379) (-475.831) (-478.841) [-473.542] * (-475.345) (-475.214) (-475.394) [-474.282] -- 0:00:19

      Average standard deviation of split frequencies: 0.008720

      695500 -- (-474.318) (-478.064) [-478.386] (-476.411) * (-476.584) [-475.591] (-473.367) (-476.089) -- 0:00:19
      696000 -- (-474.490) [-475.165] (-476.779) (-476.543) * (-475.585) [-475.803] (-477.636) (-476.315) -- 0:00:19
      696500 -- (-477.546) [-473.966] (-476.856) (-475.848) * [-476.017] (-474.811) (-473.468) (-474.494) -- 0:00:19
      697000 -- (-475.922) (-474.913) (-474.888) [-474.836] * [-474.543] (-475.073) (-473.830) (-474.319) -- 0:00:19
      697500 -- (-476.007) (-475.135) [-473.716] (-474.679) * (-479.820) [-474.285] (-475.092) (-472.993) -- 0:00:19
      698000 -- (-474.353) (-475.074) [-477.079] (-475.052) * (-474.332) (-483.899) (-475.096) [-474.486] -- 0:00:19
      698500 -- [-473.363] (-474.283) (-478.291) (-475.191) * (-477.153) (-476.196) [-478.634] (-475.843) -- 0:00:18
      699000 -- (-473.392) [-473.594] (-474.384) (-480.354) * (-474.111) (-476.310) [-475.163] (-477.013) -- 0:00:18
      699500 -- (-475.814) (-473.394) [-475.878] (-485.230) * (-476.232) (-475.230) (-476.537) [-476.363] -- 0:00:18
      700000 -- [-479.783] (-475.199) (-472.994) (-478.672) * (-478.317) (-474.859) [-474.115] (-475.598) -- 0:00:18

      Average standard deviation of split frequencies: 0.008494

      700500 -- (-477.750) [-475.013] (-476.623) (-475.671) * (-476.015) (-479.969) (-476.928) [-475.769] -- 0:00:18
      701000 -- (-475.764) (-478.131) [-474.110] (-478.441) * (-473.975) (-476.133) (-475.993) [-474.923] -- 0:00:18
      701500 -- (-476.090) (-478.933) [-474.333] (-477.366) * (-473.951) (-475.108) [-476.871] (-475.495) -- 0:00:18
      702000 -- (-475.273) (-476.521) (-475.129) [-474.471] * (-475.334) (-477.510) (-474.915) [-474.913] -- 0:00:18
      702500 -- [-475.550] (-475.541) (-477.600) (-477.535) * [-474.367] (-475.637) (-473.070) (-479.003) -- 0:00:18
      703000 -- (-475.578) [-476.868] (-475.256) (-477.408) * [-476.788] (-477.546) (-478.314) (-474.652) -- 0:00:19
      703500 -- (-474.266) (-474.016) (-478.151) [-475.893] * [-479.847] (-479.321) (-475.378) (-478.661) -- 0:00:18
      704000 -- (-474.755) (-474.197) (-474.254) [-475.665] * (-476.159) (-476.653) (-477.992) [-476.877] -- 0:00:18
      704500 -- [-475.998] (-475.656) (-477.923) (-474.264) * (-474.696) (-475.117) [-475.001] (-474.431) -- 0:00:18
      705000 -- (-476.434) (-475.104) (-477.334) [-476.267] * [-473.579] (-475.101) (-474.254) (-475.505) -- 0:00:18

      Average standard deviation of split frequencies: 0.008805

      705500 -- (-473.724) [-473.779] (-477.758) (-476.473) * (-473.938) (-474.208) [-474.657] (-475.514) -- 0:00:18
      706000 -- [-474.230] (-473.751) (-480.987) (-476.343) * [-473.535] (-476.340) (-478.345) (-475.130) -- 0:00:18
      706500 -- [-477.291] (-474.351) (-481.384) (-475.154) * (-476.734) (-476.533) (-475.710) [-474.198] -- 0:00:18
      707000 -- [-473.718] (-473.261) (-476.670) (-480.124) * (-477.069) (-478.254) (-474.786) [-474.184] -- 0:00:18
      707500 -- (-476.103) (-473.957) [-474.502] (-474.654) * [-474.137] (-473.753) (-475.962) (-473.245) -- 0:00:18
      708000 -- (-476.475) (-474.353) (-477.364) [-474.164] * [-474.071] (-474.061) (-474.740) (-475.772) -- 0:00:18
      708500 -- (-477.119) [-473.426] (-478.259) (-477.400) * (-474.965) (-477.038) [-473.213] (-476.349) -- 0:00:18
      709000 -- (-473.331) (-476.919) [-473.276] (-478.476) * [-476.950] (-476.320) (-473.804) (-476.439) -- 0:00:18
      709500 -- (-475.429) (-475.989) [-473.127] (-477.530) * [-474.136] (-478.304) (-473.906) (-477.123) -- 0:00:18
      710000 -- (-476.386) [-475.193] (-474.907) (-473.964) * (-474.899) [-475.526] (-473.161) (-475.643) -- 0:00:18

