--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:40:18 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1791/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -620.41 -625.77
2 -620.38 -623.73
--------------------------------------
TOTAL -620.39 -625.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.865833 0.086695 0.340758 1.451811 0.836178 1285.48 1393.24 1.000
r(A<->C){all} 0.161958 0.021130 0.000011 0.464701 0.120334 123.59 130.89 1.000
r(A<->G){all} 0.153233 0.018852 0.000036 0.442132 0.114065 154.95 191.29 1.006
r(A<->T){all} 0.159553 0.017412 0.000035 0.414172 0.127125 260.50 271.26 1.001
r(C<->G){all} 0.200925 0.023409 0.000070 0.500779 0.165720 250.38 284.18 1.003
r(C<->T){all} 0.185964 0.023766 0.000027 0.501653 0.145063 186.51 198.12 1.002
r(G<->T){all} 0.138368 0.015740 0.000022 0.401241 0.100684 212.33 215.48 1.001
pi(A){all} 0.210028 0.000370 0.174906 0.248994 0.209669 1342.02 1363.02 1.000
pi(C){all} 0.261304 0.000453 0.221161 0.302233 0.260626 1355.67 1397.75 1.000
pi(G){all} 0.303754 0.000476 0.260367 0.345155 0.303622 1248.18 1339.88 1.000
pi(T){all} 0.224915 0.000386 0.188301 0.265534 0.225321 1256.43 1318.18 1.000
alpha{1,2} 0.333310 0.150203 0.000414 1.127768 0.205734 1072.64 1273.92 1.000
alpha{3} 0.422644 0.234523 0.000177 1.394305 0.246271 1250.96 1287.12 1.001
pinvar{all} 0.991684 0.000052 0.978301 0.999931 0.993592 1155.08 1328.04 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -602.274263
Model 2: PositiveSelection -602.009708
Model 0: one-ratio -602.009693
Model 7: beta -602.274263
Model 8: beta&w>1 -602.009708
Model 0 vs 1 0.5291400000000976
Model 2 vs 1 0.529109999999946
Model 8 vs 7 0.529109999999946
>C1
LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
>C2
LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
>C3
LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
>C4
LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
>C5
LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRAAMVR
LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
>C6
LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=147
C1 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
C2 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
C3 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
C4 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
C5 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRAAMVR
C6 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
*********************************************.****
C1 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
C2 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
C3 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
C4 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
C5 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
C6 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
**************************************************
C1 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
C2 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
C3 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
C4 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
C5 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
C6 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
***********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4410]--->[4410]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.466 Mb, Max= 30.680 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
C2 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
C3 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
C4 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
C5 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRAAMVR
C6 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
*********************************************.****
C1 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
C2 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
C3 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
C4 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
C5 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
C6 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
**************************************************
C1 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
C2 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
C3 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
C4 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
C5 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
C6 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
***********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 99.32 C1 C5 99.32
TOP 4 0 99.32 C5 C1 99.32
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 99.32 C2 C5 99.32
TOP 4 1 99.32 C5 C2 99.32
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 99.32 C3 C5 99.32
TOP 4 2 99.32 C5 C3 99.32
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 99.32 C4 C5 99.32
TOP 4 3 99.32 C5 C4 99.32
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 99.32 C5 C6 99.32
TOP 5 4 99.32 C6 C5 99.32
AVG 0 C1 * 99.86
AVG 1 C2 * 99.86
AVG 2 C3 * 99.86
AVG 3 C4 * 99.86
AVG 4 C5 * 99.32
AVG 5 C6 * 99.86
TOT TOT * 99.77
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC
C2 TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC
C3 TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC
C4 TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC
C5 TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC
C6 TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC
**************************************************
C1 CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG
C2 CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG
C3 CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG
C4 CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG
C5 CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG
C6 CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG
**************************************************
C1 GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGGCGCAATGGTTCGT
C2 GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGGCGCAATGGTTCGT
C3 GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGGCGCAATGGTTCGT
C4 GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGGCGCAATGGTTCGT
C5 GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGCCGCAATGGTTCGT
C6 GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGGCGCAATGGTTCGT
************************************ *************
C1 CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC
C2 CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC
C3 CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC
C4 CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC
C5 CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC
C6 CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC
**************************************************
C1 AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG
C2 AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG
C3 AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG
C4 AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG
C5 AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG
C6 AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG
**************************************************
C1 TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC
C2 TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC
C3 TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC
C4 TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC
C5 TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC
C6 TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC
**************************************************
C1 GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC
C2 GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC
C3 GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC
C4 GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC
C5 GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC
C6 GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC
**************************************************
C1 ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT
C2 ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT
C3 ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT
C4 ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT
C5 ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT
C6 ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT
**************************************************
C1 ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC
C2 ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC
C3 ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC
C4 ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC
C5 ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC
C6 ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC
*****************************************
>C1
TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC
CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG
GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGGCGCAATGGTTCGT
CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC
AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG
TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC
GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC
ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT
ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC
>C2
TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC
CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG
GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGGCGCAATGGTTCGT
CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC
AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG
TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC
GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC
ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT
ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC
>C3
TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC
CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG
GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGGCGCAATGGTTCGT
CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC
AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG
TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC
GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC
ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT
ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC
>C4
TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC
CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG
GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGGCGCAATGGTTCGT
CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC
AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG
TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC
GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC
ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT
ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC
>C5
TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC
CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG
GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGCCGCAATGGTTCGT
CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC
AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG
TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC
GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC
ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT
ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC
>C6
TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC
CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG
GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGGCGCAATGGTTCGT
CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC
AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG
TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC
GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC
ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT
ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC
>C1
LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
>C2
LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
>C3
LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
>C4
LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
>C5
LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRAAMVR
LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
>C6
LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 441 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579858714
Setting output file names to "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 41586110
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5865558515
Seed = 1338452791
Swapseed = 1579858714
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -990.380453 -- -24.965149
Chain 2 -- -990.380453 -- -24.965149
Chain 3 -- -990.380396 -- -24.965149
Chain 4 -- -990.382003 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -990.380453 -- -24.965149
Chain 2 -- -990.381787 -- -24.965149
Chain 3 -- -990.381946 -- -24.965149
Chain 4 -- -990.381787 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-990.380] (-990.380) (-990.380) (-990.382) * [-990.380] (-990.382) (-990.382) (-990.382)
500 -- (-626.638) [-624.493] (-627.176) (-627.109) * (-627.385) [-624.925] (-626.812) (-626.460) -- 0:00:00
1000 -- [-623.580] (-625.938) (-630.250) (-626.467) * (-627.374) [-625.220] (-622.626) (-628.792) -- 0:00:00
1500 -- (-633.978) (-628.894) [-633.159] (-621.605) * (-618.464) (-631.276) [-626.552] (-623.826) -- 0:00:00
2000 -- (-625.928) [-627.502] (-630.980) (-624.034) * (-624.948) [-624.388] (-629.478) (-628.540) -- 0:00:00
2500 -- [-625.504] (-627.904) (-626.028) (-625.649) * (-624.183) [-626.563] (-628.865) (-632.722) -- 0:06:39
3000 -- (-630.353) [-620.853] (-629.325) (-627.399) * (-630.115) [-620.664] (-628.108) (-627.601) -- 0:05:32
3500 -- (-630.538) [-625.646] (-628.292) (-624.729) * (-624.245) (-627.555) (-622.808) [-626.935] -- 0:04:44
4000 -- (-627.698) [-629.441] (-626.611) (-631.226) * (-623.085) [-632.339] (-627.869) (-632.383) -- 0:04:09
4500 -- (-623.372) (-628.557) [-627.334] (-639.883) * [-623.871] (-629.885) (-627.014) (-635.513) -- 0:03:41
5000 -- (-623.692) (-626.592) [-634.025] (-629.917) * [-629.361] (-638.004) (-626.659) (-627.593) -- 0:03:19
Average standard deviation of split frequencies: 0.098209
5500 -- (-625.532) (-628.753) (-629.874) [-624.021] * (-627.521) [-619.664] (-629.072) (-629.606) -- 0:03:00
6000 -- (-626.940) [-626.541] (-624.475) (-632.680) * [-629.155] (-626.801) (-628.548) (-629.415) -- 0:02:45
6500 -- (-629.343) (-625.265) [-627.385] (-634.070) * [-626.316] (-624.806) (-636.526) (-626.958) -- 0:02:32
7000 -- [-628.137] (-625.678) (-623.844) (-631.756) * [-626.353] (-626.927) (-631.162) (-627.584) -- 0:02:21
7500 -- (-629.172) (-627.428) (-627.030) [-628.287] * [-625.808] (-628.766) (-623.345) (-626.039) -- 0:02:12
8000 -- [-630.068] (-628.876) (-634.718) (-623.194) * (-627.869) [-630.867] (-628.610) (-630.281) -- 0:02:04
8500 -- (-628.881) (-624.165) [-632.220] (-625.572) * (-631.451) [-630.050] (-629.759) (-629.920) -- 0:01:56
9000 -- (-625.519) (-624.192) (-623.637) [-626.032] * (-636.659) [-622.110] (-627.613) (-627.427) -- 0:01:50
9500 -- (-622.234) (-624.599) [-626.707] (-625.179) * [-628.711] (-625.715) (-634.384) (-626.595) -- 0:01:44
10000 -- [-623.252] (-620.970) (-633.320) (-619.974) * (-624.258) [-625.552] (-627.031) (-633.412) -- 0:01:39
Average standard deviation of split frequencies: 0.060265
10500 -- (-638.229) [-623.725] (-625.773) (-620.072) * [-622.449] (-621.657) (-631.654) (-627.757) -- 0:01:34
11000 -- (-624.648) (-627.908) (-626.665) [-620.421] * (-633.034) [-629.043] (-622.642) (-620.980) -- 0:01:29
11500 -- (-626.719) (-632.582) [-623.801] (-621.856) * (-630.511) (-632.449) [-624.588] (-620.475) -- 0:01:25
12000 -- (-627.115) [-629.526] (-634.015) (-620.455) * (-627.490) [-629.384] (-622.616) (-620.295) -- 0:01:22
12500 -- (-627.561) [-629.866] (-622.044) (-621.477) * (-628.089) (-628.195) [-626.768] (-620.661) -- 0:01:19
13000 -- (-627.217) (-626.500) (-619.163) [-619.993] * (-627.185) (-622.108) (-641.228) [-623.143] -- 0:01:15
13500 -- (-631.278) [-623.507] (-622.889) (-621.339) * (-622.819) (-627.743) (-627.482) [-621.770] -- 0:01:13
14000 -- [-622.737] (-631.954) (-620.311) (-623.191) * [-624.194] (-626.946) (-638.429) (-621.384) -- 0:01:10
14500 -- [-626.082] (-619.766) (-621.480) (-623.295) * (-622.527) (-623.728) [-624.177] (-620.327) -- 0:01:07
15000 -- [-626.747] (-625.517) (-621.929) (-621.814) * (-623.635) (-631.498) [-622.932] (-621.837) -- 0:01:05
Average standard deviation of split frequencies: 0.046299
15500 -- (-627.386) [-624.532] (-623.853) (-622.214) * (-627.421) [-626.827] (-623.873) (-619.640) -- 0:01:03
16000 -- (-631.431) (-629.319) (-619.241) [-621.996] * [-626.780] (-628.293) (-628.159) (-619.552) -- 0:02:03
16500 -- [-629.877] (-630.125) (-621.079) (-624.077) * [-619.762] (-621.336) (-626.678) (-624.259) -- 0:01:59
17000 -- (-632.261) [-631.930] (-623.184) (-620.351) * (-627.427) (-623.307) (-630.584) [-619.919] -- 0:01:55
17500 -- [-622.507] (-631.109) (-623.175) (-624.167) * [-630.265] (-625.132) (-625.027) (-619.755) -- 0:01:52
18000 -- (-630.912) (-627.840) [-622.385] (-623.622) * [-624.367] (-622.852) (-628.228) (-626.197) -- 0:01:49
18500 -- (-625.826) (-634.018) [-621.954] (-623.794) * [-621.703] (-621.542) (-631.120) (-622.225) -- 0:01:46
19000 -- (-633.686) (-627.135) [-626.443] (-622.989) * (-625.144) (-622.199) (-619.148) [-619.995] -- 0:01:43
19500 -- [-627.875] (-623.299) (-620.125) (-618.893) * (-624.005) [-620.596] (-620.130) (-622.317) -- 0:01:40
20000 -- (-629.679) [-622.170] (-621.050) (-620.793) * (-625.957) (-620.607) (-622.682) [-620.039] -- 0:01:38
Average standard deviation of split frequencies: 0.041058
20500 -- (-638.500) [-626.918] (-623.511) (-620.550) * (-632.592) (-623.180) (-618.948) [-622.427] -- 0:01:35
21000 -- (-622.336) [-628.310] (-621.893) (-622.366) * (-627.111) (-620.197) [-619.140] (-619.138) -- 0:01:33
21500 -- (-625.534) [-626.272] (-626.460) (-620.337) * (-637.346) (-620.767) [-619.278] (-619.050) -- 0:01:31
22000 -- (-621.769) (-634.305) [-621.401] (-621.481) * (-631.094) (-624.533) [-619.149] (-621.450) -- 0:01:28
22500 -- (-625.602) (-627.725) (-621.252) [-622.445] * [-627.622] (-619.216) (-621.604) (-621.429) -- 0:01:26
23000 -- (-623.441) [-630.790] (-623.127) (-620.545) * [-623.816] (-621.157) (-620.522) (-620.998) -- 0:01:24
23500 -- [-620.535] (-635.357) (-622.477) (-623.460) * (-635.282) (-620.817) (-619.039) [-624.606] -- 0:01:23
24000 -- [-618.343] (-634.566) (-622.099) (-620.280) * [-619.609] (-621.093) (-620.137) (-620.945) -- 0:01:21
24500 -- (-619.854) (-628.616) [-620.583] (-621.121) * [-623.281] (-619.249) (-621.497) (-619.783) -- 0:01:19
25000 -- [-620.154] (-627.800) (-619.989) (-622.860) * (-627.692) [-621.826] (-624.658) (-627.190) -- 0:01:18
Average standard deviation of split frequencies: 0.044896
25500 -- (-619.204) (-623.375) (-620.793) [-620.629] * (-628.680) [-618.987] (-623.541) (-621.904) -- 0:01:16
26000 -- (-621.549) [-630.395] (-620.144) (-623.164) * (-624.554) [-620.585] (-622.302) (-620.314) -- 0:01:14
26500 -- (-622.961) (-625.592) (-620.246) [-621.703] * (-627.723) (-623.551) (-619.365) [-618.910] -- 0:01:13
27000 -- (-627.633) (-631.897) (-617.985) [-622.083] * (-629.460) [-624.887] (-622.002) (-623.313) -- 0:01:12
27500 -- (-619.991) (-623.616) (-620.244) [-621.503] * (-622.292) (-622.895) [-622.267] (-626.471) -- 0:01:10
28000 -- (-621.178) (-621.006) [-619.709] (-621.166) * (-627.455) (-622.294) (-620.342) [-623.073] -- 0:01:09
28500 -- [-620.477] (-624.785) (-620.787) (-620.155) * [-620.010] (-620.327) (-620.160) (-621.466) -- 0:01:08
29000 -- [-618.233] (-625.578) (-621.730) (-623.918) * [-624.194] (-621.655) (-620.579) (-621.071) -- 0:01:06
29500 -- (-623.120) (-621.328) (-623.075) [-620.041] * (-622.616) (-624.835) (-620.161) [-623.598] -- 0:01:05
30000 -- (-622.293) [-618.582] (-621.509) (-622.062) * (-624.312) (-619.859) [-621.552] (-620.481) -- 0:01:37
Average standard deviation of split frequencies: 0.036893
30500 -- (-624.080) [-620.821] (-622.269) (-621.455) * [-627.224] (-622.023) (-622.543) (-621.033) -- 0:01:35
31000 -- [-620.528] (-622.882) (-621.257) (-621.337) * [-623.430] (-622.453) (-622.686) (-618.629) -- 0:01:33
31500 -- [-621.813] (-624.041) (-621.469) (-621.071) * [-630.557] (-621.674) (-622.351) (-622.307) -- 0:01:32
32000 -- [-621.202] (-623.443) (-627.216) (-620.652) * [-621.507] (-621.485) (-620.620) (-624.329) -- 0:01:30
32500 -- [-621.505] (-621.437) (-622.564) (-622.303) * (-623.769) (-621.653) (-621.322) [-618.886] -- 0:01:29
33000 -- (-622.838) (-619.828) (-621.635) [-622.516] * [-626.916] (-621.207) (-621.591) (-618.746) -- 0:01:27
33500 -- [-622.751] (-623.198) (-622.022) (-619.877) * (-624.665) [-620.755] (-620.508) (-623.155) -- 0:01:26
34000 -- (-622.158) [-620.498] (-622.658) (-619.478) * (-625.539) (-622.017) (-621.225) [-620.705] -- 0:01:25
34500 -- (-620.993) (-626.398) (-619.976) [-622.317] * (-631.248) (-624.771) [-624.297] (-620.636) -- 0:01:23
35000 -- (-621.156) (-626.741) [-620.371] (-620.811) * (-635.921) (-619.642) (-626.933) [-621.557] -- 0:01:22
Average standard deviation of split frequencies: 0.033048
35500 -- (-622.160) (-626.824) (-622.599) [-621.819] * (-625.446) [-619.698] (-621.651) (-622.192) -- 0:01:21
36000 -- (-621.160) (-621.967) [-622.619] (-619.532) * [-630.571] (-621.978) (-628.363) (-620.350) -- 0:01:20
36500 -- (-620.399) (-620.181) [-622.859] (-619.510) * [-622.544] (-619.850) (-621.031) (-620.359) -- 0:01:19
37000 -- (-621.291) (-625.047) (-622.130) [-619.523] * [-630.165] (-621.332) (-620.496) (-620.530) -- 0:01:18
37500 -- (-621.328) (-621.710) (-620.172) [-620.936] * (-624.145) (-620.604) (-622.889) [-620.650] -- 0:01:17
38000 -- (-622.930) (-620.822) [-623.183] (-622.416) * (-623.851) (-620.980) (-622.480) [-620.841] -- 0:01:15
38500 -- (-621.665) (-622.746) [-624.594] (-620.504) * (-625.602) (-622.150) (-621.862) [-626.697] -- 0:01:14
39000 -- (-620.473) (-623.887) (-621.408) [-622.320] * (-626.422) [-619.333] (-620.428) (-624.875) -- 0:01:13
39500 -- (-620.621) [-622.269] (-621.650) (-621.939) * (-625.420) (-619.807) (-621.988) [-621.195] -- 0:01:12
40000 -- [-619.873] (-620.984) (-621.138) (-623.167) * (-637.415) (-623.665) (-621.367) [-627.203] -- 0:01:12
Average standard deviation of split frequencies: 0.043792
40500 -- (-622.104) (-620.839) [-620.759] (-620.711) * (-628.552) (-625.999) [-623.711] (-622.322) -- 0:01:11
41000 -- (-623.257) (-623.300) [-620.212] (-621.505) * (-623.564) (-626.803) (-621.584) [-621.162] -- 0:01:10
41500 -- (-622.489) (-620.507) [-621.676] (-624.050) * (-623.091) (-623.246) [-620.569] (-621.496) -- 0:01:09
42000 -- [-619.825] (-619.134) (-619.658) (-621.951) * [-624.905] (-623.090) (-620.830) (-623.564) -- 0:01:08
42500 -- [-621.241] (-621.093) (-622.878) (-620.908) * (-627.062) [-623.636] (-621.398) (-622.212) -- 0:01:07
43000 -- (-622.410) [-618.627] (-622.467) (-623.512) * (-626.437) (-618.749) [-623.956] (-620.206) -- 0:01:06
43500 -- (-628.453) [-620.806] (-620.836) (-624.012) * [-620.888] (-623.994) (-621.108) (-617.550) -- 0:01:05
44000 -- (-625.907) (-617.934) [-619.960] (-620.507) * (-624.388) (-622.135) [-620.138] (-621.723) -- 0:01:26
44500 -- [-622.008] (-619.611) (-621.092) (-621.246) * [-622.791] (-619.655) (-622.903) (-622.057) -- 0:01:25
45000 -- [-620.999] (-622.318) (-622.906) (-620.783) * (-629.998) [-622.336] (-621.141) (-621.274) -- 0:01:24
Average standard deviation of split frequencies: 0.042529
45500 -- (-619.849) [-620.697] (-621.693) (-622.455) * (-628.050) (-619.395) (-620.690) [-622.128] -- 0:01:23
46000 -- (-620.822) [-619.352] (-621.766) (-624.839) * (-626.351) (-628.751) (-621.535) [-619.215] -- 0:01:22
46500 -- [-620.622] (-618.619) (-622.536) (-621.373) * (-622.637) [-620.420] (-623.239) (-623.585) -- 0:01:22
47000 -- (-621.153) [-619.758] (-621.912) (-621.634) * (-627.571) (-620.422) (-620.210) [-620.392] -- 0:01:21
47500 -- (-619.998) (-620.267) (-625.766) [-621.860] * [-624.180] (-626.597) (-621.562) (-619.759) -- 0:01:20
48000 -- [-618.964] (-619.635) (-622.081) (-623.356) * (-628.670) (-621.557) [-622.570] (-621.389) -- 0:01:19
48500 -- (-624.041) (-619.475) [-622.540] (-623.654) * [-623.003] (-620.749) (-623.809) (-621.149) -- 0:01:18
49000 -- (-620.974) (-621.765) (-619.824) [-621.689] * [-629.493] (-621.860) (-624.023) (-620.232) -- 0:01:17
49500 -- [-621.358] (-621.610) (-619.277) (-621.062) * [-625.281] (-621.223) (-625.691) (-620.987) -- 0:01:16
50000 -- (-622.114) (-619.794) [-621.666] (-621.657) * (-629.278) (-619.871) [-623.767] (-621.866) -- 0:01:16
Average standard deviation of split frequencies: 0.035747
50500 -- (-625.151) (-620.321) [-621.491] (-623.430) * [-625.782] (-620.998) (-623.157) (-618.840) -- 0:01:15
51000 -- (-621.384) [-620.014] (-621.030) (-620.686) * [-633.724] (-621.237) (-621.518) (-625.469) -- 0:01:14
51500 -- (-620.519) [-620.146] (-621.546) (-621.244) * (-640.382) (-621.503) [-621.048] (-620.877) -- 0:01:13
52000 -- (-621.478) [-619.502] (-624.224) (-624.098) * (-635.554) (-621.968) (-621.015) [-626.709] -- 0:01:12
52500 -- [-621.054] (-621.244) (-621.303) (-625.345) * [-628.735] (-620.814) (-622.274) (-622.098) -- 0:01:12
53000 -- (-622.469) (-623.324) [-621.720] (-621.934) * [-622.340] (-623.999) (-623.270) (-621.391) -- 0:01:11
53500 -- (-624.755) [-619.786] (-620.711) (-626.204) * (-630.613) (-621.365) [-619.878] (-621.138) -- 0:01:10
54000 -- (-620.246) (-621.092) (-622.766) [-625.578] * [-628.955] (-620.862) (-625.057) (-623.329) -- 0:01:10
54500 -- (-625.245) (-620.727) (-619.242) [-619.190] * [-625.098] (-622.347) (-623.088) (-622.900) -- 0:01:09
55000 -- (-620.760) [-621.442] (-619.945) (-623.079) * [-624.469] (-625.005) (-619.508) (-620.125) -- 0:01:08
Average standard deviation of split frequencies: 0.033672
55500 -- (-620.415) (-620.488) (-621.378) [-621.265] * [-624.665] (-624.178) (-624.237) (-621.185) -- 0:01:08
56000 -- (-620.097) (-620.074) (-621.560) [-618.991] * [-625.071] (-621.276) (-621.259) (-620.693) -- 0:01:07
56500 -- (-623.277) (-623.515) (-620.780) [-619.030] * (-631.366) [-620.149] (-618.668) (-618.074) -- 0:01:06
57000 -- (-626.594) [-620.846] (-622.819) (-623.070) * (-626.019) [-620.640] (-620.126) (-622.164) -- 0:01:22
57500 -- (-625.934) [-619.199] (-621.023) (-627.162) * (-623.718) [-620.365] (-621.057) (-621.289) -- 0:01:21
58000 -- (-625.030) (-619.156) [-620.510] (-628.971) * [-627.871] (-618.864) (-624.518) (-624.075) -- 0:01:21
58500 -- (-619.942) (-621.403) [-623.709] (-622.398) * (-628.019) [-623.520] (-621.193) (-621.032) -- 0:01:20
59000 -- (-622.699) (-620.451) (-621.608) [-621.385] * (-624.593) [-625.768] (-625.144) (-621.895) -- 0:01:19
59500 -- [-620.232] (-620.811) (-622.584) (-622.571) * (-627.381) [-621.134] (-625.453) (-619.647) -- 0:01:19
60000 -- (-623.997) (-623.768) (-622.436) [-621.095] * (-630.639) (-621.474) [-620.558] (-620.610) -- 0:01:18
Average standard deviation of split frequencies: 0.033801
60500 -- (-624.141) (-622.848) [-621.013] (-624.285) * [-623.926] (-620.045) (-621.615) (-623.555) -- 0:01:17
61000 -- (-621.112) (-625.728) (-622.291) [-619.157] * (-625.353) (-620.820) [-626.076] (-621.052) -- 0:01:16
61500 -- (-619.367) [-621.204] (-621.787) (-620.067) * [-627.740] (-620.715) (-624.694) (-620.936) -- 0:01:16
62000 -- [-621.229] (-625.013) (-623.283) (-619.426) * (-629.619) (-625.407) [-621.162] (-618.815) -- 0:01:15
62500 -- [-621.013] (-623.258) (-620.603) (-621.341) * [-625.412] (-629.631) (-620.711) (-620.135) -- 0:01:15
63000 -- (-620.882) (-621.122) [-623.246] (-620.877) * (-631.643) (-623.041) [-622.614] (-621.418) -- 0:01:14
63500 -- [-622.614] (-620.763) (-622.946) (-621.573) * (-634.985) (-623.845) (-624.576) [-621.721] -- 0:01:13
64000 -- [-621.148] (-623.678) (-620.293) (-619.631) * [-635.722] (-624.889) (-623.551) (-618.979) -- 0:01:13
64500 -- [-620.676] (-621.479) (-619.649) (-624.067) * (-634.976) (-621.565) (-620.916) [-618.705] -- 0:01:12
65000 -- [-622.696] (-620.274) (-620.868) (-621.518) * (-630.761) [-622.108] (-621.081) (-621.149) -- 0:01:11
Average standard deviation of split frequencies: 0.038774
65500 -- (-621.747) [-619.516] (-621.494) (-622.867) * (-624.843) (-623.033) [-620.260] (-619.402) -- 0:01:11
66000 -- [-620.899] (-621.213) (-621.571) (-621.388) * [-625.713] (-623.018) (-619.455) (-619.781) -- 0:01:10
66500 -- (-619.554) (-622.561) (-622.651) [-620.979] * [-622.719] (-622.798) (-621.008) (-619.936) -- 0:01:10
67000 -- (-621.015) (-624.099) [-622.807] (-620.457) * [-626.837] (-622.092) (-619.607) (-620.831) -- 0:01:09
67500 -- (-620.275) (-620.672) [-620.895] (-619.603) * (-628.206) (-623.556) [-619.754] (-622.020) -- 0:01:09
68000 -- (-621.515) [-620.525] (-622.329) (-619.388) * (-626.370) [-622.416] (-623.014) (-626.546) -- 0:01:08
68500 -- [-621.221] (-623.996) (-620.843) (-623.583) * (-632.134) (-628.547) (-620.186) [-627.922] -- 0:01:07
69000 -- (-622.496) (-622.921) (-621.030) [-620.728] * (-631.332) (-624.144) (-619.695) [-627.420] -- 0:01:07
69500 -- (-621.311) (-621.021) (-621.333) [-619.233] * (-626.396) (-620.869) (-620.928) [-619.333] -- 0:01:06
70000 -- (-617.764) (-620.349) (-622.091) [-618.688] * (-628.525) (-619.203) (-622.090) [-621.241] -- 0:01:06
Average standard deviation of split frequencies: 0.038119
70500 -- (-620.540) (-619.863) [-620.294] (-620.468) * [-630.721] (-620.052) (-619.711) (-619.698) -- 0:01:05
71000 -- (-620.486) (-621.702) [-619.319] (-618.756) * [-623.424] (-623.520) (-620.456) (-622.076) -- 0:01:18
71500 -- (-622.809) (-621.975) (-620.729) [-619.431] * [-621.091] (-621.250) (-626.669) (-622.257) -- 0:01:17
72000 -- (-620.904) (-623.458) (-622.092) [-621.498] * (-624.264) (-621.275) (-623.156) [-619.251] -- 0:01:17
72500 -- (-623.276) [-624.872] (-625.434) (-621.072) * (-625.711) (-622.818) [-622.884] (-619.942) -- 0:01:16
73000 -- (-626.137) (-623.407) (-625.640) [-622.367] * (-626.960) [-620.799] (-626.474) (-620.120) -- 0:01:16
73500 -- (-623.048) (-624.085) [-623.234] (-620.242) * [-626.031] (-621.884) (-622.001) (-620.320) -- 0:01:15
74000 -- (-624.607) (-621.184) (-620.838) [-620.616] * [-624.481] (-620.814) (-626.195) (-620.553) -- 0:01:15
74500 -- (-619.767) (-619.573) [-626.524] (-619.938) * [-631.012] (-622.171) (-620.763) (-620.719) -- 0:01:14
75000 -- [-621.295] (-620.223) (-619.190) (-625.284) * [-623.675] (-622.498) (-620.823) (-620.638) -- 0:01:14
Average standard deviation of split frequencies: 0.034558
75500 -- (-620.723) [-621.404] (-622.150) (-623.084) * [-628.570] (-620.859) (-619.948) (-621.248) -- 0:01:13
76000 -- (-621.700) (-619.459) [-618.067] (-623.890) * (-628.829) (-622.170) (-621.513) [-623.698] -- 0:01:12
76500 -- [-621.713] (-623.724) (-620.832) (-621.333) * (-622.663) (-621.188) [-622.180] (-624.513) -- 0:01:12
77000 -- (-620.918) [-622.937] (-621.296) (-622.828) * [-631.073] (-622.971) (-623.755) (-625.225) -- 0:01:11
77500 -- (-620.214) (-619.731) [-622.458] (-623.246) * (-629.627) (-622.027) [-623.127] (-623.436) -- 0:01:11
78000 -- (-618.007) [-622.167] (-621.807) (-622.552) * (-633.421) (-621.257) [-620.865] (-620.739) -- 0:01:10
78500 -- (-619.231) (-621.852) (-626.194) [-621.439] * (-628.811) [-622.276] (-623.312) (-623.010) -- 0:01:10
79000 -- (-619.846) (-625.801) [-621.397] (-621.188) * (-627.020) (-622.684) (-628.411) [-622.365] -- 0:01:09
79500 -- (-619.282) (-622.091) (-620.604) [-618.197] * (-630.711) (-621.031) [-620.837] (-623.420) -- 0:01:09
80000 -- (-619.344) (-621.264) (-619.988) [-620.100] * (-628.199) (-624.301) (-620.400) [-622.201] -- 0:01:09
Average standard deviation of split frequencies: 0.034089
80500 -- (-621.552) (-620.637) [-623.072] (-619.250) * (-622.804) [-620.478] (-620.985) (-622.717) -- 0:01:08
81000 -- [-622.073] (-622.138) (-622.896) (-620.814) * (-630.089) (-620.587) (-623.479) [-621.205] -- 0:01:08
81500 -- (-620.019) (-620.644) [-619.248] (-619.873) * (-628.180) [-620.966] (-621.777) (-622.276) -- 0:01:07
82000 -- [-623.395] (-619.809) (-625.245) (-619.272) * [-623.132] (-622.092) (-622.363) (-622.546) -- 0:01:07
82500 -- (-624.846) [-621.289] (-618.280) (-623.967) * (-628.051) (-623.723) [-622.076] (-621.115) -- 0:01:06
83000 -- (-619.690) (-621.453) (-619.114) [-621.565] * (-624.883) (-627.670) [-621.042] (-620.370) -- 0:01:06
83500 -- (-619.743) (-621.451) [-627.292] (-622.120) * [-622.937] (-622.554) (-621.212) (-620.680) -- 0:01:05
84000 -- (-619.856) (-622.708) (-625.842) [-626.748] * [-622.598] (-620.668) (-622.607) (-620.187) -- 0:01:05
84500 -- (-620.343) (-623.494) (-621.502) [-625.945] * [-623.151] (-623.408) (-623.918) (-625.153) -- 0:01:05
85000 -- (-620.929) (-618.305) [-621.211] (-621.841) * [-624.835] (-623.809) (-623.186) (-625.400) -- 0:01:15
Average standard deviation of split frequencies: 0.028190
85500 -- (-621.144) (-620.427) [-622.055] (-621.156) * [-625.897] (-623.077) (-620.962) (-625.719) -- 0:01:14
86000 -- (-623.512) [-619.730] (-619.356) (-619.616) * [-622.277] (-624.377) (-621.284) (-626.268) -- 0:01:14
86500 -- [-625.253] (-621.970) (-624.025) (-623.544) * (-622.553) (-622.390) [-621.606] (-623.825) -- 0:01:13
87000 -- (-619.461) [-621.607] (-622.613) (-623.859) * (-627.840) (-621.562) (-621.937) [-624.015] -- 0:01:13
87500 -- (-621.083) [-621.883] (-621.923) (-622.102) * [-622.914] (-621.901) (-620.625) (-621.541) -- 0:01:13
88000 -- (-623.632) (-622.088) [-621.443] (-620.135) * [-623.524] (-623.404) (-620.544) (-626.063) -- 0:01:12
88500 -- (-621.885) [-620.980] (-620.306) (-620.869) * (-629.379) [-623.496] (-624.693) (-628.053) -- 0:01:12
89000 -- (-619.999) [-619.900] (-625.377) (-621.695) * (-623.044) [-620.469] (-620.615) (-621.777) -- 0:01:11
89500 -- (-623.981) [-619.596] (-621.970) (-620.355) * (-624.452) (-623.745) [-618.801] (-622.470) -- 0:01:11
90000 -- (-621.020) (-622.907) [-623.218] (-621.524) * [-626.107] (-625.048) (-622.589) (-621.284) -- 0:01:10
Average standard deviation of split frequencies: 0.025737
90500 -- (-622.112) (-619.159) [-623.516] (-622.373) * (-627.899) (-620.971) (-621.219) [-621.722] -- 0:01:10
91000 -- (-624.995) (-619.513) (-622.361) [-622.537] * (-625.789) [-620.903] (-618.392) (-621.375) -- 0:01:09
91500 -- (-624.839) [-619.990] (-623.717) (-623.633) * (-623.958) (-620.870) (-620.326) [-622.216] -- 0:01:09
92000 -- (-625.308) [-621.167] (-624.378) (-620.458) * (-626.024) [-620.905] (-619.134) (-621.537) -- 0:01:09
92500 -- (-622.513) (-619.509) (-620.807) [-621.570] * (-623.768) (-619.202) [-619.765] (-621.286) -- 0:01:08
93000 -- [-619.487] (-620.303) (-620.296) (-620.071) * (-625.119) (-619.578) [-622.068] (-622.057) -- 0:01:08
93500 -- (-619.630) (-623.049) [-622.310] (-621.944) * (-629.317) [-619.464] (-621.908) (-620.944) -- 0:01:07
94000 -- (-620.994) (-626.958) (-622.818) [-619.944] * [-629.580] (-620.636) (-620.311) (-625.082) -- 0:01:07
94500 -- [-626.424] (-620.726) (-620.549) (-620.328) * (-621.723) (-621.595) (-623.569) [-624.115] -- 0:01:07
95000 -- (-621.806) (-627.041) (-620.738) [-621.416] * [-624.059] (-621.902) (-621.171) (-619.816) -- 0:01:06
Average standard deviation of split frequencies: 0.022343
95500 -- (-622.940) [-624.074] (-622.132) (-620.108) * (-622.559) [-619.218] (-622.926) (-621.469) -- 0:01:06
96000 -- (-623.174) (-624.813) (-621.385) [-618.861] * [-620.937] (-621.375) (-621.843) (-623.428) -- 0:01:05
96500 -- (-620.271) (-621.987) (-620.069) [-620.140] * (-628.189) [-618.393] (-621.420) (-623.719) -- 0:01:05
97000 -- [-622.380] (-622.573) (-622.470) (-620.290) * [-627.215] (-618.296) (-623.157) (-624.273) -- 0:01:05
97500 -- (-620.839) (-619.940) (-621.437) [-621.641] * [-625.141] (-622.456) (-622.182) (-622.676) -- 0:01:04
98000 -- (-621.931) [-622.767] (-626.212) (-622.878) * (-625.615) (-624.571) [-623.475] (-621.045) -- 0:01:04
98500 -- (-625.621) (-622.467) (-620.167) [-620.933] * [-626.135] (-623.727) (-626.003) (-619.703) -- 0:01:04
99000 -- (-623.038) (-621.371) (-623.047) [-623.081] * [-627.313] (-624.552) (-620.438) (-623.329) -- 0:01:12
99500 -- [-619.953] (-624.364) (-620.420) (-623.246) * [-633.774] (-622.152) (-622.501) (-621.269) -- 0:01:12
100000 -- (-618.657) (-624.705) [-620.630] (-621.725) * (-633.777) [-620.273] (-622.462) (-620.543) -- 0:01:12
Average standard deviation of split frequencies: 0.025386
100500 -- (-623.087) (-622.521) (-621.407) [-620.570] * (-625.963) [-622.178] (-622.827) (-625.377) -- 0:01:11