      Average standard deviation of split frequencies: 0.008831

      710500 -- (-478.276) (-478.737) [-475.626] (-476.440) * (-477.419) (-476.616) [-474.477] (-473.864) -- 0:00:18
      711000 -- (-480.249) (-475.343) (-476.837) [-476.296] * (-473.953) [-478.138] (-476.244) (-474.360) -- 0:00:18
      711500 -- [-473.834] (-481.960) (-476.947) (-475.723) * [-475.258] (-476.879) (-475.266) (-474.913) -- 0:00:18
      712000 -- (-473.499) (-474.938) (-473.526) [-473.506] * (-475.613) (-478.294) (-475.260) [-476.125] -- 0:00:18
      712500 -- (-474.129) (-478.181) [-474.752] (-474.326) * [-476.064] (-474.660) (-480.828) (-474.105) -- 0:00:18
      713000 -- [-474.268] (-476.315) (-476.573) (-476.979) * (-474.934) (-474.190) [-473.453] (-473.689) -- 0:00:18
      713500 -- (-477.159) (-476.263) (-475.049) [-475.695] * [-476.198] (-474.080) (-474.287) (-475.825) -- 0:00:18
      714000 -- (-476.305) (-474.003) (-476.099) [-476.210] * (-474.510) (-474.496) (-474.445) [-476.372] -- 0:00:18
      714500 -- (-474.734) (-473.828) [-475.447] (-473.411) * [-473.956] (-473.250) (-474.461) (-475.948) -- 0:00:17
      715000 -- (-477.098) [-474.784] (-473.592) (-473.635) * (-474.134) (-478.824) [-479.600] (-475.843) -- 0:00:17

      Average standard deviation of split frequencies: 0.007901

      715500 -- (-474.591) (-477.206) (-474.575) [-474.654] * [-477.230] (-478.663) (-474.710) (-475.225) -- 0:00:17
      716000 -- (-475.502) (-474.186) [-479.179] (-476.517) * [-473.368] (-476.319) (-474.319) (-474.353) -- 0:00:17
      716500 -- (-473.922) [-475.185] (-479.074) (-474.527) * (-476.742) (-474.665) (-475.317) [-475.978] -- 0:00:17
      717000 -- (-474.904) (-475.123) [-479.265] (-474.247) * [-475.866] (-481.892) (-474.690) (-475.394) -- 0:00:17
      717500 -- (-476.855) (-474.060) (-477.537) [-475.142] * (-473.781) (-479.506) (-473.561) [-474.014] -- 0:00:17
      718000 -- [-474.211] (-475.139) (-477.046) (-473.226) * (-478.916) [-474.442] (-474.311) (-473.700) -- 0:00:17
      718500 -- (-473.134) (-476.024) [-477.675] (-474.390) * (-476.345) (-473.240) (-481.967) [-474.991] -- 0:00:17
      719000 -- (-476.239) [-475.147] (-480.589) (-476.345) * (-474.540) (-474.557) [-478.005] (-476.927) -- 0:00:17
      719500 -- [-474.133] (-473.230) (-476.661) (-473.199) * (-474.971) [-475.263] (-475.665) (-476.253) -- 0:00:17
      720000 -- (-478.670) (-473.920) (-475.846) [-476.632] * (-476.693) [-476.730] (-473.482) (-473.722) -- 0:00:17