101000 -- [-621.885] (-622.317) (-623.044) (-622.221) * [-626.180] (-623.146) (-621.694) (-620.590) -- 0:01:11
101500 -- (-625.179) [-621.170] (-623.056) (-619.564) * [-622.262] (-623.210) (-620.293) (-622.857) -- 0:01:10
102000 -- (-619.576) (-622.559) [-623.406] (-624.787) * (-632.324) (-621.745) (-622.045) [-621.883] -- 0:01:10
102500 -- (-619.941) (-623.525) (-623.015) [-622.536] * (-629.226) (-623.548) [-622.392] (-618.899) -- 0:01:10
103000 -- [-619.785] (-624.059) (-621.760) (-625.337) * (-623.695) (-619.699) [-623.955] (-622.216) -- 0:01:09
103500 -- (-620.232) (-625.011) (-623.187) [-624.149] * [-627.382] (-621.755) (-621.062) (-619.153) -- 0:01:09
104000 -- [-617.712] (-620.963) (-621.577) (-620.888) * [-623.176] (-619.298) (-622.379) (-619.734) -- 0:01:08
104500 -- [-624.865] (-619.989) (-622.148) (-620.042) * [-620.307] (-621.980) (-622.227) (-620.192) -- 0:01:08
105000 -- [-621.401] (-622.813) (-622.899) (-619.646) * [-628.325] (-621.669) (-622.950) (-620.248) -- 0:01:08
Average standard deviation of split frequencies: 0.025571
105500 -- (-620.261) (-621.818) [-621.299] (-623.083) * (-629.698) (-621.791) [-624.127] (-620.316) -- 0:01:07
106000 -- (-621.447) (-620.522) [-620.529] (-624.823) * (-625.539) (-623.390) (-621.189) [-620.756] -- 0:01:07
106500 -- [-618.724] (-617.926) (-624.327) (-620.582) * (-628.371) (-619.208) (-621.193) [-619.412] -- 0:01:07
107000 -- (-617.957) (-619.853) [-621.557] (-619.310) * [-628.152] (-618.431) (-617.472) (-621.506) -- 0:01:06
107500 -- (-619.426) (-621.255) (-621.977) [-620.656] * (-630.425) (-619.580) (-619.740) [-620.089] -- 0:01:06
108000 -- (-619.001) (-618.582) (-623.466) [-621.046] * (-623.200) [-621.097] (-620.785) (-624.015) -- 0:01:06
108500 -- (-619.648) [-621.687] (-620.827) (-621.735) * (-624.107) (-618.674) (-621.119) [-620.548] -- 0:01:05
109000 -- (-621.229) (-621.675) (-622.041) [-624.920] * [-622.074] (-620.839) (-619.463) (-620.607) -- 0:01:05
109500 -- (-618.608) [-621.177] (-620.805) (-619.586) * (-618.739) (-621.273) [-628.000] (-620.585) -- 0:01:05
110000 -- [-620.181] (-621.351) (-621.076) (-622.675) * [-618.276] (-622.580) (-621.482) (-620.248) -- 0:01:04
Average standard deviation of split frequencies: 0.023428
110500 -- (-619.674) [-622.929] (-619.388) (-620.964) * (-621.092) (-621.037) [-623.060] (-619.760) -- 0:01:04
111000 -- (-623.109) [-623.565] (-623.000) (-621.923) * [-621.457] (-620.802) (-622.056) (-620.805) -- 0:01:04
111500 -- (-619.183) (-622.674) (-622.418) [-621.693] * (-620.484) (-620.222) [-621.040] (-620.635) -- 0:01:03
112000 -- (-619.338) (-621.879) (-622.831) [-620.560] * [-621.841] (-620.798) (-621.808) (-624.066) -- 0:01:03
112500 -- (-621.602) (-621.806) (-623.750) [-620.636] * (-619.682) (-625.900) (-621.126) [-620.027] -- 0:01:11
113000 -- [-620.728] (-621.417) (-620.394) (-620.836) * (-619.516) [-623.509] (-622.360) (-622.448) -- 0:01:10
113500 -- (-622.175) (-621.815) (-620.381) [-618.595] * (-619.699) [-622.958] (-622.616) (-620.191) -- 0:01:10
114000 -- (-620.662) (-622.931) [-619.399] (-622.021) * [-620.691] (-620.422) (-621.114) (-623.782) -- 0:01:09
114500 -- (-621.291) [-622.686] (-621.230) (-622.603) * (-621.131) [-621.540] (-622.327) (-626.901) -- 0:01:09
115000 -- (-620.680) [-620.191] (-621.027) (-619.609) * [-622.385] (-618.720) (-620.411) (-622.171) -- 0:01:09
Average standard deviation of split frequencies: 0.023706
115500 -- (-619.632) (-623.471) (-623.105) [-620.107] * (-623.052) (-618.830) (-625.801) [-620.034] -- 0:01:08
116000 -- (-625.379) (-621.307) [-620.772] (-619.851) * (-621.242) (-619.362) [-621.633] (-621.149) -- 0:01:08
116500 -- [-621.795] (-623.647) (-622.445) (-620.924) * (-621.206) (-619.024) [-624.593] (-623.314) -- 0:01:08
117000 -- (-621.246) (-620.303) [-619.949] (-622.888) * (-623.129) [-620.854] (-620.920) (-623.034) -- 0:01:07
117500 -- [-623.782] (-625.406) (-620.808) (-623.041) * (-619.092) (-623.895) (-622.383) [-621.538] -- 0:01:07
118000 -- (-621.095) [-623.514] (-622.754) (-619.447) * (-619.045) [-620.015] (-624.954) (-624.016) -- 0:01:07
118500 -- (-622.083) [-621.625] (-620.130) (-624.153) * (-622.153) (-621.687) (-621.370) [-621.468] -- 0:01:06
119000 -- [-620.805] (-624.678) (-623.638) (-625.306) * (-621.052) [-622.324] (-625.670) (-621.377) -- 0:01:06
119500 -- (-630.023) (-621.996) (-621.075) [-620.594] * (-619.489) (-622.167) (-621.167) [-623.592] -- 0:01:06
120000 -- [-622.317] (-622.043) (-621.023) (-622.834) * (-622.203) (-626.092) [-623.948] (-627.082) -- 0:01:06
Average standard deviation of split frequencies: 0.023670
120500 -- (-621.740) (-621.925) [-622.590] (-619.213) * (-621.761) [-621.729] (-625.006) (-619.088) -- 0:01:05
121000 -- (-620.964) [-622.380] (-620.483) (-621.621) * (-621.266) [-622.668] (-625.850) (-621.528) -- 0:01:05
121500 -- (-622.697) [-620.319] (-620.374) (-622.884) * (-620.764) (-623.970) (-620.141) [-627.579] -- 0:01:05
122000 -- (-623.112) [-620.745] (-622.247) (-623.768) * (-621.330) [-622.635] (-621.267) (-622.151) -- 0:01:04
122500 -- (-623.541) (-621.999) [-620.893] (-620.615) * [-622.798] (-623.380) (-621.139) (-621.543) -- 0:01:04
123000 -- (-625.144) (-624.819) (-623.619) [-621.560] * (-620.620) (-623.336) (-620.436) [-621.679] -- 0:01:04
123500 -- (-621.303) (-621.649) (-623.399) [-620.625] * (-622.043) (-626.083) [-618.913] (-623.159) -- 0:01:03
124000 -- (-622.607) (-620.452) [-623.356] (-620.854) * [-619.850] (-620.840) (-621.325) (-622.883) -- 0:01:03
124500 -- (-623.063) (-621.124) [-621.032] (-619.955) * [-621.978] (-626.298) (-623.230) (-621.495) -- 0:01:03
125000 -- (-621.928) (-621.159) (-621.026) [-619.898] * (-620.994) (-621.696) [-620.679] (-621.825) -- 0:01:03
Average standard deviation of split frequencies: 0.020479
125500 -- (-619.925) [-621.616] (-619.520) (-619.134) * (-622.297) [-621.046] (-623.054) (-621.447) -- 0:01:02
126000 -- [-621.239] (-621.251) (-623.151) (-622.923) * [-618.595] (-622.106) (-619.517) (-622.334) -- 0:01:09
126500 -- (-622.718) (-619.670) (-620.970) [-620.694] * [-619.452] (-622.819) (-623.791) (-620.430) -- 0:01:09
127000 -- (-621.700) (-623.890) [-620.441] (-628.291) * [-618.413] (-623.882) (-620.597) (-623.123) -- 0:01:08
127500 -- (-618.866) (-621.837) [-623.541] (-621.138) * (-624.212) (-622.426) [-621.901] (-620.900) -- 0:01:08
128000 -- (-621.607) (-622.500) (-623.640) [-621.225] * (-622.575) (-621.167) [-621.111] (-621.272) -- 0:01:08
128500 -- [-622.319] (-619.831) (-621.988) (-621.189) * [-620.137] (-623.924) (-620.550) (-620.897) -- 0:01:07
129000 -- (-622.556) (-627.884) [-622.953] (-620.933) * (-621.073) (-623.121) (-621.716) [-621.801] -- 0:01:07
129500 -- (-620.539) (-624.856) (-623.406) [-620.191] * (-623.981) [-621.944] (-621.327) (-621.157) -- 0:01:07
130000 -- [-620.765] (-625.820) (-630.451) (-625.373) * (-626.289) [-622.852] (-619.681) (-620.198) -- 0:01:06
Average standard deviation of split frequencies: 0.019642
130500 -- [-621.348] (-622.538) (-624.159) (-625.221) * [-624.233] (-622.708) (-622.823) (-619.752) -- 0:01:06
131000 -- [-620.771] (-622.727) (-625.400) (-623.845) * (-624.065) [-620.939] (-623.038) (-622.513) -- 0:01:06
131500 -- (-622.820) (-622.894) (-622.859) [-625.654] * [-623.035] (-620.854) (-620.220) (-620.998) -- 0:01:06
132000 -- (-620.455) [-619.020] (-624.215) (-620.810) * (-625.174) [-620.590] (-622.576) (-621.662) -- 0:01:05
132500 -- (-620.712) [-619.292] (-623.909) (-624.544) * (-622.057) (-622.352) (-620.625) [-617.944] -- 0:01:05
133000 -- (-623.989) [-619.828] (-623.107) (-619.223) * (-622.681) (-622.888) [-620.568] (-621.686) -- 0:01:05
133500 -- (-621.322) (-620.525) (-620.019) [-624.878] * (-622.904) (-620.592) (-621.902) [-623.983] -- 0:01:04
134000 -- [-618.074] (-623.559) (-618.391) (-621.755) * (-623.632) (-622.880) [-625.239] (-621.398) -- 0:01:04
134500 -- (-619.171) (-629.918) (-621.916) [-622.346] * (-620.889) [-622.525] (-622.625) (-618.575) -- 0:01:04
135000 -- (-618.715) (-623.289) (-620.912) [-619.623] * (-624.170) (-620.421) (-624.804) [-619.679] -- 0:01:04
Average standard deviation of split frequencies: 0.018872
135500 -- (-619.635) (-623.624) [-620.940] (-621.074) * (-621.629) [-620.771] (-621.078) (-620.435) -- 0:01:03
136000 -- [-623.296] (-619.718) (-620.576) (-622.398) * [-624.480] (-622.592) (-624.974) (-623.439) -- 0:01:03
136500 -- (-620.575) [-621.896] (-620.652) (-619.529) * [-621.876] (-623.475) (-622.849) (-619.404) -- 0:01:03
137000 -- (-620.673) (-622.161) [-621.642] (-620.264) * (-621.280) (-623.547) [-620.901] (-620.679) -- 0:01:02
137500 -- (-622.369) (-624.669) (-619.819) [-621.228] * (-621.180) (-620.915) [-620.604] (-621.300) -- 0:01:02
138000 -- (-623.835) [-620.196] (-621.483) (-619.952) * (-627.295) (-621.971) [-623.836] (-622.072) -- 0:01:02
138500 -- (-625.305) [-620.575] (-621.856) (-620.993) * (-622.161) [-620.407] (-622.316) (-619.778) -- 0:01:02
139000 -- [-621.766] (-624.231) (-624.595) (-622.110) * (-623.575) [-620.025] (-621.673) (-620.229) -- 0:01:01
139500 -- (-624.768) [-622.917] (-621.572) (-621.775) * (-620.894) (-620.594) (-622.265) [-619.249] -- 0:01:01
140000 -- [-619.204] (-621.962) (-623.915) (-623.068) * [-622.888] (-622.016) (-620.886) (-622.887) -- 0:01:07
Average standard deviation of split frequencies: 0.018246
140500 -- [-620.404] (-622.553) (-622.095) (-623.121) * [-621.505] (-622.119) (-621.761) (-622.785) -- 0:01:07
141000 -- (-617.831) (-621.828) (-622.244) [-621.282] * (-623.347) (-621.353) [-619.666] (-619.887) -- 0:01:07
141500 -- [-619.423] (-624.209) (-621.416) (-623.065) * (-621.576) [-623.163] (-619.884) (-619.916) -- 0:01:06
142000 -- (-623.236) (-626.199) (-622.659) [-620.883] * (-622.962) (-624.775) [-620.131] (-623.376) -- 0:01:06
142500 -- (-619.387) (-623.382) [-620.200] (-622.454) * (-619.120) (-621.322) [-619.394] (-623.517) -- 0:01:06
143000 -- [-622.350] (-622.526) (-620.096) (-622.231) * (-626.278) [-621.439] (-618.212) (-622.252) -- 0:01:05
143500 -- [-623.383] (-620.652) (-621.385) (-622.900) * (-621.998) (-622.618) (-620.480) [-622.472] -- 0:01:05
144000 -- (-623.233) (-625.004) (-623.744) [-621.303] * [-619.843] (-621.321) (-622.496) (-621.720) -- 0:01:05
144500 -- (-621.442) (-622.198) [-621.858] (-624.809) * (-629.057) [-623.222] (-621.671) (-623.165) -- 0:01:05
145000 -- (-618.937) (-619.781) [-622.029] (-620.152) * (-622.657) (-624.807) (-620.785) [-622.002] -- 0:01:04
Average standard deviation of split frequencies: 0.017400
145500 -- (-620.468) [-618.889] (-624.660) (-621.257) * (-620.780) (-621.614) [-621.776] (-619.864) -- 0:01:04
146000 -- [-619.902] (-620.987) (-623.296) (-621.543) * (-621.167) (-619.683) (-623.567) [-622.017] -- 0:01:04
146500 -- (-618.708) [-621.287] (-622.856) (-621.440) * (-620.008) (-619.842) [-620.679] (-622.863) -- 0:01:04
147000 -- (-622.152) (-619.662) [-625.818] (-622.360) * (-624.924) [-619.707] (-619.258) (-620.988) -- 0:01:03
147500 -- [-621.386] (-621.496) (-621.749) (-623.945) * (-621.357) (-623.535) (-622.682) [-621.278] -- 0:01:03
148000 -- [-620.589] (-621.298) (-620.770) (-621.165) * [-623.876] (-626.829) (-621.346) (-627.114) -- 0:01:03
148500 -- (-618.712) (-628.656) [-620.637] (-623.415) * (-627.941) (-624.211) [-619.449] (-624.377) -- 0:01:03
149000 -- (-618.763) (-625.104) (-619.225) [-621.855] * [-621.531] (-622.677) (-621.460) (-626.855) -- 0:01:02
149500 -- (-619.531) (-622.051) (-619.137) [-626.753] * (-625.519) (-621.806) [-621.159] (-627.134) -- 0:01:02
150000 -- (-623.396) (-624.353) (-621.287) [-624.063] * (-625.033) [-619.175] (-620.505) (-620.250) -- 0:01:02
Average standard deviation of split frequencies: 0.015470
150500 -- (-621.407) [-621.436] (-619.833) (-621.222) * [-621.630] (-620.651) (-621.149) (-620.866) -- 0:01:02
151000 -- [-621.209] (-621.770) (-626.524) (-624.708) * [-620.452] (-620.311) (-620.968) (-620.830) -- 0:01:01
151500 -- (-622.707) [-620.669] (-625.705) (-622.693) * [-620.965] (-621.103) (-621.333) (-620.726) -- 0:01:01
152000 -- (-623.288) (-620.835) (-619.971) [-621.487] * (-621.117) (-622.244) [-620.319] (-620.922) -- 0:01:01
152500 -- (-622.781) (-628.420) (-622.723) [-622.162] * (-625.325) [-619.735] (-621.362) (-622.031) -- 0:01:01
153000 -- [-622.011] (-622.544) (-622.306) (-621.623) * [-624.211] (-620.405) (-622.063) (-624.104) -- 0:01:00
153500 -- [-621.165] (-621.549) (-621.485) (-619.327) * (-622.063) [-624.372] (-620.450) (-623.653) -- 0:01:00
154000 -- (-621.958) (-623.396) [-619.014] (-621.209) * [-621.824] (-622.964) (-620.801) (-624.394) -- 0:01:00
154500 -- (-622.453) (-622.342) (-625.065) [-623.005] * [-621.088] (-619.377) (-620.712) (-623.731) -- 0:01:05
155000 -- (-621.865) (-621.276) (-623.227) [-621.458] * (-622.982) [-623.423] (-623.762) (-622.065) -- 0:01:05
Average standard deviation of split frequencies: 0.014605
155500 -- (-621.128) [-619.717] (-618.230) (-623.192) * (-621.866) [-621.373] (-622.733) (-623.121) -- 0:01:05
156000 -- (-624.256) (-623.501) (-618.715) [-620.603] * (-620.756) (-620.689) (-622.601) [-621.703] -- 0:01:04
156500 -- (-621.956) [-623.373] (-619.908) (-620.187) * [-620.279] (-621.860) (-620.329) (-622.078) -- 0:01:04
157000 -- [-623.179] (-621.504) (-619.858) (-621.489) * (-621.909) (-621.232) (-621.791) [-623.371] -- 0:01:04
157500 -- (-623.473) (-623.265) (-619.348) [-621.640] * (-624.020) [-622.227] (-621.683) (-622.191) -- 0:01:04
158000 -- [-628.740] (-621.818) (-620.235) (-621.198) * [-623.860] (-620.623) (-622.786) (-622.547) -- 0:01:03
158500 -- (-625.536) [-622.283] (-626.326) (-622.906) * [-626.662] (-622.572) (-623.044) (-623.043) -- 0:01:03
159000 -- (-620.575) (-619.846) [-623.250] (-622.573) * [-623.072] (-620.725) (-624.024) (-623.368) -- 0:01:03
159500 -- (-621.301) (-622.082) [-620.169] (-620.484) * (-622.183) [-622.824] (-625.247) (-621.807) -- 0:01:03
160000 -- (-622.772) (-621.252) (-624.678) [-623.684] * (-619.912) (-619.994) (-620.998) [-623.181] -- 0:01:02
Average standard deviation of split frequencies: 0.014833
160500 -- [-619.972] (-622.762) (-622.477) (-623.254) * [-625.656] (-622.127) (-625.599) (-630.909) -- 0:01:02
161000 -- (-619.059) [-621.019] (-621.326) (-622.279) * (-620.734) (-624.975) [-620.261] (-622.058) -- 0:01:02
161500 -- (-620.676) [-621.837] (-621.401) (-621.461) * (-620.094) [-626.573] (-624.067) (-622.101) -- 0:01:02
162000 -- (-620.629) (-630.077) [-623.804] (-622.992) * (-621.248) (-624.171) [-621.558] (-619.802) -- 0:01:02
162500 -- (-623.290) (-628.483) [-621.556] (-621.716) * [-620.014] (-623.754) (-622.819) (-621.552) -- 0:01:01
163000 -- [-620.447] (-621.329) (-622.141) (-620.089) * (-621.046) [-622.824] (-622.199) (-621.380) -- 0:01:01
163500 -- (-620.489) [-625.872] (-619.072) (-621.346) * [-620.999] (-621.098) (-621.424) (-622.335) -- 0:01:01
164000 -- (-621.745) (-620.231) (-620.488) [-620.801] * [-620.611] (-624.799) (-620.824) (-621.404) -- 0:01:01
164500 -- (-623.064) (-619.417) [-618.782] (-619.916) * [-622.054] (-621.231) (-623.926) (-622.434) -- 0:01:00
165000 -- [-621.850] (-618.981) (-619.852) (-620.936) * (-624.026) (-623.393) (-622.249) [-622.331] -- 0:01:00
Average standard deviation of split frequencies: 0.014830
165500 -- (-623.123) [-620.836] (-624.837) (-621.028) * (-622.845) (-621.801) [-623.266] (-622.140) -- 0:01:00
166000 -- (-620.062) (-620.215) (-621.088) [-622.171] * [-622.283] (-621.769) (-623.555) (-625.067) -- 0:01:00
166500 -- (-620.162) [-620.629] (-618.871) (-621.229) * (-620.567) (-621.481) (-621.289) [-621.221] -- 0:01:05
167000 -- (-619.320) [-621.665] (-620.446) (-621.406) * (-620.128) (-622.674) [-622.630] (-621.295) -- 0:01:04
167500 -- (-620.590) [-623.057] (-619.657) (-621.563) * (-620.830) [-618.425] (-620.374) (-622.073) -- 0:01:04
168000 -- (-618.678) (-622.530) [-621.136] (-619.424) * (-620.144) [-619.582] (-620.968) (-627.726) -- 0:01:04
168500 -- (-620.775) (-622.423) [-619.224] (-622.261) * [-624.239] (-619.956) (-621.361) (-624.025) -- 0:01:04
169000 -- (-622.723) (-624.943) (-620.943) [-619.487] * [-622.635] (-622.173) (-620.607) (-621.024) -- 0:01:03
169500 -- [-624.485] (-623.213) (-622.163) (-621.585) * (-623.598) (-622.676) [-619.968] (-621.339) -- 0:01:03
170000 -- (-618.771) (-622.421) (-628.173) [-620.013] * [-619.834] (-625.141) (-625.351) (-623.915) -- 0:01:03
Average standard deviation of split frequencies: 0.017009
170500 -- (-623.433) (-620.747) (-622.387) [-619.816] * (-625.981) (-622.285) [-623.606] (-623.927) -- 0:01:03
171000 -- (-621.334) (-624.067) [-621.068] (-622.279) * (-622.835) (-621.468) [-623.271] (-623.652) -- 0:01:03
171500 -- (-624.186) [-620.513] (-620.973) (-619.021) * (-622.506) (-625.595) [-620.932] (-621.748) -- 0:01:02
172000 -- [-624.888] (-622.331) (-625.898) (-623.471) * (-623.641) (-621.498) [-625.970] (-624.516) -- 0:01:02
172500 -- [-619.388] (-628.446) (-620.470) (-626.872) * (-623.204) (-624.176) (-623.820) [-622.975] -- 0:01:02
173000 -- (-620.584) [-621.120] (-621.223) (-622.524) * (-624.769) [-621.618] (-619.968) (-621.910) -- 0:01:02
173500 -- [-621.858] (-620.900) (-621.300) (-621.709) * (-623.322) (-619.281) [-619.173] (-621.716) -- 0:01:01
174000 -- (-620.434) (-623.236) (-621.612) [-619.785] * (-621.619) [-619.856] (-623.301) (-621.906) -- 0:01:01
174500 -- (-623.077) (-623.103) (-623.684) [-621.517] * (-625.010) [-620.377] (-620.936) (-622.262) -- 0:01:01
175000 -- (-623.249) (-625.214) (-621.173) [-624.496] * (-623.290) (-620.912) [-621.312] (-620.226) -- 0:01:01
Average standard deviation of split frequencies: 0.015283
175500 -- (-622.027) (-625.115) (-627.359) [-622.444] * [-621.425] (-619.310) (-619.033) (-620.396) -- 0:01:01
176000 -- (-621.562) (-621.276) [-621.180] (-621.523) * (-620.682) (-623.964) (-619.584) [-619.200] -- 0:01:00
176500 -- (-621.159) [-621.942] (-622.447) (-621.365) * (-619.773) (-622.324) [-619.708] (-621.180) -- 0:01:00
177000 -- (-622.955) (-620.524) [-623.739] (-623.229) * (-621.807) (-621.168) (-622.623) [-621.224] -- 0:01:00
177500 -- (-622.970) (-622.501) (-621.512) [-620.636] * (-619.892) (-624.706) [-618.895] (-620.776) -- 0:01:00
178000 -- (-624.108) (-622.923) (-621.753) [-621.532] * (-621.559) [-620.657] (-619.069) (-620.456) -- 0:01:00
178500 -- [-620.697] (-622.652) (-619.539) (-622.219) * (-621.110) [-619.582] (-620.392) (-620.286) -- 0:00:59
179000 -- (-619.647) (-625.894) (-623.913) [-618.378] * (-622.371) (-618.900) [-621.875] (-619.895) -- 0:00:59
179500 -- (-619.052) (-621.523) (-619.701) [-620.784] * (-627.533) (-623.343) [-622.402] (-625.206) -- 0:01:03
180000 -- (-624.744) (-622.709) [-622.357] (-619.568) * (-619.575) [-620.714] (-619.735) (-620.046) -- 0:01:03
Average standard deviation of split frequencies: 0.017990
180500 -- (-619.210) (-620.727) [-618.936] (-619.810) * (-621.509) (-621.234) [-620.998] (-620.750) -- 0:01:03
181000 -- [-621.439] (-621.586) (-619.788) (-627.059) * [-623.441] (-619.626) (-620.055) (-621.509) -- 0:01:03
181500 -- [-626.113] (-623.739) (-618.088) (-622.759) * (-623.314) [-620.133] (-622.172) (-621.760) -- 0:01:03
182000 -- (-624.102) (-625.230) [-617.471] (-621.150) * (-624.504) (-623.136) [-623.158] (-622.840) -- 0:01:02
182500 -- (-623.663) (-620.140) [-621.087] (-622.883) * (-621.699) (-624.612) (-621.594) [-621.025] -- 0:01:02
183000 -- (-625.205) (-621.161) [-619.198] (-623.146) * (-623.573) [-620.781] (-627.400) (-621.223) -- 0:01:02
183500 -- [-622.134] (-621.132) (-619.090) (-621.895) * [-621.386] (-624.377) (-621.814) (-621.486) -- 0:01:02
184000 -- (-622.307) [-620.573] (-621.226) (-625.741) * (-621.966) (-620.405) [-621.516] (-621.486) -- 0:01:02
184500 -- (-620.401) (-618.998) [-622.752] (-622.135) * (-622.194) (-619.757) [-621.586] (-620.954) -- 0:01:01
185000 -- [-621.547] (-625.016) (-627.170) (-622.051) * (-623.142) [-619.791] (-622.793) (-622.910) -- 0:01:01
Average standard deviation of split frequencies: 0.018008
185500 -- (-620.272) (-622.404) [-620.124] (-622.714) * (-624.192) (-618.752) [-619.473] (-623.358) -- 0:01:01
186000 -- (-622.522) [-622.839] (-622.777) (-620.245) * (-622.660) [-622.280] (-622.781) (-623.483) -- 0:01:01
186500 -- (-621.443) [-622.102] (-618.928) (-623.012) * (-621.801) (-621.729) (-620.794) [-621.664] -- 0:01:01
187000 -- (-624.411) (-624.017) (-620.291) [-623.631] * (-619.264) [-619.455] (-619.914) (-624.373) -- 0:01:00
187500 -- (-621.405) (-620.051) (-621.532) [-619.882] * (-619.545) [-622.601] (-620.606) (-625.979) -- 0:01:00
188000 -- (-624.272) [-622.876] (-622.065) (-620.116) * [-618.991] (-620.047) (-623.662) (-622.696) -- 0:01:00
188500 -- [-621.083] (-620.419) (-622.845) (-620.269) * (-620.433) [-618.609] (-623.468) (-623.523) -- 0:01:00
189000 -- (-620.437) (-619.814) (-621.984) [-621.180] * [-620.097] (-619.220) (-622.748) (-619.512) -- 0:01:00
189500 -- [-621.576] (-622.260) (-627.984) (-623.646) * [-621.030] (-620.072) (-621.606) (-621.971) -- 0:00:59
190000 -- (-621.110) (-621.598) [-621.887] (-622.382) * [-619.741] (-620.038) (-622.482) (-622.530) -- 0:00:59
Average standard deviation of split frequencies: 0.017567
190500 -- (-620.901) [-619.930] (-619.659) (-621.350) * [-619.623] (-620.857) (-621.829) (-621.487) -- 0:00:59
191000 -- (-624.079) (-621.912) [-620.684] (-622.518) * (-625.033) [-625.438] (-624.057) (-620.666) -- 0:00:59
191500 -- [-621.792] (-625.282) (-620.386) (-620.625) * (-620.199) (-623.948) (-622.117) [-621.064] -- 0:01:03
192000 -- (-623.525) (-620.941) [-620.669] (-620.562) * (-618.439) (-625.737) (-624.644) [-621.610] -- 0:01:03
192500 -- (-622.008) (-623.346) (-619.572) [-620.546] * (-622.431) (-624.030) [-623.203] (-620.303) -- 0:01:02
193000 -- (-622.003) [-622.124] (-618.326) (-621.080) * (-623.003) [-622.785] (-624.263) (-621.766) -- 0:01:02
193500 -- (-622.131) [-619.753] (-620.131) (-624.411) * (-622.397) [-623.805] (-622.995) (-625.654) -- 0:01:02
194000 -- (-624.313) (-619.465) [-618.864] (-621.215) * (-617.727) [-623.868] (-625.185) (-627.017) -- 0:01:02
194500 -- (-619.326) (-622.678) (-622.930) [-619.683] * (-620.202) (-622.296) [-621.175] (-628.316) -- 0:01:02
195000 -- (-622.126) (-619.783) (-621.272) [-621.619] * (-621.955) (-625.128) [-625.244] (-622.402) -- 0:01:01
Average standard deviation of split frequencies: 0.017342
195500 -- (-621.267) (-618.670) [-619.745] (-618.133) * (-624.436) (-621.154) (-623.899) [-619.415] -- 0:01:01
196000 -- (-621.622) (-620.352) (-621.891) [-621.444] * (-624.686) (-621.054) [-620.589] (-621.013) -- 0:01:01
196500 -- (-622.834) (-619.054) [-622.620] (-623.264) * (-620.907) (-623.797) (-625.545) [-624.101] -- 0:01:01
197000 -- (-625.589) (-622.579) (-619.067) [-621.257] * (-622.790) [-621.128] (-620.372) (-623.947) -- 0:01:01
197500 -- (-622.076) (-628.184) [-618.948] (-622.383) * (-621.283) (-619.252) (-619.501) [-621.973] -- 0:01:00
198000 -- (-622.069) (-619.505) [-619.996] (-621.046) * (-620.823) [-621.142] (-621.976) (-622.301) -- 0:01:00
198500 -- (-620.698) [-622.796] (-621.763) (-620.487) * (-623.968) [-620.329] (-624.122) (-622.602) -- 0:01:00
199000 -- (-626.293) (-621.655) [-621.009] (-622.485) * (-625.116) (-622.197) [-620.856] (-622.230) -- 0:01:00
199500 -- [-622.085] (-622.631) (-619.795) (-621.131) * (-623.035) (-623.486) (-621.027) [-622.039] -- 0:01:00
200000 -- [-620.838] (-620.448) (-621.419) (-622.730) * [-622.379] (-620.160) (-622.909) (-621.527) -- 0:00:59
Average standard deviation of split frequencies: 0.017619
200500 -- (-623.942) (-624.241) [-620.076] (-624.211) * (-621.010) [-620.702] (-626.835) (-621.670) -- 0:00:59
201000 -- (-621.670) (-619.907) (-620.464) [-621.662] * (-620.125) (-619.576) (-624.609) [-627.841] -- 0:00:59
201500 -- (-620.932) (-624.885) (-621.676) [-623.008] * (-621.450) [-620.518] (-621.809) (-625.535) -- 0:00:59
202000 -- (-620.626) (-623.201) [-619.913] (-621.941) * (-622.106) [-622.934] (-624.452) (-621.290) -- 0:00:59
202500 -- (-620.981) (-621.188) [-621.499] (-629.072) * [-619.303] (-622.697) (-621.370) (-620.697) -- 0:00:59
203000 -- (-622.728) [-620.872] (-621.550) (-623.253) * (-621.895) (-624.424) (-621.686) [-619.274] -- 0:00:58
203500 -- (-622.371) (-619.179) [-620.678] (-623.426) * (-617.917) (-623.274) (-620.081) [-622.926] -- 0:00:58
204000 -- (-622.092) [-623.408] (-617.878) (-623.622) * [-621.744] (-625.471) (-619.902) (-618.245) -- 0:01:02
204500 -- (-620.769) (-619.634) [-621.300] (-619.906) * [-619.664] (-621.052) (-620.879) (-620.992) -- 0:01:02
205000 -- (-621.212) (-620.450) (-621.988) [-619.973] * (-621.447) (-622.079) (-620.654) [-618.458] -- 0:01:02
Average standard deviation of split frequencies: 0.019391
205500 -- (-626.691) (-621.887) (-620.905) [-619.697] * (-620.698) [-620.481] (-620.839) (-621.304) -- 0:01:01
206000 -- (-621.365) (-622.808) [-622.256] (-621.717) * [-620.211] (-623.276) (-621.935) (-620.598) -- 0:01:01
206500 -- (-624.096) [-621.754] (-622.222) (-620.292) * (-619.012) (-620.684) [-621.658] (-622.950) -- 0:01:01
207000 -- (-624.104) (-622.405) (-619.976) [-620.203] * [-622.039] (-624.385) (-620.764) (-623.155) -- 0:01:01
207500 -- (-618.676) [-621.294] (-621.435) (-619.505) * (-622.119) (-623.668) [-619.421] (-626.994) -- 0:01:01
208000 -- (-622.245) (-621.992) (-623.736) [-619.652] * [-622.281] (-625.339) (-620.264) (-620.491) -- 0:01:00
208500 -- [-618.692] (-621.523) (-623.216) (-618.216) * (-621.352) (-624.607) (-620.498) [-620.690] -- 0:01:00
209000 -- (-620.890) (-621.001) (-620.575) [-620.542] * (-621.455) (-620.845) (-620.885) [-621.343] -- 0:01:00
209500 -- (-620.333) (-622.396) [-619.064] (-621.891) * (-623.483) (-621.209) [-621.071] (-620.595) -- 0:01:00
210000 -- (-618.957) [-622.610] (-619.570) (-620.395) * (-620.998) (-621.595) [-619.641] (-622.518) -- 0:01:00
Average standard deviation of split frequencies: 0.020475
210500 -- (-619.601) (-619.892) [-621.034] (-622.463) * (-622.411) [-621.355] (-621.325) (-626.792) -- 0:01:00
211000 -- [-621.733] (-619.881) (-620.011) (-623.236) * (-625.009) (-623.004) [-623.005] (-621.034) -- 0:00:59
211500 -- (-619.623) (-622.364) [-620.691] (-624.730) * (-624.329) [-620.506] (-619.777) (-622.866) -- 0:00:59
212000 -- (-619.624) (-622.694) (-621.054) [-620.464] * (-625.124) (-622.371) (-621.185) [-623.220] -- 0:00:59
212500 -- (-621.079) (-620.541) [-619.949] (-620.848) * (-619.601) [-622.855] (-621.513) (-622.773) -- 0:00:59
213000 -- [-619.226] (-621.609) (-620.806) (-620.005) * [-620.469] (-621.785) (-622.617) (-619.945) -- 0:00:59
213500 -- (-623.537) (-620.711) [-622.571] (-622.164) * (-619.950) (-621.416) (-621.178) [-619.604] -- 0:00:58
214000 -- (-619.874) (-626.675) (-619.710) [-620.926] * (-619.453) (-620.290) [-619.755] (-620.152) -- 0:00:58
214500 -- (-620.133) (-622.318) [-622.426] (-623.778) * (-624.496) (-623.681) (-620.510) [-621.457] -- 0:00:58
215000 -- (-618.693) [-621.698] (-620.397) (-621.201) * (-621.358) (-621.118) (-627.000) [-620.612] -- 0:00:58
Average standard deviation of split frequencies: 0.019314
215500 -- (-618.378) [-622.898] (-620.422) (-620.807) * [-619.827] (-621.056) (-624.036) (-619.626) -- 0:01:01
216000 -- [-618.616] (-625.568) (-619.554) (-624.653) * (-620.649) [-621.796] (-620.489) (-620.322) -- 0:01:01
216500 -- (-619.283) (-621.578) (-620.215) [-624.549] * (-620.905) [-621.994] (-619.523) (-621.914) -- 0:01:01
217000 -- (-620.768) (-622.117) (-621.037) [-627.434] * (-621.440) [-622.432] (-619.132) (-622.872) -- 0:01:01
217500 -- (-620.653) (-624.573) [-621.545] (-624.000) * (-621.012) (-622.586) [-623.373] (-624.164) -- 0:01:01
218000 -- [-620.170] (-621.027) (-619.973) (-622.458) * (-622.766) (-620.694) (-621.272) [-621.978] -- 0:01:00
218500 -- [-619.111] (-624.921) (-622.613) (-624.696) * (-621.173) (-622.524) (-622.282) [-621.872] -- 0:01:00
219000 -- (-619.767) (-622.112) [-620.953] (-621.478) * [-620.748] (-623.255) (-622.016) (-621.682) -- 0:01:00
219500 -- (-619.787) (-620.436) (-619.431) [-620.049] * (-621.626) (-620.990) [-619.086] (-626.300) -- 0:01:00
220000 -- (-620.614) (-621.428) (-620.216) [-621.242] * (-622.614) (-623.770) (-620.669) [-619.268] -- 0:01:00
Average standard deviation of split frequencies: 0.021138
220500 -- (-619.917) [-622.147] (-621.556) (-620.615) * (-620.456) (-623.536) [-618.486] (-621.311) -- 0:01:00
221000 -- [-621.623] (-622.419) (-622.566) (-621.345) * (-622.010) [-623.236] (-619.745) (-623.432) -- 0:00:59
221500 -- [-620.916] (-623.968) (-620.360) (-623.440) * (-621.819) (-623.015) [-620.289] (-619.541) -- 0:00:59
222000 -- [-626.299] (-624.133) (-624.248) (-623.219) * [-622.117] (-624.689) (-620.614) (-619.655) -- 0:00:59
222500 -- (-620.975) [-620.672] (-620.725) (-621.420) * [-622.531] (-626.425) (-620.790) (-620.622) -- 0:00:59
223000 -- (-618.582) (-622.006) [-622.927] (-619.888) * [-620.894] (-624.359) (-618.610) (-626.553) -- 0:00:59
223500 -- (-623.293) [-620.767] (-624.158) (-624.349) * [-619.345] (-621.538) (-623.163) (-622.428) -- 0:00:59
224000 -- (-627.156) (-620.900) [-621.621] (-621.686) * (-619.267) (-620.892) (-623.192) [-618.133] -- 0:00:58
224500 -- (-621.526) (-622.787) [-622.610] (-621.402) * (-622.196) [-620.857] (-624.130) (-625.399) -- 0:00:58
225000 -- (-620.972) (-622.277) [-621.029] (-620.116) * (-622.305) (-623.338) [-620.859] (-620.789) -- 0:00:58
Average standard deviation of split frequencies: 0.018043
225500 -- [-621.137] (-620.264) (-622.925) (-620.021) * [-622.229] (-620.674) (-621.141) (-619.658) -- 0:00:58
226000 -- [-621.700] (-621.118) (-621.202) (-621.310) * (-627.280) (-622.159) [-623.222] (-619.614) -- 0:00:58
226500 -- (-620.742) (-622.060) [-620.566] (-621.837) * (-621.981) [-619.450] (-622.822) (-620.139) -- 0:00:58
227000 -- (-619.444) (-621.883) (-622.363) [-622.163] * (-620.176) (-622.104) [-622.339] (-619.381) -- 0:00:57
227500 -- [-622.953] (-621.095) (-621.433) (-619.925) * [-618.639] (-621.622) (-621.650) (-619.365) -- 0:00:57
228000 -- (-621.928) (-620.269) (-620.838) [-618.575] * (-621.324) (-619.555) (-621.318) [-623.783] -- 0:00:57
228500 -- (-620.998) (-623.072) [-620.487] (-619.237) * (-622.555) [-621.448] (-619.246) (-624.924) -- 0:00:57
229000 -- (-621.245) (-619.821) [-622.360] (-619.996) * (-624.024) (-621.143) (-622.214) [-618.960] -- 0:01:00
229500 -- [-619.199] (-623.239) (-619.578) (-621.004) * (-622.959) (-623.491) (-623.728) [-620.660] -- 0:01:00
230000 -- (-621.275) [-623.965] (-620.123) (-622.525) * (-622.742) (-622.743) (-621.763) [-620.614] -- 0:01:00
Average standard deviation of split frequencies: 0.016962
230500 -- [-620.683] (-621.538) (-621.595) (-621.085) * [-621.624] (-626.346) (-619.517) (-619.965) -- 0:01:00
231000 -- (-621.481) (-621.520) (-621.279) [-623.136] * [-620.683] (-621.900) (-621.567) (-620.035) -- 0:00:59
231500 -- [-622.159] (-623.717) (-621.460) (-620.726) * (-624.411) (-625.703) [-620.444] (-622.465) -- 0:00:59
232000 -- (-623.362) [-622.044] (-621.457) (-621.318) * (-621.278) (-621.410) [-621.024] (-621.490) -- 0:00:59
232500 -- [-621.891] (-621.157) (-621.963) (-620.523) * [-622.887] (-618.601) (-620.258) (-628.927) -- 0:00:59
233000 -- (-621.537) (-621.422) (-620.480) [-622.742] * (-621.986) (-620.714) [-622.836] (-623.026) -- 0:00:59
233500 -- (-621.235) [-626.600] (-623.788) (-622.687) * (-623.620) (-623.703) [-620.416] (-622.913) -- 0:00:59
234000 -- (-617.606) [-621.619] (-624.843) (-622.242) * [-619.967] (-623.389) (-621.866) (-619.634) -- 0:00:58
234500 -- (-623.444) (-621.873) (-625.418) [-619.667] * [-621.150] (-623.746) (-623.230) (-620.615) -- 0:00:58
235000 -- (-624.372) [-623.016] (-623.048) (-618.628) * (-624.386) [-621.092] (-621.795) (-623.160) -- 0:00:58
Average standard deviation of split frequencies: 0.015181
235500 -- (-621.270) [-625.647] (-623.061) (-626.346) * [-622.362] (-621.924) (-621.470) (-622.203) -- 0:00:58
236000 -- [-620.210] (-621.423) (-623.940) (-624.099) * (-622.544) (-620.532) (-620.109) [-619.360] -- 0:00:58
236500 -- (-622.565) (-622.524) (-622.833) [-621.966] * (-619.403) (-620.250) [-619.423] (-620.570) -- 0:00:58
237000 -- (-620.044) (-623.414) [-621.226] (-619.021) * (-619.872) (-622.008) [-621.485] (-622.741) -- 0:00:57
237500 -- (-621.789) [-622.249] (-621.348) (-619.994) * [-621.393] (-627.079) (-620.669) (-621.502) -- 0:00:57
238000 -- [-619.645] (-621.427) (-624.156) (-622.924) * (-621.331) (-624.411) [-620.955] (-621.085) -- 0:00:57
238500 -- (-619.041) (-621.772) [-619.646] (-621.230) * (-621.092) (-627.684) [-621.193] (-621.954) -- 0:00:57
239000 -- (-619.022) (-621.022) [-621.455] (-622.656) * (-620.609) (-620.612) [-619.813] (-622.670) -- 0:00:57
239500 -- [-619.569] (-620.665) (-623.336) (-619.852) * (-621.168) [-620.411] (-620.530) (-618.598) -- 0:00:57
240000 -- (-620.512) (-622.525) [-620.571] (-619.868) * [-621.566] (-621.643) (-622.867) (-622.994) -- 0:00:56
Average standard deviation of split frequencies: 0.014227
240500 -- [-619.704] (-624.554) (-623.632) (-620.535) * (-621.006) [-621.523] (-623.111) (-622.816) -- 0:00:56
241000 -- (-618.980) (-621.797) (-620.657) [-620.235] * [-619.375] (-623.359) (-620.962) (-621.016) -- 0:00:56
241500 -- [-619.554] (-622.222) (-624.501) (-620.767) * (-621.842) (-624.789) (-623.807) [-620.680] -- 0:00:59
242000 -- (-618.955) [-620.648] (-622.559) (-619.049) * (-622.112) (-620.176) (-619.988) [-623.909] -- 0:00:59
242500 -- [-619.115] (-621.634) (-621.041) (-620.179) * (-622.388) [-619.845] (-619.236) (-621.973) -- 0:00:59
243000 -- (-620.122) [-621.522] (-624.365) (-623.551) * [-627.891] (-619.055) (-619.358) (-620.499) -- 0:00:59
243500 -- (-622.973) (-620.820) [-621.846] (-619.872) * (-624.448) [-619.408] (-619.578) (-620.645) -- 0:00:59
244000 -- (-620.875) (-621.223) (-622.244) [-619.604] * (-623.177) [-626.466] (-623.331) (-620.381) -- 0:00:58
244500 -- [-619.041] (-619.941) (-619.448) (-622.774) * (-620.030) [-620.363] (-621.306) (-621.697) -- 0:00:58
245000 -- (-621.666) (-625.631) (-621.248) [-621.097] * (-621.262) [-620.206] (-623.526) (-621.196) -- 0:00:58
Average standard deviation of split frequencies: 0.014624
245500 -- [-620.744] (-621.501) (-626.082) (-618.977) * (-623.374) (-623.419) (-623.089) [-620.868] -- 0:00:58
246000 -- (-622.612) (-621.364) [-622.329] (-621.409) * [-623.171] (-621.831) (-622.328) (-621.218) -- 0:00:58
246500 -- [-620.558] (-620.423) (-620.972) (-619.136) * (-621.126) (-620.588) [-620.807] (-622.372) -- 0:00:58
247000 -- (-620.542) (-620.667) [-620.699] (-623.969) * (-623.791) (-621.670) [-619.564] (-622.413) -- 0:00:57
247500 -- (-629.451) (-623.184) (-619.316) [-622.998] * (-625.363) (-625.599) (-621.706) [-622.350] -- 0:00:57
248000 -- (-620.067) (-620.827) [-619.777] (-620.648) * (-627.999) (-621.186) (-620.650) [-620.472] -- 0:00:57
248500 -- (-623.756) (-619.706) [-619.339] (-619.250) * (-622.140) [-622.272] (-620.721) (-624.710) -- 0:00:57
249000 -- (-618.652) (-624.311) [-620.476] (-621.430) * (-621.668) [-620.950] (-622.338) (-622.932) -- 0:00:57
249500 -- (-621.411) (-622.764) (-618.506) [-624.070] * (-622.240) (-621.371) [-621.213] (-623.171) -- 0:00:57
250000 -- [-624.594] (-622.475) (-629.810) (-621.324) * (-621.633) [-622.172] (-622.378) (-624.288) -- 0:00:57
Average standard deviation of split frequencies: 0.013461
250500 -- (-624.203) [-626.344] (-622.271) (-621.182) * (-622.262) [-624.048] (-623.437) (-622.619) -- 0:00:56
251000 -- [-618.841] (-621.491) (-624.410) (-622.434) * (-624.157) [-622.464] (-621.449) (-621.732) -- 0:00:56
251500 -- (-620.653) (-618.940) [-620.774] (-619.911) * (-622.128) (-622.158) [-620.386] (-622.062) -- 0:00:56
252000 -- (-619.578) [-620.913] (-619.570) (-620.034) * (-621.936) (-621.156) [-622.322] (-621.951) -- 0:00:56
252500 -- (-625.981) [-621.770] (-621.735) (-620.834) * [-623.957] (-621.793) (-619.898) (-621.802) -- 0:00:56
253000 -- (-622.561) [-622.060] (-619.154) (-624.567) * (-625.545) (-618.925) (-621.992) [-620.576] -- 0:00:56
253500 -- (-622.439) (-620.175) [-620.708] (-620.596) * [-619.929] (-621.806) (-623.085) (-622.572) -- 0:00:55
254000 -- (-622.842) (-620.661) (-623.747) [-621.032] * (-620.828) (-618.706) (-625.818) [-621.386] -- 0:00:55
254500 -- (-621.953) (-623.222) [-623.055] (-623.822) * (-620.182) [-620.421] (-621.351) (-623.044) -- 0:00:55
255000 -- (-623.970) [-621.406] (-623.762) (-623.567) * (-620.678) (-619.198) (-620.091) [-621.592] -- 0:00:55
Average standard deviation of split frequencies: 0.013471
255500 -- (-626.394) (-620.435) (-621.549) [-617.676] * (-621.471) (-620.443) (-620.230) [-620.086] -- 0:00:55
256000 -- (-621.635) (-621.160) (-620.120) [-619.949] * [-621.510] (-620.789) (-621.419) (-622.397) -- 0:00:58