      Average standard deviation of split frequencies: 0.007762

      720500 -- [-477.171] (-474.175) (-474.536) (-475.139) * (-476.812) (-476.647) (-474.568) [-473.685] -- 0:00:17
      721000 -- (-475.093) (-478.626) [-477.042] (-476.951) * [-473.828] (-476.429) (-473.212) (-475.773) -- 0:00:17
      721500 -- [-474.789] (-476.493) (-473.587) (-479.531) * (-473.749) (-476.627) (-479.346) [-474.820] -- 0:00:17
      722000 -- (-474.639) [-474.876] (-475.265) (-477.422) * (-473.168) (-478.321) [-478.505] (-473.945) -- 0:00:17
      722500 -- (-474.531) [-474.469] (-475.744) (-474.507) * (-477.320) [-474.771] (-477.690) (-474.483) -- 0:00:17
      723000 -- (-474.758) (-474.643) (-473.459) [-475.294] * (-474.842) [-474.040] (-478.431) (-474.325) -- 0:00:17
      723500 -- [-474.534] (-475.709) (-480.036) (-479.020) * [-475.297] (-474.266) (-476.481) (-475.229) -- 0:00:17
      724000 -- (-474.600) [-475.079] (-479.172) (-473.305) * (-474.829) (-475.079) (-474.066) [-473.395] -- 0:00:17
      724500 -- [-474.035] (-477.997) (-479.154) (-474.761) * (-476.424) [-474.912] (-473.441) (-479.642) -- 0:00:17
      725000 -- (-474.171) (-473.458) [-476.196] (-475.654) * [-477.602] (-475.232) (-474.407) (-475.930) -- 0:00:17

      Average standard deviation of split frequencies: 0.008888

      725500 -- (-474.430) (-488.536) (-474.602) [-475.157] * (-474.134) (-476.801) [-474.621] (-475.563) -- 0:00:17
      726000 -- (-474.882) (-475.176) [-474.445] (-480.314) * (-475.787) (-474.907) (-478.106) [-477.039] -- 0:00:17
      726500 -- (-475.254) [-473.850] (-476.865) (-475.015) * [-475.205] (-474.230) (-475.147) (-475.367) -- 0:00:17
      727000 -- [-474.469] (-475.041) (-475.109) (-478.490) * (-474.910) (-478.785) [-473.948] (-473.214) -- 0:00:17
      727500 -- (-477.270) [-474.294] (-474.560) (-475.661) * (-481.104) [-474.795] (-474.201) (-473.705) -- 0:00:17
      728000 -- [-473.650] (-474.238) (-474.953) (-475.133) * (-476.148) (-474.301) (-475.552) [-473.301] -- 0:00:17
      728500 -- [-476.043] (-476.866) (-474.764) (-475.455) * (-474.328) (-476.548) (-476.308) [-472.933] -- 0:00:17
      729000 -- (-477.100) (-476.857) (-476.087) [-473.974] * (-477.765) (-474.406) [-473.485] (-481.947) -- 0:00:17
      729500 -- (-474.446) [-477.880] (-473.304) (-481.345) * (-476.251) [-474.449] (-475.331) (-473.850) -- 0:00:17
      730000 -- (-474.584) (-474.440) [-474.146] (-477.706) * (-474.765) (-475.547) (-477.392) [-476.285] -- 0:00:17

      Average standard deviation of split frequencies: 0.009315

      730500 -- (-478.592) (-473.411) (-475.479) [-474.215] * (-474.784) (-478.335) [-474.850] (-473.693) -- 0:00:16
      731000 -- (-479.146) [-474.015] (-473.616) (-476.176) * (-475.418) (-476.613) [-475.365] (-474.325) -- 0:00:16
      731500 -- (-477.391) (-473.874) (-473.247) [-476.981] * (-476.182) (-475.126) [-475.650] (-474.408) -- 0:00:16
      732000 -- (-473.926) (-475.329) (-476.889) [-474.639] * (-474.810) (-475.685) (-474.343) [-473.847] -- 0:00:16
      732500 -- (-475.283) [-473.755] (-477.602) (-476.172) * [-475.884] (-474.026) (-473.361) (-474.937) -- 0:00:16
      733000 -- (-474.636) [-475.896] (-476.526) (-475.972) * (-475.685) (-474.814) (-475.436) [-474.829] -- 0:00:16
      733500 -- (-473.898) (-475.045) [-480.008] (-482.078) * (-477.377) [-476.652] (-476.236) (-473.920) -- 0:00:16
      734000 -- (-474.720) (-473.316) (-475.690) [-478.353] * [-477.718] (-476.396) (-476.748) (-473.282) -- 0:00:16
      734500 -- (-475.438) (-476.759) [-474.056] (-476.603) * (-474.854) [-474.619] (-474.531) (-477.242) -- 0:00:16
      735000 -- (-473.650) (-475.720) [-476.047] (-480.135) * (-475.973) (-480.681) (-478.024) [-473.457] -- 0:00:16