256500 -- (-622.128) (-619.330) [-618.718] (-622.936) * [-620.487] (-623.421) (-625.759) (-623.389) -- 0:00:57
257000 -- [-617.890] (-621.176) (-620.473) (-623.229) * (-623.093) [-619.339] (-620.948) (-625.039) -- 0:00:57
257500 -- (-619.419) [-621.125] (-624.309) (-624.779) * (-621.406) (-622.842) [-620.363] (-622.488) -- 0:00:57
258000 -- (-619.948) [-620.477] (-622.672) (-620.156) * (-621.646) [-624.023] (-626.747) (-622.595) -- 0:00:57
258500 -- (-623.319) (-627.945) [-621.007] (-623.729) * (-620.009) (-625.813) (-621.055) [-621.250] -- 0:00:57
259000 -- (-620.623) (-620.576) [-618.961] (-625.244) * (-626.645) [-620.965] (-621.141) (-622.418) -- 0:00:57
259500 -- [-620.245] (-621.764) (-624.515) (-624.000) * (-622.912) (-624.251) [-623.915] (-620.134) -- 0:00:57
260000 -- (-618.936) (-622.698) (-622.414) [-619.930] * (-620.957) (-620.881) (-624.051) [-620.564] -- 0:00:56
Average standard deviation of split frequencies: 0.013362
260500 -- [-623.784] (-623.529) (-624.469) (-618.630) * [-625.259] (-620.218) (-622.301) (-621.444) -- 0:00:56
261000 -- (-626.024) (-623.330) (-625.072) [-619.313] * [-626.198] (-620.955) (-622.386) (-620.273) -- 0:00:56
261500 -- (-620.653) [-620.850] (-620.865) (-625.246) * (-622.059) (-621.574) (-618.687) [-619.708] -- 0:00:56
262000 -- (-621.565) (-619.371) (-621.207) [-632.812] * (-623.833) [-620.240] (-620.261) (-622.795) -- 0:00:56
262500 -- (-622.238) (-619.901) [-622.812] (-626.600) * (-623.474) (-620.541) (-621.269) [-620.972] -- 0:00:56
263000 -- (-623.988) [-620.406] (-620.015) (-622.714) * (-622.159) (-623.560) [-619.327] (-621.176) -- 0:00:56
263500 -- (-627.499) (-621.581) (-623.461) [-621.447] * [-620.829] (-620.628) (-623.064) (-619.458) -- 0:00:55
264000 -- (-621.689) (-621.228) (-621.103) [-620.763] * (-622.316) [-620.035] (-620.274) (-621.257) -- 0:00:55
264500 -- (-619.381) (-620.323) (-626.826) [-622.890] * (-623.247) [-620.966] (-621.810) (-621.975) -- 0:00:55
265000 -- (-621.812) (-623.400) [-620.621] (-620.865) * (-620.771) (-626.628) (-622.079) [-621.261] -- 0:00:55
Average standard deviation of split frequencies: 0.013618
265500 -- [-623.543] (-623.770) (-619.628) (-623.278) * (-620.834) (-625.428) [-621.462] (-621.404) -- 0:00:55
266000 -- (-619.582) (-621.757) (-620.810) [-624.476] * (-621.440) (-623.293) (-619.785) [-619.814] -- 0:00:55
266500 -- (-621.007) (-622.160) (-623.888) [-622.987] * (-621.050) (-622.802) [-619.523] (-620.001) -- 0:00:55
267000 -- (-621.950) [-619.668] (-621.384) (-622.464) * (-619.626) (-621.854) [-621.069] (-621.189) -- 0:00:54
267500 -- (-621.369) [-620.686] (-621.719) (-621.188) * (-620.523) [-620.455] (-622.067) (-621.116) -- 0:00:54
268000 -- (-620.667) (-620.397) [-620.196] (-623.022) * (-620.850) [-621.139] (-622.661) (-620.718) -- 0:00:54
268500 -- (-622.371) [-618.713] (-620.108) (-626.145) * (-621.078) (-621.674) [-618.416] (-620.743) -- 0:00:54
269000 -- (-622.343) (-620.720) (-622.573) [-621.214] * (-620.955) (-621.688) [-622.218] (-620.341) -- 0:00:54
269500 -- (-627.082) [-619.030] (-622.146) (-621.138) * (-621.113) (-622.665) [-620.703] (-618.404) -- 0:00:54
270000 -- [-619.983] (-624.372) (-622.550) (-622.831) * (-621.531) [-620.242] (-621.958) (-623.630) -- 0:00:56
Average standard deviation of split frequencies: 0.013643
270500 -- (-622.256) (-621.798) [-623.382] (-619.418) * (-624.966) (-619.982) (-623.496) [-619.975] -- 0:00:56
271000 -- (-621.233) (-620.561) [-620.340] (-620.650) * (-621.949) [-621.450] (-622.088) (-621.476) -- 0:00:56
271500 -- (-620.744) [-619.393] (-624.408) (-621.201) * (-620.731) [-621.019] (-622.692) (-622.882) -- 0:00:56
272000 -- (-624.434) (-620.623) [-621.345] (-623.369) * (-622.764) (-621.875) [-619.922] (-623.305) -- 0:00:56
272500 -- [-619.496] (-620.865) (-620.480) (-623.894) * (-621.417) (-621.022) [-618.987] (-624.311) -- 0:00:56
273000 -- [-620.152] (-621.292) (-623.856) (-621.987) * (-622.169) (-620.965) (-618.861) [-621.616] -- 0:00:55
273500 -- (-620.514) [-622.092] (-624.001) (-624.859) * (-624.586) (-623.338) (-619.697) [-623.646] -- 0:00:55
274000 -- (-621.151) (-620.647) [-620.018] (-621.119) * (-622.792) [-618.316] (-619.638) (-621.939) -- 0:00:55
274500 -- (-621.783) [-620.601] (-620.026) (-620.260) * (-623.018) (-621.540) [-622.869] (-621.132) -- 0:00:55
275000 -- (-624.149) [-625.564] (-625.968) (-619.566) * (-621.451) (-621.230) [-619.767] (-621.088) -- 0:00:55
Average standard deviation of split frequencies: 0.013569
275500 -- (-622.355) (-627.064) (-626.387) [-623.630] * [-620.594] (-620.237) (-620.878) (-619.962) -- 0:00:55
276000 -- [-620.809] (-619.701) (-619.283) (-629.623) * [-621.572] (-620.682) (-621.691) (-621.054) -- 0:00:55
276500 -- (-625.495) [-619.434] (-624.795) (-624.879) * (-619.588) [-619.794] (-623.227) (-620.936) -- 0:00:54
277000 -- (-624.903) (-621.053) [-627.144] (-621.886) * (-627.094) [-621.659] (-618.965) (-621.271) -- 0:00:54
277500 -- [-621.046] (-620.905) (-621.004) (-622.839) * (-623.176) (-620.456) (-621.049) [-619.218] -- 0:00:54
278000 -- (-622.403) [-619.665] (-619.637) (-623.146) * [-623.607] (-620.453) (-624.223) (-622.785) -- 0:00:54
278500 -- (-621.361) [-622.280] (-621.735) (-620.285) * (-619.624) [-621.110] (-621.913) (-621.494) -- 0:00:54
279000 -- [-620.650] (-625.755) (-625.445) (-621.690) * [-619.589] (-620.894) (-624.466) (-618.189) -- 0:00:54
279500 -- (-626.925) [-622.204] (-619.940) (-622.112) * (-621.318) (-621.527) (-622.314) [-619.942] -- 0:00:54
280000 -- [-617.286] (-619.875) (-624.654) (-619.774) * (-621.203) (-621.017) (-620.371) [-619.460] -- 0:00:53
Average standard deviation of split frequencies: 0.013623
280500 -- (-620.204) (-619.246) [-620.778] (-621.300) * (-623.909) (-623.666) [-621.552] (-621.816) -- 0:00:53
281000 -- (-619.280) (-621.135) [-621.740] (-619.186) * [-622.951] (-622.373) (-621.894) (-622.301) -- 0:00:53
281500 -- (-621.269) (-621.166) [-622.681] (-619.328) * (-623.324) (-624.362) [-619.685] (-624.560) -- 0:00:53
282000 -- [-621.156] (-619.358) (-622.319) (-624.383) * [-625.466] (-621.703) (-621.366) (-623.588) -- 0:00:53
282500 -- (-624.525) (-622.667) (-621.499) [-618.872] * (-623.707) (-621.747) [-620.193] (-621.459) -- 0:00:53
283000 -- [-620.818] (-624.749) (-621.554) (-623.637) * (-622.271) (-620.812) [-622.285] (-623.328) -- 0:00:53
283500 -- [-620.078] (-620.653) (-622.946) (-620.122) * [-621.122] (-621.947) (-620.291) (-620.525) -- 0:00:53
284000 -- (-618.843) (-619.165) (-624.673) [-620.675] * (-619.745) (-628.406) (-619.793) [-625.725] -- 0:00:52
284500 -- (-622.963) (-620.098) (-621.029) [-621.632] * (-624.053) [-622.165] (-621.393) (-622.977) -- 0:00:52
285000 -- (-621.460) [-619.948] (-622.485) (-619.299) * (-622.925) (-620.741) (-625.329) [-621.581] -- 0:00:52
Average standard deviation of split frequencies: 0.015082
285500 -- (-620.979) (-618.523) [-620.844] (-621.501) * [-622.124] (-621.474) (-619.996) (-622.934) -- 0:00:55
286000 -- (-620.465) (-623.122) (-623.397) [-622.815] * (-624.285) (-622.478) [-621.007] (-618.996) -- 0:00:54
286500 -- (-625.664) (-621.412) [-620.375] (-621.382) * (-623.291) [-622.766] (-620.755) (-622.991) -- 0:00:54
287000 -- (-622.805) [-619.623] (-629.518) (-620.516) * (-625.804) (-621.544) (-620.335) [-622.461] -- 0:00:54
287500 -- (-622.571) (-622.428) [-621.944] (-621.564) * (-621.630) (-623.451) [-620.212] (-620.168) -- 0:00:54
288000 -- (-620.486) (-621.900) [-622.713] (-622.898) * (-622.394) (-623.951) (-620.900) [-623.786] -- 0:00:54
288500 -- [-622.235] (-620.458) (-621.287) (-618.533) * (-620.735) (-623.991) (-621.029) [-619.835] -- 0:00:54
289000 -- (-620.195) (-621.020) (-621.223) [-622.647] * (-619.681) (-619.936) [-627.128] (-619.374) -- 0:00:54
289500 -- (-622.733) (-621.190) (-622.023) [-622.247] * (-623.397) (-624.365) [-620.266] (-621.261) -- 0:00:53
290000 -- (-623.857) (-621.029) [-621.573] (-620.121) * (-620.615) (-621.339) (-621.267) [-621.580] -- 0:00:53
Average standard deviation of split frequencies: 0.014776
290500 -- (-621.058) (-621.792) (-622.117) [-624.240] * (-626.101) (-623.140) [-620.627] (-623.482) -- 0:00:53
291000 -- (-621.754) (-621.409) (-624.468) [-622.117] * (-624.231) [-623.296] (-618.839) (-624.087) -- 0:00:53
291500 -- (-621.442) [-622.448] (-621.697) (-621.148) * (-620.976) [-621.534] (-620.415) (-621.827) -- 0:00:53
292000 -- (-620.413) (-621.201) [-621.766] (-622.778) * (-620.604) [-620.701] (-619.890) (-620.189) -- 0:00:53
292500 -- (-620.802) [-624.700] (-621.434) (-621.600) * (-621.602) (-621.505) [-621.987] (-619.189) -- 0:00:53
293000 -- (-630.775) (-621.015) [-620.754] (-625.022) * (-624.019) (-623.412) (-621.438) [-620.687] -- 0:00:53
293500 -- (-622.250) [-622.453] (-619.722) (-621.628) * (-622.149) [-621.493] (-622.856) (-623.535) -- 0:00:52
294000 -- (-621.380) (-620.822) [-620.319] (-619.563) * (-619.708) (-621.446) (-621.169) [-619.168] -- 0:00:52
294500 -- (-621.590) (-619.513) (-621.211) [-621.131] * (-623.593) [-622.148] (-620.263) (-623.169) -- 0:00:52
295000 -- [-620.004] (-622.075) (-620.942) (-622.541) * (-619.756) (-621.100) [-619.745] (-620.426) -- 0:00:52
Average standard deviation of split frequencies: 0.014082
295500 -- (-622.781) [-618.488] (-619.162) (-622.176) * [-622.707] (-620.014) (-620.750) (-621.791) -- 0:00:52
296000 -- [-623.814] (-618.566) (-621.055) (-621.790) * (-621.442) (-624.137) [-620.174] (-622.640) -- 0:00:52
296500 -- (-619.847) (-619.377) [-622.255] (-620.973) * (-620.031) (-622.079) (-619.369) [-621.645] -- 0:00:52
297000 -- [-622.374] (-619.706) (-623.171) (-622.383) * (-622.337) (-622.134) [-619.279] (-621.802) -- 0:00:52
297500 -- [-619.425] (-622.334) (-623.942) (-627.133) * (-621.544) (-622.228) [-620.245] (-621.454) -- 0:00:51
298000 -- [-622.545] (-620.381) (-620.118) (-622.201) * (-620.775) [-623.840] (-622.242) (-626.433) -- 0:00:51
298500 -- [-620.276] (-621.018) (-619.398) (-621.754) * (-621.584) (-625.187) (-623.312) [-622.622] -- 0:00:51
299000 -- (-626.070) (-618.364) (-619.046) [-620.084] * (-620.337) (-624.323) [-623.072] (-625.047) -- 0:00:51
299500 -- (-623.784) [-619.204] (-622.032) (-621.854) * [-620.143] (-623.929) (-621.391) (-621.024) -- 0:00:51
300000 -- (-623.776) [-621.626] (-621.348) (-622.438) * [-621.562] (-620.587) (-619.902) (-622.945) -- 0:00:51
Average standard deviation of split frequencies: 0.014982
300500 -- [-622.546] (-621.032) (-621.569) (-622.699) * (-619.910) [-626.947] (-622.194) (-622.120) -- 0:00:53
301000 -- [-622.294] (-620.459) (-621.360) (-621.013) * (-618.407) (-621.113) [-623.681] (-621.158) -- 0:00:53
301500 -- [-618.415] (-623.995) (-620.310) (-621.765) * [-622.428] (-621.132) (-622.937) (-621.439) -- 0:00:53
302000 -- (-621.031) (-625.257) [-618.984] (-619.846) * (-619.370) (-622.186) (-621.686) [-623.377] -- 0:00:53
302500 -- (-622.585) (-619.017) [-619.496] (-620.023) * (-621.324) (-619.883) (-623.647) [-620.538] -- 0:00:53
303000 -- (-623.639) [-619.592] (-623.164) (-620.746) * (-620.458) [-619.355] (-622.312) (-621.643) -- 0:00:52
303500 -- (-623.001) (-621.229) [-621.144] (-620.878) * (-622.528) [-621.576] (-620.508) (-622.409) -- 0:00:52
304000 -- (-621.543) (-620.887) [-621.500] (-619.575) * (-622.039) (-619.921) [-620.559] (-624.207) -- 0:00:52
304500 -- (-622.219) (-621.585) [-622.795] (-621.874) * [-619.766] (-620.437) (-618.712) (-619.851) -- 0:00:52
305000 -- (-622.485) (-619.505) [-620.223] (-621.620) * (-619.963) (-622.374) [-620.064] (-620.459) -- 0:00:52
Average standard deviation of split frequencies: 0.013557
305500 -- [-620.568] (-624.388) (-619.450) (-621.494) * [-620.985] (-624.043) (-620.083) (-619.870) -- 0:00:52
306000 -- (-623.292) [-619.881] (-620.439) (-623.625) * (-620.955) (-619.668) [-619.632] (-621.739) -- 0:00:52
306500 -- [-625.370] (-619.559) (-624.413) (-620.872) * [-621.714] (-621.113) (-623.583) (-625.163) -- 0:00:52
307000 -- (-619.658) (-622.343) (-619.552) [-619.635] * (-619.299) [-621.497] (-622.101) (-624.289) -- 0:00:51
307500 -- [-622.098] (-621.297) (-618.392) (-619.801) * (-621.547) (-623.181) (-619.297) [-619.862] -- 0:00:51
308000 -- (-620.625) (-625.164) (-619.213) [-622.617] * [-620.982] (-624.252) (-618.980) (-622.550) -- 0:00:51
308500 -- (-622.399) (-625.423) (-620.438) [-620.637] * (-622.538) (-620.480) (-619.365) [-619.319] -- 0:00:51
309000 -- (-621.108) (-620.881) (-621.083) [-625.011] * (-622.887) (-622.286) (-619.749) [-620.258] -- 0:00:51
309500 -- [-619.352] (-626.350) (-621.688) (-622.115) * [-619.989] (-620.875) (-619.805) (-620.316) -- 0:00:51
310000 -- (-621.209) (-623.091) [-617.620] (-624.449) * (-621.188) (-621.172) (-620.695) [-621.571] -- 0:00:51
Average standard deviation of split frequencies: 0.014001
310500 -- (-626.217) (-626.428) (-622.328) [-619.930] * [-622.442] (-620.184) (-618.631) (-622.724) -- 0:00:51
311000 -- [-622.347] (-620.341) (-620.216) (-620.958) * (-623.622) [-619.675] (-622.481) (-622.982) -- 0:00:50
311500 -- (-621.598) [-621.676] (-623.334) (-619.883) * (-625.139) [-620.821] (-622.026) (-619.615) -- 0:00:50
312000 -- (-620.502) [-622.844] (-619.849) (-621.851) * (-621.788) [-621.919] (-621.885) (-621.145) -- 0:00:50
312500 -- (-620.025) [-621.255] (-623.589) (-620.442) * (-623.256) [-620.876] (-621.728) (-622.118) -- 0:00:50
313000 -- [-621.093] (-622.171) (-621.009) (-623.395) * (-622.778) (-619.662) (-618.594) [-623.910] -- 0:00:50
313500 -- (-622.097) [-622.973] (-622.176) (-624.495) * (-623.698) (-619.027) [-621.662] (-621.657) -- 0:00:50
314000 -- (-620.012) [-625.088] (-621.093) (-619.120) * (-619.642) (-624.676) (-621.881) [-622.637] -- 0:00:50
314500 -- [-619.329] (-620.298) (-623.657) (-618.817) * [-619.370] (-623.822) (-623.078) (-624.433) -- 0:00:50
315000 -- (-621.531) (-621.034) (-625.794) [-621.130] * (-619.339) (-619.454) (-620.584) [-621.455] -- 0:00:50
Average standard deviation of split frequencies: 0.013034
315500 -- (-621.469) (-624.219) (-622.102) [-622.366] * (-624.521) (-627.811) [-619.389] (-621.773) -- 0:00:49
316000 -- (-623.681) [-620.901] (-622.483) (-619.773) * (-618.935) (-620.839) [-620.738] (-622.966) -- 0:00:51
316500 -- (-624.113) (-621.554) [-623.263] (-620.388) * [-621.434] (-618.427) (-624.381) (-623.256) -- 0:00:51
317000 -- (-618.660) [-620.033] (-622.750) (-620.210) * (-627.372) [-619.872] (-624.282) (-622.010) -- 0:00:51
317500 -- (-622.188) (-621.421) (-626.124) [-623.685] * (-627.280) [-622.281] (-621.347) (-620.239) -- 0:00:51
318000 -- (-619.807) (-620.200) (-619.677) [-619.989] * [-620.753] (-624.301) (-621.119) (-622.310) -- 0:00:51
318500 -- (-624.827) (-623.733) [-622.720] (-620.599) * (-621.895) [-621.039] (-621.353) (-619.143) -- 0:00:51
319000 -- (-618.595) [-626.749] (-620.357) (-623.375) * (-621.153) (-621.114) [-621.774] (-620.417) -- 0:00:51
319500 -- [-619.924] (-623.192) (-620.844) (-621.458) * [-621.738] (-623.496) (-621.612) (-620.732) -- 0:00:51
320000 -- (-620.894) (-624.187) [-620.106] (-620.544) * (-621.158) (-622.881) (-621.462) [-622.539] -- 0:00:50
Average standard deviation of split frequencies: 0.012380
320500 -- (-622.552) [-619.786] (-621.831) (-620.855) * [-620.107] (-628.630) (-621.391) (-623.509) -- 0:00:50
321000 -- (-620.543) (-624.485) [-629.092] (-621.063) * (-626.044) (-621.034) (-624.436) [-620.189] -- 0:00:50
321500 -- [-620.889] (-618.168) (-622.264) (-620.984) * (-624.970) (-621.915) (-618.988) [-618.827] -- 0:00:50
322000 -- (-621.506) [-621.417] (-623.936) (-620.855) * [-620.474] (-624.270) (-621.654) (-624.644) -- 0:00:50
322500 -- (-621.016) (-618.477) (-624.670) [-620.464] * (-621.589) (-620.349) [-620.547] (-621.885) -- 0:00:50
323000 -- (-620.393) (-619.071) [-620.733] (-622.430) * [-621.885] (-621.395) (-625.105) (-619.385) -- 0:00:50
323500 -- (-624.518) [-621.289] (-620.942) (-621.434) * (-620.982) [-618.889] (-622.516) (-619.251) -- 0:00:50
324000 -- [-624.375] (-621.200) (-623.953) (-620.015) * (-622.392) [-619.925] (-624.075) (-621.222) -- 0:00:50
324500 -- (-622.346) (-620.980) (-623.908) [-619.080] * (-622.741) (-626.500) [-619.572] (-621.224) -- 0:00:49
325000 -- (-620.157) [-622.413] (-619.939) (-622.115) * (-623.508) (-620.739) (-621.793) [-621.492] -- 0:00:49
Average standard deviation of split frequencies: 0.012074
325500 -- (-619.701) (-620.125) [-619.957] (-624.078) * (-623.996) (-622.856) [-620.973] (-619.925) -- 0:00:49
326000 -- [-620.754] (-619.450) (-622.049) (-625.929) * (-622.481) (-624.425) (-619.920) [-623.838] -- 0:00:49
326500 -- (-620.787) (-622.784) [-623.231] (-621.991) * (-621.143) [-623.058] (-623.844) (-621.900) -- 0:00:49
327000 -- (-619.692) (-622.323) (-623.413) [-621.202] * [-625.730] (-623.440) (-621.510) (-622.450) -- 0:00:49
327500 -- (-618.795) [-623.142] (-626.374) (-625.180) * (-624.362) [-621.661] (-619.505) (-624.466) -- 0:00:49
328000 -- [-622.493] (-622.844) (-621.215) (-623.409) * [-623.844] (-623.519) (-619.985) (-621.796) -- 0:00:49
328500 -- (-622.490) [-624.163] (-622.227) (-622.120) * [-622.692] (-619.548) (-620.778) (-622.719) -- 0:00:49
329000 -- (-621.701) [-619.068] (-622.161) (-626.959) * [-623.614] (-621.079) (-619.839) (-622.564) -- 0:00:48
329500 -- (-622.490) (-621.299) [-621.540] (-624.910) * (-626.682) (-621.913) [-621.500] (-620.828) -- 0:00:48
330000 -- (-621.135) [-623.210] (-620.904) (-622.958) * (-625.946) [-621.665] (-621.213) (-622.507) -- 0:00:48
Average standard deviation of split frequencies: 0.012189
330500 -- (-619.224) (-624.321) (-623.125) [-621.293] * (-620.780) [-621.937] (-626.884) (-623.964) -- 0:00:50
331000 -- (-621.989) (-622.158) [-623.875] (-620.565) * (-623.196) (-622.188) (-622.112) [-620.656] -- 0:00:50
331500 -- (-619.961) (-618.795) (-620.654) [-623.353] * (-621.837) [-621.551] (-621.178) (-622.056) -- 0:00:50
332000 -- [-619.583] (-622.685) (-621.313) (-620.824) * (-625.705) (-621.353) (-622.055) [-618.943] -- 0:00:50
332500 -- (-619.560) (-620.815) (-620.537) [-619.301] * [-624.170] (-623.352) (-624.952) (-618.884) -- 0:00:50
333000 -- [-621.497] (-621.216) (-621.073) (-620.454) * (-621.996) [-621.729] (-625.228) (-620.767) -- 0:00:50
333500 -- [-620.710] (-621.098) (-620.428) (-619.381) * (-622.765) (-623.226) (-627.277) [-623.057] -- 0:00:49
334000 -- (-622.100) [-620.704] (-623.885) (-622.454) * (-621.239) (-620.263) (-626.046) [-619.957] -- 0:00:49