      Average standard deviation of split frequencies: 0.008028

      735500 -- [-473.632] (-478.245) (-475.664) (-476.018) * (-475.261) [-483.170] (-476.613) (-474.110) -- 0:00:16
      736000 -- [-476.366] (-474.259) (-474.077) (-473.992) * [-475.194] (-474.541) (-475.133) (-473.836) -- 0:00:16
      736500 -- (-476.687) (-474.744) (-476.843) [-474.858] * (-478.504) [-477.553] (-477.987) (-475.380) -- 0:00:16
      737000 -- (-477.831) [-474.274] (-473.796) (-475.242) * (-475.588) (-475.604) (-485.670) [-475.412] -- 0:00:16
      737500 -- (-476.307) (-473.463) [-474.234] (-477.160) * [-477.311] (-475.926) (-474.764) (-476.158) -- 0:00:16
      738000 -- (-480.424) (-473.675) (-474.645) [-475.561] * (-475.449) (-474.292) [-474.037] (-477.312) -- 0:00:16
      738500 -- [-475.444] (-473.370) (-476.391) (-477.008) * (-473.678) [-473.366] (-474.522) (-476.847) -- 0:00:16
      739000 -- (-476.417) (-473.691) (-475.880) [-480.619] * [-477.933] (-478.331) (-474.386) (-475.352) -- 0:00:16
      739500 -- [-476.518] (-476.733) (-478.918) (-476.368) * (-477.007) (-475.105) [-474.192] (-474.253) -- 0:00:16
      740000 -- (-475.460) (-476.916) [-473.782] (-478.419) * (-474.468) (-473.630) (-474.155) [-473.097] -- 0:00:16

      Average standard deviation of split frequencies: 0.009746

      740500 -- (-475.839) (-474.209) [-475.908] (-475.621) * [-474.434] (-478.188) (-478.241) (-478.242) -- 0:00:16
      741000 -- [-474.320] (-474.014) (-476.846) (-474.690) * (-480.527) (-476.295) [-474.005] (-476.893) -- 0:00:16
      741500 -- (-475.595) [-479.470] (-474.434) (-474.915) * (-473.414) [-475.828] (-475.176) (-478.421) -- 0:00:16
      742000 -- (-478.242) [-477.665] (-473.550) (-475.022) * (-473.767) [-478.481] (-473.074) (-475.124) -- 0:00:16
      742500 -- [-475.521] (-480.573) (-474.037) (-476.599) * (-477.126) (-475.667) [-472.993] (-475.438) -- 0:00:16
      743000 -- (-474.164) [-477.476] (-477.175) (-477.071) * (-475.463) [-474.501] (-474.354) (-476.828) -- 0:00:16
      743500 -- [-474.046] (-474.445) (-477.254) (-476.774) * (-475.848) (-474.294) [-476.597] (-474.153) -- 0:00:16
      744000 -- (-474.050) (-474.375) [-473.978] (-478.481) * [-477.130] (-477.146) (-475.082) (-474.050) -- 0:00:16
      744500 -- (-474.182) [-473.876] (-476.312) (-478.143) * (-474.275) [-476.686] (-476.317) (-473.825) -- 0:00:16
      745000 -- (-476.237) (-474.263) (-475.241) [-474.819] * (-476.027) (-475.862) [-476.025] (-474.472) -- 0:00:16

      Average standard deviation of split frequencies: 0.009874

      745500 -- (-474.362) (-477.030) [-474.450] (-474.899) * (-474.133) [-475.317] (-475.738) (-474.691) -- 0:00:16
      746000 -- (-476.032) [-474.635] (-475.462) (-473.680) * [-475.394] (-477.301) (-475.501) (-481.246) -- 0:00:16
      746500 -- [-477.702] (-475.219) (-478.758) (-474.650) * [-478.412] (-477.033) (-475.733) (-478.444) -- 0:00:15
      747000 -- (-474.518) (-474.789) [-474.706] (-476.885) * (-476.560) [-474.701] (-475.465) (-476.256) -- 0:00:15
      747500 -- (-477.856) (-473.425) [-476.672] (-480.135) * (-474.255) [-475.695] (-473.628) (-473.929) -- 0:00:15
      748000 -- (-476.500) [-473.963] (-477.074) (-481.702) * [-474.118] (-475.844) (-474.336) (-474.723) -- 0:00:15
      748500 -- (-476.400) (-475.006) [-475.300] (-474.440) * [-477.516] (-475.236) (-474.728) (-474.134) -- 0:00:15
      749000 -- (-475.697) (-475.215) (-475.312) [-475.223] * [-476.660] (-475.249) (-474.167) (-476.656) -- 0:00:15
      749500 -- (-476.780) (-474.775) (-474.895) [-476.058] * (-475.899) [-477.965] (-476.411) (-474.100) -- 0:00:15
      750000 -- (-475.421) (-477.721) [-475.378] (-477.458) * (-474.813) (-476.120) (-479.206) [-474.221] -- 0:00:15