334500 -- (-621.391) (-622.268) (-622.942) [-619.405] * (-620.627) [-622.039] (-625.567) (-619.775) -- 0:00:49
335000 -- [-620.766] (-623.052) (-623.450) (-620.954) * (-623.560) (-624.632) (-619.875) [-621.713] -- 0:00:49
Average standard deviation of split frequencies: 0.010633
335500 -- (-622.323) (-619.112) [-620.646] (-618.232) * [-623.014] (-623.283) (-621.139) (-620.769) -- 0:00:49
336000 -- [-620.517] (-621.860) (-620.285) (-620.262) * (-623.188) (-622.671) (-621.958) [-619.527] -- 0:00:49
336500 -- (-624.280) [-620.628] (-621.229) (-621.846) * [-622.132] (-622.811) (-621.860) (-623.839) -- 0:00:49
337000 -- (-619.396) (-622.937) (-622.175) [-621.394] * (-620.026) (-622.011) (-621.454) [-619.796] -- 0:00:49
337500 -- (-619.281) (-620.657) (-620.068) [-622.703] * (-623.918) (-622.648) [-621.445] (-618.548) -- 0:00:49
338000 -- (-621.578) [-620.634] (-623.785) (-621.653) * (-622.062) (-622.814) [-621.043] (-622.062) -- 0:00:48
338500 -- (-620.669) [-620.486] (-623.694) (-624.103) * (-619.977) [-622.236] (-626.086) (-619.493) -- 0:00:48
339000 -- [-621.689] (-620.915) (-620.132) (-621.782) * [-620.625] (-622.843) (-623.053) (-621.581) -- 0:00:48
339500 -- [-619.293] (-620.477) (-620.313) (-621.524) * (-622.480) (-627.235) (-623.812) [-621.846] -- 0:00:48
340000 -- (-623.753) (-624.080) [-625.235] (-626.090) * (-620.318) (-618.906) [-619.155] (-625.182) -- 0:00:48
Average standard deviation of split frequencies: 0.010633
340500 -- (-622.818) [-621.941] (-624.599) (-623.517) * (-624.312) [-621.732] (-623.841) (-624.291) -- 0:00:48
341000 -- (-621.593) (-623.577) [-620.614] (-623.838) * (-621.613) (-621.925) [-622.695] (-623.058) -- 0:00:48
341500 -- [-621.818] (-622.069) (-621.987) (-625.537) * [-623.211] (-621.197) (-623.076) (-621.787) -- 0:00:48
342000 -- [-621.751] (-625.407) (-619.591) (-622.062) * [-621.281] (-622.655) (-622.197) (-620.985) -- 0:00:48
342500 -- (-627.643) [-621.651] (-622.155) (-626.057) * (-621.399) [-620.733] (-622.558) (-621.224) -- 0:00:47
343000 -- (-625.291) (-621.031) [-622.270] (-619.950) * (-621.916) (-620.561) (-621.773) [-623.540] -- 0:00:49
343500 -- (-621.545) (-623.093) [-622.380] (-617.372) * [-622.262] (-621.027) (-620.445) (-622.420) -- 0:00:49
344000 -- [-622.232] (-617.718) (-622.654) (-622.934) * (-620.599) (-623.160) [-620.608] (-623.617) -- 0:00:49
344500 -- (-621.286) (-622.389) [-625.076] (-625.015) * (-622.759) (-619.916) (-620.675) [-623.227] -- 0:00:49
345000 -- (-623.001) (-624.153) [-623.904] (-622.440) * (-623.422) [-619.445] (-622.702) (-622.264) -- 0:00:49
Average standard deviation of split frequencies: 0.011140
345500 -- [-621.477] (-622.892) (-626.336) (-621.886) * (-625.081) [-621.213] (-622.206) (-624.885) -- 0:00:49
346000 -- (-621.302) (-625.295) (-622.269) [-621.319] * (-624.181) (-623.551) (-620.174) [-625.625] -- 0:00:49
346500 -- (-621.063) (-623.772) [-623.064] (-620.733) * (-623.297) [-620.608] (-624.584) (-620.692) -- 0:00:49
347000 -- [-621.318] (-620.006) (-622.416) (-625.679) * [-619.274] (-620.793) (-625.809) (-621.391) -- 0:00:48
347500 -- (-622.543) [-620.642] (-622.335) (-622.178) * (-622.117) [-626.458] (-621.718) (-621.271) -- 0:00:48
348000 -- [-621.456] (-621.218) (-623.409) (-619.069) * (-624.298) (-622.623) (-620.750) [-620.019] -- 0:00:48
348500 -- (-621.948) (-623.553) [-620.692] (-618.235) * [-621.376] (-621.124) (-620.918) (-620.819) -- 0:00:48
349000 -- (-622.213) [-619.651] (-620.944) (-621.013) * (-622.779) [-625.669] (-623.355) (-621.504) -- 0:00:48
349500 -- (-624.363) [-624.839] (-618.956) (-620.189) * (-623.263) (-622.683) [-620.893] (-621.036) -- 0:00:48
350000 -- (-620.173) (-620.982) (-623.862) [-619.579] * (-620.708) (-621.394) (-623.425) [-622.669] -- 0:00:48
Average standard deviation of split frequencies: 0.010754
350500 -- [-618.872] (-620.811) (-623.658) (-620.620) * [-621.023] (-620.769) (-621.182) (-620.535) -- 0:00:48
351000 -- (-620.315) (-622.011) (-620.091) [-620.997] * (-623.172) [-622.021] (-619.613) (-619.293) -- 0:00:48
351500 -- [-619.601] (-620.828) (-618.670) (-621.136) * [-621.335] (-621.173) (-622.921) (-620.431) -- 0:00:47
352000 -- (-621.870) (-623.383) (-623.230) [-621.018] * (-622.678) [-618.564] (-621.899) (-624.284) -- 0:00:47
352500 -- (-626.824) (-625.180) (-621.852) [-622.997] * [-620.425] (-621.835) (-620.959) (-622.091) -- 0:00:47
353000 -- (-622.853) (-623.307) [-621.269] (-624.004) * (-619.555) [-621.676] (-622.143) (-625.952) -- 0:00:47
353500 -- [-630.068] (-625.514) (-623.842) (-621.573) * (-621.428) [-618.450] (-620.751) (-624.235) -- 0:00:47
354000 -- [-621.468] (-625.265) (-625.430) (-624.296) * (-622.435) (-619.547) (-621.401) [-621.223] -- 0:00:47
354500 -- (-622.518) (-620.888) (-619.941) [-623.561] * (-620.625) (-621.190) [-621.306] (-623.143) -- 0:00:47
355000 -- (-622.828) [-622.422] (-620.348) (-626.258) * [-619.033] (-620.411) (-622.485) (-621.015) -- 0:00:47
Average standard deviation of split frequencies: 0.009659
355500 -- (-618.582) (-621.609) [-622.216] (-623.132) * [-619.285] (-621.821) (-623.825) (-619.214) -- 0:00:47
356000 -- (-622.717) (-621.834) (-620.514) [-622.876] * (-622.955) [-623.524] (-626.178) (-622.032) -- 0:00:47
356500 -- [-621.720] (-621.718) (-621.184) (-619.584) * [-621.559] (-622.702) (-620.195) (-620.261) -- 0:00:46
357000 -- [-619.792] (-623.635) (-619.165) (-623.231) * (-618.680) (-619.701) (-620.833) [-621.475] -- 0:00:48
357500 -- (-622.020) (-622.029) [-621.605] (-620.089) * (-620.676) (-621.542) [-619.682] (-622.418) -- 0:00:48
358000 -- (-621.451) (-622.483) [-621.046] (-619.520) * [-622.896] (-619.741) (-624.924) (-627.602) -- 0:00:48
358500 -- (-620.942) [-623.912] (-621.261) (-620.891) * (-619.112) [-620.902] (-621.524) (-620.617) -- 0:00:48
359000 -- (-620.674) (-621.997) [-622.909] (-621.039) * (-621.380) [-619.501] (-621.763) (-621.978) -- 0:00:48
359500 -- [-620.310] (-622.147) (-621.210) (-621.259) * (-618.372) [-622.486] (-621.733) (-623.075) -- 0:00:48
360000 -- (-620.299) (-622.351) [-623.810] (-622.127) * (-618.651) (-621.819) [-619.100] (-622.716) -- 0:00:47
Average standard deviation of split frequencies: 0.009639
360500 -- [-621.904] (-623.293) (-622.040) (-625.132) * [-620.195] (-619.879) (-624.583) (-620.504) -- 0:00:47
361000 -- (-622.316) [-623.244] (-621.339) (-624.762) * [-621.143] (-621.884) (-622.419) (-621.612) -- 0:00:47
361500 -- [-627.198] (-622.114) (-624.146) (-623.635) * (-622.473) [-619.179] (-621.102) (-622.068) -- 0:00:47
362000 -- (-620.431) (-620.917) [-619.997] (-622.416) * (-622.122) [-620.150] (-623.286) (-621.607) -- 0:00:47
362500 -- (-622.439) [-623.342] (-621.394) (-622.068) * (-618.463) [-620.905] (-619.950) (-622.218) -- 0:00:47
363000 -- (-620.328) (-624.265) [-621.803] (-623.730) * (-624.794) (-623.581) [-621.156] (-623.029) -- 0:00:47
363500 -- [-620.237] (-624.834) (-623.446) (-621.277) * [-628.819] (-621.136) (-620.686) (-624.096) -- 0:00:47
364000 -- (-623.380) [-624.320] (-624.085) (-623.856) * (-625.050) (-624.644) (-621.679) [-622.691] -- 0:00:47
364500 -- (-625.733) (-620.100) (-628.036) [-619.826] * [-619.601] (-620.654) (-623.053) (-620.116) -- 0:00:47
365000 -- [-623.226] (-623.295) (-622.560) (-621.766) * (-621.727) (-625.363) (-622.264) [-620.507] -- 0:00:46
Average standard deviation of split frequencies: 0.009159
365500 -- [-623.379] (-621.961) (-620.665) (-620.478) * (-623.047) (-620.069) [-623.911] (-620.757) -- 0:00:46
366000 -- [-622.459] (-623.261) (-621.318) (-624.345) * (-622.130) (-621.125) [-621.421] (-621.143) -- 0:00:46
366500 -- (-618.702) (-620.286) [-621.998] (-619.660) * (-621.716) (-622.822) (-623.650) [-621.562] -- 0:00:46
367000 -- [-622.206] (-621.737) (-627.260) (-625.967) * (-623.911) (-628.290) [-619.965] (-620.815) -- 0:00:46
367500 -- (-618.723) (-622.177) [-628.785] (-622.696) * (-620.441) [-620.211] (-622.661) (-620.192) -- 0:00:46
368000 -- (-621.341) [-621.354] (-622.687) (-621.296) * [-621.339] (-622.894) (-622.804) (-621.303) -- 0:00:46
368500 -- (-620.610) [-620.677] (-621.710) (-620.022) * [-621.898] (-620.882) (-623.773) (-620.500) -- 0:00:46
369000 -- (-620.309) (-624.703) (-620.166) [-621.225] * [-622.173] (-620.680) (-621.418) (-622.179) -- 0:00:46
369500 -- (-621.086) [-619.366] (-623.105) (-624.708) * (-622.349) (-619.915) (-628.578) [-622.416] -- 0:00:46
370000 -- (-623.824) (-620.733) (-622.561) [-622.111] * (-619.932) (-619.204) (-622.612) [-621.656] -- 0:00:45
Average standard deviation of split frequencies: 0.008977
370500 -- (-620.768) (-621.241) [-622.279] (-621.524) * (-619.706) (-621.481) (-624.184) [-619.775] -- 0:00:45
371000 -- (-620.570) (-622.011) (-620.667) [-620.565] * (-622.532) (-622.410) (-624.522) [-622.094] -- 0:00:45
371500 -- (-620.666) (-621.378) [-621.009] (-622.119) * (-620.078) (-623.764) (-623.709) [-619.476] -- 0:00:45
372000 -- (-622.354) [-619.774] (-620.275) (-620.781) * (-620.850) (-622.356) (-618.682) [-620.579] -- 0:00:45
372500 -- (-621.059) (-620.910) [-618.860] (-623.079) * (-622.216) (-622.865) (-623.683) [-625.364] -- 0:00:47
373000 -- (-620.977) [-621.149] (-618.851) (-619.184) * (-622.753) [-621.092] (-623.261) (-619.611) -- 0:00:47
373500 -- (-622.640) (-618.482) (-623.869) [-621.209] * (-619.462) (-621.713) (-622.777) [-619.563] -- 0:00:46
374000 -- (-620.692) [-620.856] (-620.329) (-621.985) * [-621.173] (-621.261) (-631.859) (-620.533) -- 0:00:46
374500 -- [-622.612] (-621.820) (-623.394) (-620.622) * (-620.722) (-622.109) (-622.091) [-619.809] -- 0:00:46
375000 -- (-622.790) (-618.335) (-622.694) [-619.559] * (-620.889) [-623.124] (-622.029) (-619.304) -- 0:00:46
Average standard deviation of split frequencies: 0.009809
375500 -- [-619.279] (-620.562) (-619.157) (-623.533) * (-621.886) (-621.131) (-626.299) [-622.087] -- 0:00:46
376000 -- (-623.249) (-621.447) [-621.840] (-620.767) * (-622.255) [-621.209] (-626.401) (-622.156) -- 0:00:46
376500 -- (-625.551) [-622.113] (-622.203) (-618.104) * (-621.730) [-625.199] (-625.487) (-622.130) -- 0:00:46
377000 -- (-620.988) [-621.224] (-621.877) (-619.623) * (-621.252) (-622.035) [-619.610] (-622.324) -- 0:00:46
377500 -- (-623.727) (-621.861) (-627.449) [-623.267] * (-620.940) [-620.817] (-620.878) (-620.968) -- 0:00:46
378000 -- (-622.439) (-620.796) (-622.298) [-621.221] * (-621.374) (-618.988) (-625.112) [-624.962] -- 0:00:46
378500 -- (-623.606) (-619.022) [-621.308] (-619.149) * (-619.043) (-622.956) [-624.192] (-624.318) -- 0:00:45
379000 -- (-620.671) (-620.742) [-619.615] (-626.211) * (-622.248) (-626.910) (-622.306) [-618.299] -- 0:00:45
379500 -- (-620.502) (-618.896) [-620.918] (-623.607) * [-622.005] (-622.546) (-621.995) (-623.211) -- 0:00:45
380000 -- (-622.817) [-624.570] (-619.781) (-622.651) * [-618.561] (-622.702) (-621.820) (-621.240) -- 0:00:45
Average standard deviation of split frequencies: 0.008746
380500 -- (-621.945) (-621.804) [-621.085] (-621.208) * (-623.262) [-619.216] (-622.557) (-618.829) -- 0:00:45
381000 -- [-621.491] (-620.970) (-624.118) (-619.647) * (-620.608) [-624.955] (-621.943) (-623.995) -- 0:00:45
381500 -- [-620.016] (-622.068) (-620.836) (-619.709) * [-618.811] (-619.886) (-622.229) (-623.235) -- 0:00:45
382000 -- [-621.052] (-621.687) (-619.560) (-621.246) * [-618.642] (-622.637) (-622.341) (-622.271) -- 0:00:45
382500 -- (-624.111) (-620.471) (-622.694) [-623.651] * (-619.343) (-623.406) (-621.749) [-618.843] -- 0:00:45
383000 -- (-619.269) (-620.085) (-621.189) [-621.351] * [-619.206] (-620.538) (-621.763) (-618.720) -- 0:00:45
383500 -- (-621.451) (-619.958) [-623.684] (-623.480) * [-622.743] (-621.849) (-621.674) (-621.226) -- 0:00:45
384000 -- (-624.687) (-619.664) [-620.501] (-619.302) * (-622.318) (-620.821) (-621.304) [-619.449] -- 0:00:44
384500 -- (-619.214) (-623.861) (-620.294) [-620.483] * (-622.027) (-624.881) [-623.232] (-621.409) -- 0:00:44
385000 -- (-623.106) (-620.322) (-622.061) [-622.242] * (-623.256) (-623.909) [-622.019] (-620.502) -- 0:00:44
Average standard deviation of split frequencies: 0.008549
385500 -- (-626.001) (-620.104) (-620.657) [-619.844] * [-620.755] (-622.334) (-623.906) (-619.647) -- 0:00:44
386000 -- (-623.878) [-622.267] (-622.023) (-619.648) * [-621.366] (-621.930) (-624.585) (-620.911) -- 0:00:44
386500 -- (-623.271) (-624.267) [-621.113] (-619.637) * (-621.668) (-622.065) [-619.785] (-620.474) -- 0:00:44
387000 -- (-619.935) (-624.343) [-621.955] (-621.404) * (-621.092) (-621.147) (-622.364) [-622.508] -- 0:00:44
387500 -- (-625.530) (-620.964) (-620.489) [-622.475] * (-620.412) (-620.944) [-624.325] (-619.598) -- 0:00:44
388000 -- (-621.261) (-620.718) (-621.320) [-620.936] * (-621.754) (-623.884) (-622.019) [-621.106] -- 0:00:45
388500 -- (-621.982) (-622.926) [-622.250] (-617.969) * (-624.322) [-619.472] (-626.590) (-620.553) -- 0:00:45
389000 -- (-622.311) (-625.436) (-621.287) [-621.598] * (-621.593) [-623.151] (-619.761) (-621.938) -- 0:00:45
389500 -- (-626.282) (-623.189) (-620.990) [-619.309] * (-621.705) [-621.431] (-626.168) (-621.311) -- 0:00:45
390000 -- (-622.453) [-617.780] (-621.027) (-618.874) * [-619.005] (-621.685) (-621.537) (-620.412) -- 0:00:45
Average standard deviation of split frequencies: 0.008163
390500 -- (-620.790) [-622.293] (-620.612) (-620.189) * (-618.462) [-621.841] (-623.229) (-618.943) -- 0:00:45
391000 -- (-622.150) [-622.831] (-621.006) (-620.194) * (-619.243) (-622.014) (-621.789) [-620.158] -- 0:00:45
391500 -- (-620.838) (-619.895) [-619.958] (-622.820) * (-619.999) [-622.199] (-629.561) (-618.809) -- 0:00:45
392000 -- (-622.355) (-622.411) (-621.161) [-619.565] * (-621.992) [-621.047] (-619.705) (-620.815) -- 0:00:44
392500 -- (-624.945) [-619.628] (-619.437) (-620.466) * (-620.401) (-621.829) [-621.582] (-622.941) -- 0:00:44
393000 -- (-621.678) (-619.675) (-622.909) [-619.713] * (-621.171) (-621.162) (-620.482) [-619.294] -- 0:00:44
393500 -- [-619.457] (-619.906) (-623.870) (-620.564) * (-620.868) (-621.307) [-620.943] (-624.714) -- 0:00:44
394000 -- [-620.583] (-621.775) (-621.258) (-623.524) * (-621.578) [-620.573] (-619.786) (-622.096) -- 0:00:44
394500 -- (-624.463) (-621.022) [-622.113] (-622.770) * (-620.374) (-621.951) (-622.700) [-623.266] -- 0:00:44
395000 -- (-621.623) [-621.400] (-623.471) (-624.959) * (-622.298) (-621.234) [-620.170] (-625.436) -- 0:00:44
Average standard deviation of split frequencies: 0.009103
395500 -- (-620.648) [-619.971] (-621.706) (-621.190) * (-620.354) (-622.511) [-620.132] (-628.491) -- 0:00:44
396000 -- (-622.589) (-620.121) (-620.517) [-623.338] * (-620.191) (-621.131) (-621.104) [-622.674] -- 0:00:44
396500 -- [-622.421] (-623.349) (-624.457) (-629.630) * (-619.160) (-621.678) (-622.059) [-623.144] -- 0:00:44
397000 -- (-623.552) [-622.520] (-625.120) (-627.475) * (-618.591) [-620.801] (-618.634) (-625.719) -- 0:00:44
397500 -- (-619.816) [-619.838] (-619.933) (-623.464) * (-620.837) (-621.291) (-621.895) [-621.461] -- 0:00:43
398000 -- (-623.415) [-620.043] (-620.377) (-619.918) * (-619.930) (-624.180) [-619.185] (-621.433) -- 0:00:43
398500 -- [-622.076] (-619.077) (-620.749) (-621.722) * [-619.486] (-622.189) (-624.039) (-621.068) -- 0:00:43
399000 -- [-623.629] (-621.752) (-622.660) (-619.868) * (-620.709) (-625.863) [-618.210] (-624.435) -- 0:00:43
399500 -- (-623.774) [-622.356] (-623.573) (-624.380) * [-622.040] (-620.801) (-621.491) (-620.694) -- 0:00:43
400000 -- (-621.824) [-619.583] (-622.624) (-621.297) * (-621.921) (-620.606) (-620.030) [-619.048] -- 0:00:43
Average standard deviation of split frequencies: 0.009192
400500 -- [-620.241] (-617.114) (-623.082) (-621.455) * (-622.444) (-619.759) [-619.911] (-619.158) -- 0:00:43
401000 -- (-623.176) [-619.713] (-624.628) (-619.521) * (-620.236) (-621.476) [-620.850] (-626.503) -- 0:00:43
401500 -- (-622.023) [-622.340] (-624.165) (-619.161) * [-620.383] (-624.682) (-621.878) (-628.940) -- 0:00:43
402000 -- (-620.124) (-627.139) [-623.380] (-624.151) * [-622.234] (-624.719) (-620.390) (-623.882) -- 0:00:43
402500 -- [-620.306] (-621.596) (-621.545) (-625.437) * (-625.493) [-620.930] (-621.042) (-620.482) -- 0:00:43
403000 -- [-620.292] (-620.799) (-620.607) (-620.798) * (-623.811) (-628.342) [-620.682] (-622.811) -- 0:00:42
403500 -- (-625.516) (-622.682) (-620.570) [-620.595] * (-624.308) [-626.722] (-623.231) (-622.131) -- 0:00:44
404000 -- (-621.239) [-624.253] (-623.745) (-623.358) * (-622.243) (-624.356) (-622.456) [-619.847] -- 0:00:44
404500 -- (-623.442) [-621.129] (-623.271) (-620.567) * (-621.089) [-623.519] (-618.993) (-619.727) -- 0:00:44
405000 -- (-620.168) [-622.451] (-621.635) (-620.323) * (-621.159) (-625.021) (-621.899) [-618.900] -- 0:00:44
Average standard deviation of split frequencies: 0.009084
405500 -- (-625.081) (-626.880) (-625.104) [-621.147] * (-620.466) [-622.512] (-619.688) (-619.584) -- 0:00:43
406000 -- (-621.809) [-620.199] (-625.433) (-622.025) * (-619.259) [-620.413] (-622.996) (-620.855) -- 0:00:43
406500 -- [-627.112] (-619.914) (-620.545) (-620.363) * (-622.539) (-620.291) [-623.608] (-621.190) -- 0:00:43
407000 -- [-621.430] (-622.258) (-623.689) (-621.185) * (-619.862) [-621.464] (-623.339) (-620.432) -- 0:00:43
407500 -- (-621.801) [-620.761] (-622.240) (-623.918) * (-621.371) (-618.767) [-622.904] (-624.696) -- 0:00:43
408000 -- (-621.766) [-622.385] (-618.770) (-629.391) * [-620.503] (-620.613) (-623.217) (-622.423) -- 0:00:43
408500 -- (-620.114) [-623.229] (-621.644) (-631.606) * (-620.372) (-618.411) [-620.402] (-622.819) -- 0:00:43
409000 -- [-621.087] (-621.226) (-621.342) (-622.652) * (-620.640) (-621.827) (-623.616) [-619.503] -- 0:00:43
409500 -- (-621.933) (-623.101) [-619.655] (-622.837) * [-619.488] (-621.811) (-624.152) (-619.359) -- 0:00:43
410000 -- (-622.271) (-621.123) [-622.087] (-623.601) * (-621.184) (-621.367) [-620.139] (-622.487) -- 0:00:43
Average standard deviation of split frequencies: 0.008538
410500 -- [-621.032] (-621.222) (-622.370) (-622.078) * (-622.550) [-621.143] (-623.269) (-624.307) -- 0:00:43
411000 -- (-619.504) (-623.425) [-620.042] (-620.083) * (-620.041) (-624.508) [-620.394] (-624.858) -- 0:00:42
411500 -- [-620.469] (-621.238) (-621.726) (-620.613) * (-619.968) [-620.707] (-624.141) (-621.148) -- 0:00:42
412000 -- (-622.643) (-622.534) [-620.656] (-622.532) * (-618.455) (-620.976) (-622.156) [-619.933] -- 0:00:42