      Average standard deviation of split frequencies: 0.009616

      750500 -- (-481.570) (-476.814) (-474.803) [-476.724] * [-473.238] (-473.501) (-477.038) (-476.616) -- 0:00:15
      751000 -- [-479.739] (-476.972) (-475.247) (-476.284) * (-475.026) (-476.857) (-475.644) [-475.230] -- 0:00:15
      751500 -- (-476.253) (-475.258) (-474.494) [-476.181] * (-476.186) (-475.269) [-473.982] (-474.039) -- 0:00:15
      752000 -- (-477.421) (-473.603) (-474.422) [-477.525] * [-477.074] (-473.973) (-477.359) (-475.705) -- 0:00:15
      752500 -- (-473.836) (-481.645) [-476.296] (-478.519) * [-476.341] (-475.045) (-474.125) (-476.971) -- 0:00:15
      753000 -- (-474.896) (-473.162) (-475.272) [-475.202] * (-473.396) (-474.942) [-473.626] (-475.074) -- 0:00:15
      753500 -- (-475.226) (-476.011) (-474.837) [-478.313] * (-476.814) [-476.725] (-476.537) (-473.893) -- 0:00:15
      754000 -- (-474.294) (-478.225) (-479.467) [-475.695] * (-478.350) [-473.396] (-477.318) (-474.300) -- 0:00:15
      754500 -- (-475.370) [-476.098] (-478.118) (-480.784) * (-475.879) [-477.888] (-473.988) (-475.562) -- 0:00:15
      755000 -- (-479.340) [-475.132] (-474.819) (-474.697) * (-474.155) (-478.486) [-475.449] (-478.648) -- 0:00:15

      Average standard deviation of split frequencies: 0.009119

      755500 -- (-479.095) [-476.200] (-475.021) (-474.966) * (-475.015) [-476.007] (-476.577) (-475.536) -- 0:00:15
      756000 -- [-474.222] (-476.796) (-475.776) (-476.744) * (-473.704) (-476.454) (-475.545) [-474.845] -- 0:00:15
      756500 -- (-474.944) (-473.189) (-477.515) [-474.247] * (-474.481) (-475.277) (-475.205) [-476.569] -- 0:00:15
      757000 -- (-475.698) (-474.029) [-474.670] (-476.900) * (-473.888) (-479.111) (-475.235) [-478.657] -- 0:00:15
      757500 -- [-476.995] (-477.079) (-476.584) (-480.882) * (-477.971) [-476.084] (-474.735) (-476.871) -- 0:00:15
      758000 -- (-477.550) (-475.416) (-474.979) [-477.379] * (-477.791) (-473.916) (-475.818) [-474.239] -- 0:00:15
      758500 -- (-474.602) [-477.672] (-474.874) (-475.069) * (-476.323) [-474.693] (-474.249) (-473.829) -- 0:00:15
      759000 -- (-473.933) (-487.168) (-475.951) [-475.238] * (-475.762) (-483.834) (-474.404) [-479.388] -- 0:00:15
      759500 -- (-476.817) (-478.208) [-475.762] (-476.787) * (-475.187) (-474.845) [-479.195] (-480.436) -- 0:00:15
      760000 -- (-476.920) [-474.099] (-476.029) (-474.743) * (-480.453) [-474.966] (-474.591) (-476.711) -- 0:00:15