412500 -- [-622.220] (-620.618) (-623.152) (-621.510) * (-620.741) (-624.621) (-625.019) [-620.156] -- 0:00:42
413000 -- [-621.899] (-618.688) (-620.950) (-622.928) * (-622.031) (-621.649) (-620.627) [-620.385] -- 0:00:42
413500 -- (-621.050) [-623.150] (-623.187) (-621.992) * (-621.285) [-621.355] (-621.308) (-621.499) -- 0:00:42
414000 -- [-620.613] (-621.577) (-620.582) (-621.101) * (-623.515) [-620.871] (-622.207) (-621.254) -- 0:00:42
414500 -- (-619.956) [-620.476] (-625.237) (-620.422) * (-619.000) (-628.856) [-620.750] (-620.501) -- 0:00:42
415000 -- (-622.741) (-624.311) (-621.658) [-622.584] * [-619.879] (-622.166) (-621.186) (-621.575) -- 0:00:42
Average standard deviation of split frequencies: 0.008003
415500 -- (-626.523) (-623.424) [-621.844] (-621.936) * [-619.459] (-620.989) (-621.260) (-623.420) -- 0:00:42
416000 -- (-621.666) (-627.774) (-622.424) [-621.469] * [-620.100] (-622.898) (-621.967) (-621.242) -- 0:00:42
416500 -- (-622.094) (-620.672) [-620.253] (-622.721) * (-623.124) (-623.945) [-621.329] (-628.286) -- 0:00:42
417000 -- (-620.363) [-619.936] (-619.995) (-624.280) * (-621.159) [-623.146] (-620.802) (-622.268) -- 0:00:41
417500 -- [-620.673] (-620.902) (-623.811) (-619.351) * (-620.229) (-620.879) (-619.266) [-621.757] -- 0:00:41
418000 -- (-621.094) (-622.684) (-623.028) [-624.236] * [-621.131] (-624.820) (-620.806) (-621.346) -- 0:00:41
418500 -- (-621.066) (-620.542) (-625.167) [-622.296] * [-618.932] (-620.786) (-622.514) (-622.901) -- 0:00:43
419000 -- (-622.065) (-624.305) [-621.226] (-624.288) * (-622.014) [-622.634] (-621.442) (-620.530) -- 0:00:42
419500 -- (-621.718) (-622.240) [-621.533] (-618.393) * (-620.585) [-620.880] (-622.647) (-620.688) -- 0:00:42
420000 -- (-621.968) (-625.877) [-620.265] (-620.602) * (-620.285) (-619.472) [-621.551] (-618.348) -- 0:00:42
Average standard deviation of split frequencies: 0.008405
420500 -- (-624.505) [-621.287] (-621.387) (-621.024) * [-621.560] (-619.970) (-621.777) (-622.223) -- 0:00:42
421000 -- (-622.192) (-623.726) [-623.010] (-621.586) * (-622.193) (-619.919) (-622.490) [-621.808] -- 0:00:42
421500 -- [-620.041] (-628.302) (-623.656) (-624.406) * (-625.046) (-626.540) [-622.572] (-621.843) -- 0:00:42
422000 -- (-622.051) (-622.889) [-621.175] (-625.042) * (-621.922) (-622.674) [-621.284] (-624.846) -- 0:00:42
422500 -- (-622.365) [-623.699] (-622.157) (-622.346) * (-624.752) (-620.646) (-624.131) [-619.965] -- 0:00:42
423000 -- [-619.836] (-622.787) (-628.344) (-619.906) * (-620.622) [-620.389] (-625.476) (-621.129) -- 0:00:42
423500 -- [-621.886] (-619.766) (-619.811) (-621.867) * (-624.978) (-626.668) [-623.330] (-619.900) -- 0:00:42
424000 -- (-619.896) [-620.859] (-620.465) (-623.280) * (-625.188) [-625.341] (-622.892) (-619.324) -- 0:00:42
424500 -- (-623.813) [-619.879] (-621.672) (-626.127) * (-626.016) (-623.782) (-621.611) [-623.095] -- 0:00:42
425000 -- (-624.818) (-621.462) [-621.823] (-621.089) * (-623.297) [-621.749] (-621.437) (-620.830) -- 0:00:41
Average standard deviation of split frequencies: 0.008299
425500 -- (-622.421) [-621.836] (-620.489) (-622.023) * (-623.447) [-621.013] (-623.855) (-620.137) -- 0:00:41
426000 -- (-619.562) (-619.474) (-620.577) [-621.892] * [-626.597] (-620.752) (-620.519) (-620.238) -- 0:00:41
426500 -- (-620.802) (-620.247) [-621.397] (-621.055) * (-621.904) (-623.870) (-621.709) [-619.477] -- 0:00:41
427000 -- (-620.055) (-624.445) (-621.820) [-621.865] * (-624.092) (-619.570) [-623.741] (-619.183) -- 0:00:41
427500 -- [-622.403] (-622.363) (-624.837) (-622.740) * (-620.120) (-620.510) [-619.878] (-619.420) -- 0:00:41
428000 -- (-620.781) (-622.459) [-621.742] (-619.879) * (-620.411) (-628.676) (-622.754) [-622.022] -- 0:00:41
428500 -- (-621.013) (-621.925) [-619.694] (-621.846) * [-620.004] (-622.195) (-620.860) (-625.579) -- 0:00:41
429000 -- (-621.271) (-621.190) (-622.558) [-623.441] * (-621.230) [-622.027] (-622.069) (-619.447) -- 0:00:41
429500 -- [-620.702] (-624.639) (-620.617) (-624.867) * [-622.674] (-620.965) (-623.985) (-621.109) -- 0:00:41
430000 -- [-621.942] (-623.747) (-619.949) (-624.859) * (-618.817) (-620.804) [-623.613] (-619.797) -- 0:00:41
Average standard deviation of split frequencies: 0.008894
430500 -- [-620.169] (-620.632) (-623.173) (-622.712) * [-620.673] (-620.527) (-625.094) (-625.175) -- 0:00:41
431000 -- (-622.642) (-626.024) (-623.398) [-621.200] * [-621.662] (-619.940) (-622.183) (-621.413) -- 0:00:40
431500 -- (-623.484) (-622.598) [-619.245] (-623.434) * [-618.188] (-620.065) (-624.904) (-618.782) -- 0:00:40
432000 -- (-626.302) [-622.106] (-623.366) (-624.499) * [-619.806] (-626.074) (-623.415) (-622.543) -- 0:00:40
432500 -- [-624.143] (-622.073) (-620.886) (-625.526) * (-621.035) (-621.046) [-623.984] (-626.394) -- 0:00:40
433000 -- [-621.104] (-620.349) (-620.150) (-624.726) * (-620.580) (-621.005) (-622.238) [-621.543] -- 0:00:40
433500 -- (-620.764) (-621.654) [-620.717] (-623.635) * (-619.141) (-621.256) (-621.977) [-621.198] -- 0:00:41
434000 -- (-620.223) (-620.343) (-621.252) [-621.405] * (-620.760) (-622.172) (-622.696) [-618.529] -- 0:00:41
434500 -- [-626.250] (-620.843) (-621.645) (-620.674) * [-620.637] (-622.441) (-626.328) (-618.596) -- 0:00:41
435000 -- (-626.478) [-620.118] (-625.303) (-621.322) * (-622.391) [-620.604] (-623.721) (-623.090) -- 0:00:41
Average standard deviation of split frequencies: 0.008920
435500 -- [-621.277] (-621.338) (-619.328) (-620.353) * [-620.032] (-620.895) (-621.043) (-628.773) -- 0:00:41
436000 -- [-620.639] (-621.387) (-623.525) (-620.787) * [-618.919] (-620.521) (-621.972) (-622.985) -- 0:00:41
436500 -- [-619.640] (-621.947) (-623.339) (-623.702) * (-620.393) (-626.049) [-620.375] (-622.192) -- 0:00:41
437000 -- (-622.432) (-621.394) [-623.570] (-620.369) * (-623.045) (-622.552) (-626.925) [-620.834] -- 0:00:41
437500 -- [-625.836] (-621.294) (-621.222) (-620.738) * [-618.697] (-622.801) (-621.591) (-620.870) -- 0:00:41
438000 -- (-622.328) (-619.604) (-625.731) [-621.059] * [-620.262] (-620.480) (-622.576) (-625.868) -- 0:00:41
438500 -- (-620.398) (-621.341) (-625.364) [-620.002] * (-622.950) (-620.517) [-620.444] (-620.841) -- 0:00:40
439000 -- (-620.674) [-620.471] (-619.939) (-622.234) * [-624.420] (-621.305) (-624.748) (-622.251) -- 0:00:40
439500 -- (-619.177) [-623.210] (-623.261) (-622.905) * (-619.096) (-621.743) [-623.254] (-619.272) -- 0:00:40
440000 -- [-621.571] (-621.136) (-629.263) (-621.328) * (-622.763) (-620.870) [-620.208] (-626.126) -- 0:00:40
Average standard deviation of split frequencies: 0.008625
440500 -- [-622.920] (-621.303) (-620.565) (-623.741) * (-622.048) [-624.349] (-621.103) (-623.733) -- 0:00:40
441000 -- [-622.172] (-624.542) (-623.776) (-620.899) * (-623.198) [-621.756] (-624.208) (-621.050) -- 0:00:40
441500 -- [-622.380] (-623.819) (-621.241) (-619.143) * (-623.242) (-622.876) (-623.701) [-619.695] -- 0:00:40
442000 -- [-621.712] (-622.645) (-621.071) (-619.913) * (-622.426) (-621.545) (-623.888) [-619.834] -- 0:00:40
442500 -- [-623.486] (-621.213) (-621.742) (-623.150) * (-622.576) [-620.516] (-620.084) (-623.027) -- 0:00:40
443000 -- (-623.860) [-620.846] (-621.187) (-622.403) * (-622.665) (-622.424) (-620.581) [-620.674] -- 0:00:40
443500 -- (-627.252) [-620.769] (-620.819) (-621.989) * [-621.825] (-623.360) (-619.889) (-618.893) -- 0:00:40
444000 -- (-622.924) [-621.426] (-625.723) (-621.040) * (-623.396) (-624.057) (-619.359) [-617.610] -- 0:00:40
444500 -- (-621.005) (-619.649) (-620.970) [-622.172] * (-625.781) (-623.651) [-619.168] (-623.291) -- 0:00:39
445000 -- (-621.942) [-622.329] (-621.929) (-620.199) * [-621.158] (-621.317) (-620.760) (-620.090) -- 0:00:39
Average standard deviation of split frequencies: 0.008918
445500 -- (-630.205) (-622.132) [-619.540] (-620.923) * [-621.341] (-622.282) (-623.481) (-619.685) -- 0:00:39
446000 -- [-622.787] (-621.071) (-620.851) (-623.574) * (-621.264) (-622.411) (-623.394) [-620.175] -- 0:00:39
446500 -- (-620.185) (-621.244) [-620.876] (-622.706) * (-621.874) (-620.892) (-625.477) [-620.816] -- 0:00:39
447000 -- [-620.935] (-620.929) (-622.962) (-621.593) * (-621.034) (-622.388) (-620.558) [-621.432] -- 0:00:39
447500 -- [-624.568] (-620.423) (-621.588) (-622.357) * [-621.222] (-624.626) (-622.979) (-620.898) -- 0:00:39
448000 -- (-620.241) (-620.387) [-622.369] (-622.089) * [-622.569] (-626.771) (-623.882) (-621.466) -- 0:00:39
448500 -- (-621.396) (-620.214) (-622.783) [-625.225] * (-623.407) (-622.417) (-624.794) [-619.831] -- 0:00:40
449000 -- (-621.817) [-620.102] (-622.959) (-625.667) * [-622.602] (-621.999) (-625.246) (-625.569) -- 0:00:40
449500 -- (-627.266) (-620.841) (-625.127) [-621.548] * (-622.649) (-620.388) [-622.437] (-630.384) -- 0:00:40
450000 -- (-621.453) (-620.388) (-623.828) [-619.045] * [-618.968] (-623.198) (-618.962) (-621.200) -- 0:00:40
Average standard deviation of split frequencies: 0.010264
450500 -- (-619.790) (-620.557) (-625.428) [-619.451] * [-619.307] (-623.618) (-624.243) (-622.580) -- 0:00:40
451000 -- [-619.125] (-622.857) (-620.966) (-622.820) * [-623.971] (-622.267) (-626.828) (-621.813) -- 0:00:40
451500 -- [-620.971] (-619.613) (-620.525) (-620.423) * (-623.544) [-622.147] (-625.466) (-622.488) -- 0:00:40
452000 -- [-620.357] (-625.921) (-622.049) (-624.951) * [-622.628] (-620.667) (-622.575) (-622.742) -- 0:00:40
452500 -- (-620.247) (-622.004) (-621.178) [-619.046] * (-620.007) [-618.351] (-622.067) (-623.319) -- 0:00:39
453000 -- (-620.356) [-621.943] (-620.229) (-620.787) * (-622.703) (-623.731) (-622.764) [-622.382] -- 0:00:39
453500 -- (-622.510) (-621.137) (-620.491) [-622.340] * [-621.537] (-622.374) (-622.343) (-622.621) -- 0:00:39
454000 -- (-620.815) (-619.310) [-622.969] (-618.984) * (-623.151) (-621.396) [-625.155] (-620.841) -- 0:00:39
454500 -- (-621.179) (-617.644) [-625.704] (-621.244) * [-619.969] (-624.154) (-625.456) (-620.611) -- 0:00:39
455000 -- (-624.732) [-619.566] (-621.061) (-620.889) * (-627.208) [-620.974] (-625.919) (-622.381) -- 0:00:39
Average standard deviation of split frequencies: 0.009886
455500 -- (-621.660) (-624.909) [-622.007] (-619.551) * [-619.532] (-621.417) (-621.954) (-620.545) -- 0:00:39
456000 -- (-622.544) (-623.932) (-624.139) [-621.287] * (-618.562) (-620.882) (-621.779) [-620.279] -- 0:00:39
456500 -- (-620.779) (-621.489) [-622.059] (-625.974) * [-619.600] (-621.625) (-621.030) (-622.148) -- 0:00:39
457000 -- (-621.646) (-619.953) (-623.002) [-620.727] * [-623.874] (-619.936) (-621.336) (-622.576) -- 0:00:39
457500 -- (-622.389) (-621.093) (-622.018) [-620.893] * (-624.462) [-621.589] (-622.905) (-620.298) -- 0:00:39
458000 -- (-621.460) (-621.465) (-625.296) [-619.667] * [-619.388] (-624.231) (-622.318) (-622.082) -- 0:00:39
458500 -- (-624.527) (-622.730) [-620.572] (-622.617) * (-620.886) (-621.138) (-623.956) [-622.708] -- 0:00:38
459000 -- (-621.352) (-620.893) (-621.309) [-619.771] * (-623.226) (-624.485) [-621.291] (-617.815) -- 0:00:38
459500 -- (-621.474) [-619.328] (-621.452) (-621.171) * [-622.841] (-623.664) (-621.614) (-623.137) -- 0:00:38
460000 -- (-622.977) [-618.794] (-623.334) (-622.150) * (-623.217) (-620.667) [-617.872] (-623.644) -- 0:00:38
Average standard deviation of split frequencies: 0.009146
460500 -- (-622.995) [-620.757] (-622.908) (-622.036) * (-622.333) (-620.059) [-620.523] (-623.375) -- 0:00:38
461000 -- (-622.879) [-620.412] (-621.533) (-619.980) * (-622.595) [-620.701] (-622.563) (-622.675) -- 0:00:38
461500 -- [-622.074] (-622.093) (-622.929) (-619.387) * (-621.286) [-623.296] (-623.535) (-624.402) -- 0:00:38
462000 -- (-622.493) (-625.252) [-622.905] (-620.545) * (-623.891) [-626.826] (-622.973) (-623.015) -- 0:00:38
462500 -- (-622.045) (-622.417) (-621.252) [-621.989] * (-622.364) (-630.776) [-624.526] (-621.927) -- 0:00:38
463000 -- (-622.341) (-619.745) (-622.348) [-623.564] * (-620.620) (-629.649) (-620.581) [-623.067] -- 0:00:39
463500 -- (-621.530) (-623.075) (-624.642) [-622.511] * (-621.007) (-628.421) [-619.076] (-619.937) -- 0:00:39
464000 -- (-623.308) (-620.856) (-624.001) [-621.621] * (-621.882) (-622.266) [-621.958] (-618.064) -- 0:00:39
464500 -- (-621.359) (-626.215) [-621.562] (-624.817) * (-620.674) (-621.830) (-621.124) [-620.539] -- 0:00:39
465000 -- (-625.480) (-618.571) (-624.400) [-622.980] * (-622.525) (-626.153) (-620.990) [-623.012] -- 0:00:39
Average standard deviation of split frequencies: 0.008535
465500 -- (-622.213) (-620.521) (-621.490) [-623.274] * [-619.561] (-626.485) (-619.948) (-620.530) -- 0:00:39
466000 -- (-621.701) (-625.260) [-622.604] (-622.174) * (-621.989) (-621.692) (-619.356) [-623.071] -- 0:00:38
466500 -- [-621.058] (-620.506) (-624.218) (-619.834) * (-622.219) [-621.244] (-622.716) (-622.367) -- 0:00:38
467000 -- (-621.509) (-623.308) [-621.500] (-621.246) * (-627.405) (-621.562) (-622.298) [-622.926] -- 0:00:38
467500 -- (-619.410) (-621.402) (-624.332) [-622.260] * (-622.147) [-623.005] (-620.236) (-621.780) -- 0:00:38
468000 -- [-622.863] (-626.182) (-622.073) (-621.228) * (-623.703) [-619.826] (-619.957) (-626.424) -- 0:00:38
468500 -- (-621.973) (-619.021) [-621.315] (-624.184) * [-623.084] (-620.475) (-623.423) (-622.038) -- 0:00:38
469000 -- [-620.633] (-621.352) (-624.808) (-622.523) * [-621.849] (-619.517) (-619.677) (-621.416) -- 0:00:38
469500 -- (-619.607) (-622.656) (-621.259) [-622.608] * (-622.095) [-622.327] (-621.817) (-622.226) -- 0:00:38
470000 -- (-622.240) (-619.780) (-622.957) [-622.082] * (-621.130) (-619.197) (-619.482) [-621.379] -- 0:00:38
Average standard deviation of split frequencies: 0.008138
470500 -- (-622.518) [-620.967] (-619.532) (-621.364) * [-619.816] (-620.514) (-621.062) (-626.229) -- 0:00:38
471000 -- (-625.398) [-625.356] (-619.857) (-622.338) * (-622.781) [-618.945] (-621.120) (-621.210) -- 0:00:38
471500 -- (-620.141) (-623.233) [-622.669] (-621.485) * (-623.550) [-623.116] (-626.765) (-622.311) -- 0:00:38
472000 -- (-621.021) (-621.964) [-620.269] (-620.329) * (-621.511) (-620.991) (-621.557) [-620.656] -- 0:00:38
472500 -- (-619.208) (-625.326) (-620.285) [-620.296] * [-620.477] (-623.114) (-621.841) (-621.519) -- 0:00:37
473000 -- [-622.716] (-619.745) (-623.361) (-620.049) * [-620.418] (-621.209) (-621.302) (-623.241) -- 0:00:37
473500 -- (-623.514) (-621.147) (-620.363) [-620.848] * (-618.765) [-620.401] (-620.568) (-626.533) -- 0:00:37
474000 -- (-622.277) [-619.566] (-620.861) (-620.059) * (-621.505) (-620.907) [-619.708] (-622.699) -- 0:00:37
474500 -- (-619.083) (-623.797) [-621.988] (-623.390) * (-622.663) [-621.918] (-622.474) (-619.155) -- 0:00:37
475000 -- (-619.926) (-625.172) [-622.813] (-621.629) * (-622.318) [-623.863] (-619.783) (-619.947) -- 0:00:37
Average standard deviation of split frequencies: 0.007799
475500 -- (-619.541) (-619.934) [-622.698] (-623.660) * (-619.108) (-623.000) (-623.504) [-624.317] -- 0:00:37
476000 -- (-621.148) (-620.625) [-622.842] (-622.620) * (-626.022) (-629.231) (-620.387) [-622.795] -- 0:00:37
476500 -- (-619.095) (-621.820) [-621.535] (-620.808) * (-622.665) (-626.472) (-621.517) [-623.534] -- 0:00:37
477000 -- (-620.553) [-623.091] (-622.793) (-623.576) * [-621.650] (-627.591) (-622.589) (-619.846) -- 0:00:37
477500 -- (-624.121) (-622.011) (-620.033) [-622.352] * [-619.630] (-623.678) (-621.566) (-618.646) -- 0:00:37
478000 -- [-621.007] (-620.276) (-624.221) (-623.474) * (-621.995) [-619.711] (-620.359) (-625.308) -- 0:00:38
478500 -- (-623.260) [-618.854] (-623.219) (-620.719) * (-621.344) (-620.739) [-620.724] (-628.836) -- 0:00:38
479000 -- (-620.830) (-622.186) [-622.695] (-621.431) * [-619.834] (-629.208) (-621.779) (-624.033) -- 0:00:38
479500 -- (-622.596) (-621.006) [-621.890] (-620.456) * (-622.637) (-624.650) [-620.300] (-619.930) -- 0:00:37
480000 -- (-626.944) (-620.862) (-620.697) [-622.721] * (-620.386) [-620.080] (-622.681) (-625.341) -- 0:00:37
Average standard deviation of split frequencies: 0.007723
480500 -- [-620.478] (-622.472) (-620.489) (-625.896) * [-620.317] (-623.067) (-622.494) (-619.831) -- 0:00:37
481000 -- (-621.524) (-620.423) [-620.349] (-621.319) * (-621.665) [-621.141] (-622.829) (-623.808) -- 0:00:37
481500 -- (-627.968) [-621.166] (-620.321) (-623.515) * (-624.696) (-622.208) (-623.827) [-621.063] -- 0:00:37
482000 -- (-626.910) [-621.023] (-624.378) (-625.728) * (-622.333) [-622.416] (-625.549) (-620.349) -- 0:00:37
482500 -- (-620.597) (-623.406) (-627.910) [-619.895] * [-624.003] (-621.518) (-623.006) (-622.243) -- 0:00:37
483000 -- (-621.253) [-618.353] (-621.595) (-621.504) * (-618.784) [-622.040] (-620.651) (-620.708) -- 0:00:37
483500 -- (-621.286) [-620.116] (-620.187) (-619.620) * (-625.554) [-620.383] (-621.584) (-622.891) -- 0:00:37
484000 -- [-620.912] (-622.689) (-623.799) (-622.172) * (-620.857) [-620.832] (-628.187) (-621.989) -- 0:00:37
484500 -- [-621.154] (-622.271) (-619.093) (-621.127) * (-619.678) (-620.467) (-629.116) [-621.263] -- 0:00:37
485000 -- (-620.134) (-621.337) (-618.982) [-624.277] * [-623.121] (-619.555) (-620.784) (-622.131) -- 0:00:37
Average standard deviation of split frequencies: 0.006790
485500 -- (-624.313) (-625.161) [-619.971] (-623.590) * (-621.514) [-620.722] (-625.408) (-619.952) -- 0:00:37
486000 -- (-621.380) (-622.379) (-628.824) [-623.428] * [-625.394] (-619.500) (-623.705) (-622.725) -- 0:00:37
486500 -- (-625.492) [-619.363] (-620.653) (-620.546) * [-621.792] (-621.008) (-620.329) (-623.343) -- 0:00:36
487000 -- (-628.257) (-621.266) [-620.416] (-619.348) * [-619.920] (-623.703) (-624.443) (-624.286) -- 0:00:36
487500 -- (-622.526) (-619.429) [-620.496] (-621.599) * [-619.149] (-620.413) (-624.301) (-622.732) -- 0:00:36
488000 -- (-624.536) (-619.575) [-620.502] (-621.322) * (-620.151) (-620.810) [-621.638] (-623.151) -- 0:00:36
488500 -- (-622.019) (-621.351) (-622.442) [-623.648] * (-622.274) (-621.343) (-622.260) [-625.612] -- 0:00:36
489000 -- (-625.636) (-621.194) (-623.285) [-620.891] * (-621.524) (-621.185) [-618.040] (-621.603) -- 0:00:36
489500 -- (-620.477) [-620.956] (-620.735) (-621.280) * (-620.699) [-622.702] (-620.346) (-621.149) -- 0:00:36
490000 -- [-621.493] (-623.254) (-620.231) (-631.590) * (-622.014) (-621.948) (-620.922) [-620.676] -- 0:00:36