      Average standard deviation of split frequencies: 0.009141

      760500 -- (-476.990) (-475.870) [-474.570] (-477.902) * [-477.369] (-473.676) (-473.311) (-480.649) -- 0:00:15
      761000 -- (-476.059) [-475.492] (-474.874) (-475.294) * (-474.242) (-477.237) [-475.906] (-480.715) -- 0:00:15
      761500 -- (-475.390) (-473.475) [-475.131] (-479.132) * (-474.855) [-475.234] (-476.304) (-476.525) -- 0:00:15
      762000 -- (-474.958) (-473.417) [-475.416] (-475.731) * (-474.676) [-477.574] (-475.833) (-476.381) -- 0:00:14
      762500 -- (-475.259) [-474.871] (-477.456) (-479.168) * [-473.969] (-475.460) (-475.577) (-477.367) -- 0:00:14
      763000 -- (-475.500) (-477.230) (-473.885) [-473.459] * (-473.465) (-474.360) [-473.967] (-474.162) -- 0:00:14
      763500 -- (-474.211) (-475.031) (-473.463) [-474.116] * (-475.259) (-477.097) (-475.517) [-476.327] -- 0:00:14
      764000 -- (-476.532) (-475.696) (-474.575) [-475.169] * [-476.723] (-480.150) (-476.508) (-476.172) -- 0:00:14
      764500 -- (-475.140) [-477.812] (-474.915) (-475.251) * (-473.374) (-475.253) (-474.975) [-473.102] -- 0:00:14
      765000 -- (-474.400) (-474.443) (-475.969) [-475.294] * [-474.689] (-474.445) (-475.546) (-473.996) -- 0:00:14

      Average standard deviation of split frequencies: 0.009577

      765500 -- [-477.234] (-475.702) (-479.925) (-474.049) * (-475.617) [-474.609] (-474.503) (-473.412) -- 0:00:14
      766000 -- (-473.261) (-474.933) (-476.298) [-475.377] * (-474.666) (-474.591) (-474.929) [-473.628] -- 0:00:14
      766500 -- [-474.841] (-475.915) (-475.962) (-473.859) * (-477.290) [-474.472] (-479.255) (-475.036) -- 0:00:14
      767000 -- (-477.206) [-475.246] (-478.258) (-476.762) * [-475.039] (-473.811) (-481.639) (-477.932) -- 0:00:14
      767500 -- (-481.857) [-476.744] (-476.278) (-478.682) * [-474.540] (-474.654) (-477.245) (-475.329) -- 0:00:14
      768000 -- [-474.806] (-473.788) (-475.751) (-476.945) * (-473.433) (-473.070) [-483.481] (-476.291) -- 0:00:14
      768500 -- (-473.214) [-475.263] (-476.588) (-474.249) * [-476.028] (-474.110) (-479.112) (-474.689) -- 0:00:14
      769000 -- [-474.419] (-475.506) (-473.251) (-474.495) * (-476.415) [-478.486] (-475.768) (-475.562) -- 0:00:14
      769500 -- (-473.816) (-474.826) [-474.931] (-478.287) * (-474.679) (-475.557) [-475.541] (-473.071) -- 0:00:14
      770000 -- (-475.082) (-477.677) [-474.834] (-479.024) * (-474.631) [-473.545] (-474.618) (-474.658) -- 0:00:14

      Average standard deviation of split frequencies: 0.009481

      770500 -- (-474.681) (-479.283) (-476.479) [-475.085] * (-475.656) (-475.605) [-474.685] (-477.988) -- 0:00:14
      771000 -- [-474.882] (-480.182) (-475.578) (-479.353) * [-476.319] (-473.605) (-473.398) (-473.536) -- 0:00:14
      771500 -- [-475.167] (-476.252) (-475.299) (-477.975) * (-473.691) (-476.343) [-473.396] (-472.961) -- 0:00:14
      772000 -- (-476.708) (-475.967) (-474.910) [-475.742] * [-473.021] (-476.177) (-475.032) (-475.400) -- 0:00:14
      772500 -- (-477.641) [-473.885] (-475.849) (-476.483) * [-474.575] (-475.339) (-479.781) (-475.443) -- 0:00:14
      773000 -- (-478.126) (-475.160) [-478.228] (-475.867) * [-474.557] (-473.948) (-473.991) (-475.621) -- 0:00:14
      773500 -- (-475.651) (-475.073) [-476.426] (-476.390) * (-475.484) [-474.321] (-473.659) (-475.706) -- 0:00:14
      774000 -- (-474.383) (-477.396) (-477.604) [-474.090] * (-476.311) (-474.495) (-479.269) [-475.834] -- 0:00:14
      774500 -- [-476.316] (-476.551) (-479.702) (-478.764) * (-477.426) [-477.185] (-474.348) (-474.463) -- 0:00:14
      775000 -- (-476.039) (-477.098) [-476.315] (-474.973) * [-477.036] (-474.196) (-474.383) (-475.314) -- 0:00:14

      Average standard deviation of split frequencies: 0.009378

      775500 -- [-476.216] (-476.957) (-474.795) (-474.954) * [-476.462] (-478.596) (-474.342) (-475.716) -- 0:00:14
      776000 -- (-476.068) [-475.738] (-473.987) (-473.986)