Average standard deviation of split frequencies: 0.007234
490500 -- (-621.055) (-620.941) (-621.749) [-623.442] * [-621.118] (-622.608) (-622.996) (-619.672) -- 0:00:36
491000 -- (-622.137) (-623.277) [-620.913] (-624.775) * [-618.244] (-625.758) (-624.498) (-618.703) -- 0:00:36
491500 -- [-619.676] (-619.951) (-620.773) (-622.871) * (-621.774) (-629.926) (-623.923) [-620.933] -- 0:00:36
492000 -- (-621.985) (-620.150) [-622.719] (-619.689) * (-619.991) (-620.249) [-620.351] (-620.012) -- 0:00:36
492500 -- (-621.304) (-620.955) (-622.409) [-622.930] * [-621.912] (-622.143) (-622.080) (-622.251) -- 0:00:36
493000 -- (-620.862) (-621.122) [-625.802] (-626.662) * (-624.537) [-621.460] (-627.093) (-620.442) -- 0:00:37
493500 -- (-620.752) (-618.567) (-620.751) [-622.581] * (-620.833) (-621.520) [-620.440] (-621.347) -- 0:00:36
494000 -- (-620.299) (-620.197) (-625.720) [-624.125] * (-620.311) (-621.486) (-620.955) [-619.900] -- 0:00:36
494500 -- (-621.134) (-621.752) (-625.879) [-622.266] * (-621.116) [-620.968] (-622.545) (-622.477) -- 0:00:36
495000 -- (-623.572) (-623.717) (-623.822) [-619.313] * (-620.823) (-625.970) (-624.182) [-619.867] -- 0:00:36
Average standard deviation of split frequencies: 0.007782
495500 -- [-620.210] (-620.945) (-621.798) (-625.124) * (-620.749) [-623.407] (-623.316) (-622.251) -- 0:00:36
496000 -- [-619.519] (-620.827) (-624.527) (-626.757) * (-621.116) [-620.740] (-623.034) (-622.699) -- 0:00:36
496500 -- (-621.626) (-620.893) [-624.045] (-623.939) * (-620.604) [-619.060] (-620.694) (-620.597) -- 0:00:36
497000 -- (-621.135) [-621.969] (-622.452) (-625.403) * (-620.725) [-619.024] (-620.705) (-622.775) -- 0:00:36
497500 -- [-623.620] (-619.180) (-623.144) (-623.429) * (-622.585) (-620.220) (-620.281) [-624.163] -- 0:00:36
498000 -- (-622.725) [-619.226] (-621.354) (-623.784) * (-620.927) [-620.021] (-623.768) (-621.427) -- 0:00:36
498500 -- (-622.749) (-621.010) (-621.501) [-619.520] * (-621.386) [-624.278] (-622.574) (-620.884) -- 0:00:36
499000 -- (-622.880) (-621.708) [-621.231] (-620.480) * (-622.284) (-621.194) (-622.033) [-622.488] -- 0:00:36
499500 -- [-621.850] (-622.302) (-620.859) (-621.668) * (-623.092) (-623.033) [-621.217] (-622.368) -- 0:00:36
500000 -- [-619.712] (-621.385) (-621.434) (-621.586) * (-620.193) (-619.331) (-624.080) [-622.673] -- 0:00:36
Average standard deviation of split frequencies: 0.008297
500500 -- (-626.375) [-618.628] (-622.834) (-620.685) * (-621.759) [-620.766] (-620.090) (-620.349) -- 0:00:35
501000 -- (-622.137) (-620.523) (-621.926) [-619.631] * (-621.619) [-618.354] (-621.390) (-620.006) -- 0:00:35
501500 -- (-619.050) [-621.538] (-623.386) (-620.343) * (-625.076) [-620.361] (-619.497) (-621.473) -- 0:00:35
502000 -- (-620.215) (-622.737) (-623.409) [-621.369] * (-620.581) (-620.892) (-619.772) [-627.018] -- 0:00:35
502500 -- [-619.215] (-620.949) (-625.176) (-623.598) * (-621.650) [-622.525] (-623.419) (-622.824) -- 0:00:35
503000 -- [-622.163] (-620.204) (-624.068) (-623.805) * (-626.038) [-620.162] (-620.449) (-624.129) -- 0:00:35
503500 -- (-620.464) (-625.306) [-621.939] (-621.707) * (-620.661) (-626.274) [-620.110] (-621.650) -- 0:00:35
504000 -- (-619.277) [-619.632] (-619.858) (-623.953) * (-623.863) [-621.814] (-621.461) (-622.291) -- 0:00:35
504500 -- (-620.594) (-619.705) [-622.333] (-621.408) * (-623.400) (-623.232) (-618.900) [-622.099] -- 0:00:35
505000 -- (-619.601) [-619.147] (-622.749) (-628.558) * [-621.661] (-620.349) (-621.229) (-620.436) -- 0:00:35
Average standard deviation of split frequencies: 0.007802
505500 -- [-620.377] (-619.959) (-621.421) (-622.105) * [-620.087] (-622.088) (-620.472) (-619.547) -- 0:00:35
506000 -- (-622.903) [-620.771] (-624.697) (-619.879) * [-618.952] (-623.394) (-621.110) (-620.102) -- 0:00:35
506500 -- (-624.526) [-619.647] (-625.766) (-619.935) * (-620.034) (-620.782) (-619.420) [-620.104] -- 0:00:35
507000 -- [-619.337] (-620.801) (-622.276) (-621.686) * (-619.925) [-621.214] (-619.735) (-619.795) -- 0:00:35
507500 -- [-624.639] (-620.461) (-622.017) (-623.061) * [-619.510] (-620.085) (-621.138) (-622.744) -- 0:00:35
508000 -- (-621.873) (-618.800) [-621.462] (-621.070) * (-621.973) [-622.241] (-621.937) (-625.413) -- 0:00:35
508500 -- (-620.765) [-619.869] (-625.123) (-620.260) * [-623.780] (-621.480) (-620.745) (-622.730) -- 0:00:35
509000 -- (-619.711) [-619.380] (-624.043) (-620.941) * (-627.871) [-622.232] (-620.351) (-621.695) -- 0:00:35
509500 -- (-621.281) [-620.273] (-623.764) (-621.946) * (-623.553) [-620.274] (-619.963) (-621.730) -- 0:00:35
510000 -- [-620.634] (-621.584) (-620.370) (-623.182) * (-621.926) (-621.617) (-618.580) [-620.383] -- 0:00:35
Average standard deviation of split frequencies: 0.007904
510500 -- (-619.472) (-626.799) [-620.966] (-622.096) * (-620.252) (-622.768) [-622.115] (-620.366) -- 0:00:35
511000 -- [-619.127] (-623.993) (-621.506) (-622.222) * (-619.437) (-620.150) (-623.230) [-618.864] -- 0:00:35
511500 -- [-621.496] (-623.703) (-621.803) (-623.982) * (-621.048) (-620.638) [-623.060] (-620.900) -- 0:00:35
512000 -- (-621.516) (-622.113) [-621.993] (-623.750) * (-620.066) (-624.587) [-619.125] (-619.746) -- 0:00:35
512500 -- (-621.734) (-618.336) [-621.139] (-621.651) * (-620.080) (-620.807) (-622.571) [-622.203] -- 0:00:35
513000 -- (-620.800) (-620.816) (-622.284) [-620.598] * [-619.925] (-619.716) (-620.179) (-621.209) -- 0:00:35
513500 -- (-624.911) (-621.058) [-620.943] (-620.820) * (-620.798) [-619.951] (-622.015) (-624.737) -- 0:00:35
514000 -- (-619.812) [-619.816] (-620.619) (-623.054) * [-617.770] (-620.424) (-622.623) (-619.951) -- 0:00:34
514500 -- (-620.829) [-619.803] (-620.891) (-621.461) * (-620.367) (-623.182) (-620.420) [-621.860] -- 0:00:34
515000 -- [-619.857] (-621.671) (-621.922) (-625.900) * (-622.091) (-620.566) (-620.253) [-621.877] -- 0:00:34
Average standard deviation of split frequencies: 0.008051
515500 -- [-620.353] (-621.800) (-619.160) (-620.812) * [-621.650] (-621.180) (-621.002) (-622.566) -- 0:00:34
516000 -- (-618.586) (-620.631) [-621.639] (-621.748) * [-622.955] (-627.490) (-624.349) (-622.011) -- 0:00:34
516500 -- [-619.293] (-622.118) (-622.390) (-620.393) * (-620.070) (-624.645) (-623.517) [-622.451] -- 0:00:34
517000 -- (-621.511) [-620.304] (-622.593) (-620.799) * (-620.466) (-621.783) [-621.083] (-623.678) -- 0:00:34
517500 -- [-620.242] (-621.308) (-621.562) (-620.715) * (-625.174) (-619.096) [-619.303] (-622.825) -- 0:00:34
518000 -- [-620.764] (-622.001) (-619.273) (-622.405) * (-624.820) (-620.360) [-621.266] (-623.626) -- 0:00:34
518500 -- (-620.749) [-622.606] (-622.973) (-621.953) * [-619.027] (-624.598) (-621.457) (-623.835) -- 0:00:34
519000 -- (-619.774) [-624.138] (-622.103) (-621.558) * (-622.149) (-623.698) [-619.634] (-623.785) -- 0:00:34
519500 -- (-620.418) (-619.443) (-624.883) [-619.230] * (-623.273) (-622.584) [-619.511] (-621.025) -- 0:00:34
520000 -- (-620.907) [-622.346] (-622.703) (-620.034) * (-620.800) (-621.579) (-620.583) [-623.859] -- 0:00:34
Average standard deviation of split frequencies: 0.007866
520500 -- (-622.127) (-619.811) (-621.316) [-621.338] * (-621.564) (-620.166) (-630.472) [-620.846] -- 0:00:34
521000 -- [-623.661] (-621.157) (-622.937) (-620.991) * [-620.209] (-621.778) (-626.863) (-623.508) -- 0:00:34
521500 -- (-616.791) (-621.473) [-625.184] (-621.224) * [-620.698] (-621.126) (-621.644) (-624.615) -- 0:00:33
522000 -- (-621.777) (-622.860) (-623.363) [-621.094] * (-623.649) (-618.854) [-620.813] (-621.622) -- 0:00:34
522500 -- (-619.175) [-622.225] (-622.801) (-621.541) * [-623.221] (-619.981) (-622.955) (-621.658) -- 0:00:34
523000 -- (-622.231) (-622.308) (-622.748) [-621.346] * (-624.613) (-624.703) (-619.516) [-620.808] -- 0:00:34
523500 -- (-621.008) (-621.049) (-623.556) [-620.108] * (-620.367) (-622.890) (-623.548) [-620.575] -- 0:00:34
524000 -- [-619.249] (-621.535) (-624.412) (-623.087) * (-621.727) (-624.493) [-619.849] (-620.772) -- 0:00:34
524500 -- (-623.829) [-621.080] (-621.404) (-618.802) * (-626.042) (-622.663) (-623.655) [-621.385] -- 0:00:34
525000 -- (-619.655) (-621.223) [-619.249] (-623.226) * [-620.905] (-620.471) (-623.544) (-621.679) -- 0:00:34
Average standard deviation of split frequencies: 0.007338
525500 -- (-624.052) (-621.104) [-620.681] (-624.216) * [-620.247] (-621.009) (-624.004) (-619.701) -- 0:00:34
526000 -- [-620.989] (-622.521) (-619.558) (-624.078) * (-621.599) (-619.365) [-621.724] (-623.395) -- 0:00:34
526500 -- (-618.349) [-623.292] (-621.338) (-625.630) * (-620.317) (-623.015) (-619.882) [-622.410] -- 0:00:34
527000 -- (-620.044) [-622.842] (-623.611) (-620.509) * (-619.660) (-622.813) (-620.214) [-619.477] -- 0:00:34
527500 -- [-619.711] (-630.406) (-623.993) (-624.268) * (-621.323) (-621.091) [-622.073] (-622.328) -- 0:00:34
528000 -- (-622.050) (-621.842) (-624.630) [-620.106] * (-620.117) (-620.150) [-621.270] (-623.781) -- 0:00:33
528500 -- [-621.450] (-622.916) (-621.522) (-620.721) * (-620.467) [-622.657] (-624.421) (-624.531) -- 0:00:33
529000 -- (-623.486) (-620.751) (-620.463) [-620.372] * (-621.830) (-619.344) [-622.850] (-625.226) -- 0:00:33
529500 -- (-622.908) (-624.113) (-624.784) [-619.569] * (-620.888) [-619.856] (-624.084) (-623.852) -- 0:00:33
530000 -- [-622.528] (-623.100) (-625.170) (-618.484) * [-622.578] (-621.336) (-624.078) (-625.595) -- 0:00:33
Average standard deviation of split frequencies: 0.008050
530500 -- [-620.864] (-622.205) (-619.362) (-620.446) * (-621.814) (-621.637) [-622.621] (-625.055) -- 0:00:33
531000 -- (-623.987) (-621.703) [-620.306] (-620.659) * (-622.612) (-623.801) (-619.672) [-620.873] -- 0:00:33
531500 -- (-620.847) (-620.252) [-623.626] (-620.594) * [-622.702] (-620.871) (-620.884) (-621.196) -- 0:00:33
532000 -- (-621.424) (-620.627) (-623.800) [-619.606] * (-622.954) [-621.425] (-619.315) (-621.106) -- 0:00:33
532500 -- [-620.354] (-621.881) (-619.921) (-620.176) * (-622.172) (-621.914) (-619.596) [-618.782] -- 0:00:33
533000 -- (-620.551) (-622.378) [-620.274] (-621.533) * (-622.567) (-623.227) [-621.733] (-622.582) -- 0:00:33
533500 -- (-620.792) (-620.726) (-619.993) [-623.679] * (-622.534) (-623.686) (-619.064) [-622.023] -- 0:00:33
534000 -- (-622.877) (-625.185) [-619.522] (-621.291) * (-626.083) (-626.836) (-621.456) [-621.776] -- 0:00:33
534500 -- (-622.121) (-622.439) [-620.038] (-621.436) * [-625.499] (-621.550) (-621.023) (-622.182) -- 0:00:33
535000 -- (-619.853) (-620.738) [-621.517] (-620.147) * (-622.438) (-624.206) (-621.369) [-620.546] -- 0:00:33
Average standard deviation of split frequencies: 0.007805
535500 -- (-621.908) (-624.868) [-624.890] (-622.400) * (-622.239) (-628.181) [-627.384] (-622.683) -- 0:00:32
536000 -- (-622.696) [-619.732] (-625.007) (-625.540) * [-618.718] (-621.400) (-622.024) (-621.742) -- 0:00:32
536500 -- (-618.248) (-624.232) (-621.229) [-624.154] * (-624.178) (-621.072) (-621.817) [-621.102] -- 0:00:33
537000 -- [-620.094] (-619.537) (-621.100) (-619.744) * [-623.382] (-620.379) (-622.080) (-619.454) -- 0:00:33
537500 -- (-623.557) [-622.092] (-618.751) (-620.478) * (-621.319) (-619.180) [-621.115] (-621.599) -- 0:00:33
538000 -- (-621.191) (-622.114) (-622.804) [-620.146] * [-620.883] (-620.095) (-623.456) (-620.359) -- 0:00:33
538500 -- (-621.379) [-619.306] (-621.580) (-619.908) * [-619.483] (-621.924) (-622.562) (-620.272) -- 0:00:33
539000 -- (-622.078) (-623.352) (-620.384) [-618.271] * (-620.755) (-621.452) (-623.626) [-617.738] -- 0:00:33
539500 -- (-622.149) (-621.142) (-622.620) [-619.708] * (-620.876) (-622.869) (-622.315) [-620.272] -- 0:00:33
540000 -- (-622.578) (-625.829) (-621.032) [-624.137] * (-623.529) [-623.405] (-626.239) (-618.774) -- 0:00:33
Average standard deviation of split frequencies: 0.007738
540500 -- (-626.186) (-624.592) (-621.676) [-619.840] * [-620.426] (-621.714) (-625.241) (-621.815) -- 0:00:33
541000 -- (-624.040) (-626.028) [-620.433] (-620.845) * (-623.237) [-618.490] (-624.633) (-622.999) -- 0:00:33
541500 -- (-620.075) (-621.639) [-620.114] (-623.434) * (-620.647) [-620.610] (-621.364) (-622.513) -- 0:00:33
542000 -- (-620.852) [-622.072] (-622.245) (-621.150) * [-621.326] (-620.197) (-621.629) (-622.258) -- 0:00:32
542500 -- (-621.002) (-623.426) (-621.283) [-621.873] * (-622.648) [-618.779] (-621.770) (-622.449) -- 0:00:32
543000 -- (-621.383) [-623.934] (-621.982) (-619.444) * (-620.623) [-619.411] (-624.399) (-620.556) -- 0:00:32
543500 -- (-619.827) [-622.983] (-623.273) (-622.751) * [-620.551] (-619.932) (-627.842) (-621.215) -- 0:00:32
544000 -- (-622.700) [-620.126] (-621.387) (-623.375) * [-621.641] (-621.185) (-621.887) (-620.188) -- 0:00:32
544500 -- [-623.769] (-622.552) (-623.256) (-623.531) * (-622.160) (-619.963) (-620.156) [-623.686] -- 0:00:32
545000 -- [-621.015] (-621.959) (-621.117) (-622.896) * (-618.883) (-620.586) [-621.711] (-624.602) -- 0:00:32
Average standard deviation of split frequencies: 0.007770
545500 -- (-621.615) (-626.569) (-619.494) [-622.924] * (-621.737) (-623.234) (-624.768) [-625.937] -- 0:00:32
546000 -- (-621.815) (-622.902) [-620.741] (-622.143) * (-624.030) (-620.757) [-624.085] (-626.342) -- 0:00:32
546500 -- [-622.579] (-621.059) (-619.197) (-619.090) * (-621.025) [-619.962] (-622.327) (-622.932) -- 0:00:32
547000 -- (-621.418) (-622.005) (-622.829) [-620.843] * (-623.482) [-619.771] (-620.996) (-622.701) -- 0:00:32
547500 -- (-622.376) (-623.296) (-620.796) [-619.157] * [-620.901] (-623.161) (-623.078) (-619.862) -- 0:00:32
548000 -- [-621.083] (-624.403) (-622.679) (-619.229) * (-621.179) (-627.076) (-624.046) [-619.602] -- 0:00:32
548500 -- (-620.527) [-620.291] (-620.331) (-621.397) * [-619.532] (-622.079) (-621.742) (-620.153) -- 0:00:32
549000 -- (-622.131) (-620.207) [-622.422] (-622.011) * (-623.187) (-621.164) (-621.234) [-618.648] -- 0:00:32
549500 -- (-619.642) (-622.273) [-621.831] (-622.165) * (-619.504) [-622.775] (-620.964) (-620.647) -- 0:00:31
550000 -- (-620.964) (-623.893) [-622.346] (-620.549) * (-621.019) (-623.476) [-624.094] (-620.655) -- 0:00:31
Average standard deviation of split frequencies: 0.007491
550500 -- (-624.500) (-623.690) (-621.205) [-620.327] * (-619.729) [-622.273] (-623.209) (-622.386) -- 0:00:32
551000 -- [-622.481] (-620.666) (-623.188) (-621.332) * (-623.341) (-622.159) (-620.705) [-620.586] -- 0:00:32
551500 -- (-620.854) (-620.647) (-628.262) [-620.954] * (-623.662) [-623.881] (-620.527) (-620.491) -- 0:00:32
552000 -- (-623.656) (-623.636) (-624.441) [-622.074] * [-624.724] (-620.576) (-621.870) (-622.059) -- 0:00:32
552500 -- (-620.810) [-622.916] (-623.059) (-625.167) * (-622.054) (-623.140) (-621.079) [-621.456] -- 0:00:32
553000 -- [-618.656] (-627.484) (-622.770) (-626.381) * (-620.270) [-623.066] (-622.285) (-626.228) -- 0:00:32
553500 -- [-620.101] (-620.707) (-621.898) (-621.512) * [-618.504] (-621.991) (-622.299) (-622.400) -- 0:00:32
554000 -- (-619.541) [-622.138] (-619.543) (-621.255) * (-622.096) [-621.160] (-623.432) (-620.712) -- 0:00:32
554500 -- (-620.651) (-621.428) (-619.559) [-620.239] * (-617.913) (-621.997) [-621.210] (-623.912) -- 0:00:32
555000 -- [-626.387] (-621.624) (-620.105) (-622.670) * (-619.880) (-619.837) (-626.105) [-622.212] -- 0:00:32
Average standard deviation of split frequencies: 0.007737
555500 -- (-626.119) [-620.651] (-620.551) (-621.906) * [-619.333] (-621.759) (-620.334) (-621.271) -- 0:00:32
556000 -- (-626.201) (-621.220) [-618.940] (-619.596) * [-620.916] (-622.636) (-620.269) (-622.320) -- 0:00:31
556500 -- (-620.072) (-621.695) [-623.109] (-625.633) * [-621.199] (-621.851) (-621.822) (-628.001) -- 0:00:31
557000 -- (-623.988) (-621.505) [-619.549] (-624.642) * (-621.172) (-620.482) [-622.035] (-621.529) -- 0:00:31
557500 -- (-620.551) [-620.212] (-618.358) (-622.120) * (-621.428) [-621.419] (-620.956) (-622.085) -- 0:00:31
558000 -- (-621.322) [-622.734] (-620.483) (-621.912) * (-621.921) (-620.194) (-622.554) [-620.160] -- 0:00:31
558500 -- (-624.018) [-623.779] (-619.917) (-621.192) * (-622.288) (-619.814) (-621.694) [-621.637] -- 0:00:31
559000 -- (-620.994) (-627.765) [-620.649] (-621.194) * (-621.732) (-621.340) [-620.571] (-621.166) -- 0:00:31
559500 -- (-623.579) (-623.872) [-620.223] (-621.840) * (-622.577) (-624.083) [-620.232] (-623.214) -- 0:00:31
560000 -- [-620.054] (-619.897) (-621.414) (-620.925) * [-620.163] (-623.171) (-620.552) (-628.697) -- 0:00:31
Average standard deviation of split frequencies: 0.007830
560500 -- (-619.991) [-621.887] (-621.014) (-621.116) * (-619.585) (-623.357) [-620.388] (-623.352) -- 0:00:31
561000 -- [-622.048] (-623.835) (-620.333) (-621.458) * [-620.039] (-624.591) (-620.383) (-620.567) -- 0:00:31
561500 -- [-619.845] (-620.245) (-622.750) (-624.367) * [-620.621] (-619.318) (-621.495) (-620.232) -- 0:00:31
562000 -- (-624.157) (-621.154) (-624.958) [-620.450] * [-622.001] (-620.959) (-625.645) (-621.850) -- 0:00:31
562500 -- [-620.074] (-622.089) (-622.140) (-622.148) * (-627.623) [-625.564] (-621.556) (-623.091) -- 0:00:31
563000 -- (-620.861) (-621.221) [-621.593] (-619.498) * (-623.460) (-619.957) (-620.251) [-620.289] -- 0:00:31
563500 -- [-620.480] (-620.574) (-623.461) (-621.528) * (-623.099) (-619.566) [-621.165] (-620.843) -- 0:00:30
564000 -- (-618.816) (-620.658) (-622.272) [-622.402] * (-620.586) [-618.435] (-623.521) (-619.449) -- 0:00:30
564500 -- (-624.620) (-619.736) [-621.938] (-619.937) * (-624.603) [-618.840] (-620.754) (-620.757) -- 0:00:30
565000 -- (-625.091) (-623.926) (-624.165) [-621.909] * [-620.652] (-624.123) (-624.442) (-622.896) -- 0:00:30
Average standard deviation of split frequencies: 0.007808
565500 -- (-624.452) (-623.021) (-622.293) [-621.408] * (-618.582) [-627.864] (-622.943) (-621.048) -- 0:00:31
566000 -- (-624.695) (-622.736) (-622.210) [-621.918] * (-621.854) (-619.257) [-619.707] (-620.894) -- 0:00:31
566500 -- (-626.696) [-620.810] (-623.653) (-622.989) * [-621.946] (-620.034) (-622.343) (-620.806) -- 0:00:31
567000 -- (-622.338) [-620.084] (-621.956) (-620.792) * (-621.303) (-620.434) [-619.382] (-622.993) -- 0:00:31
567500 -- (-623.354) [-620.707] (-623.501) (-621.115) * (-621.685) (-620.636) (-621.169) [-620.809] -- 0:00:31
568000 -- [-619.637] (-622.275) (-621.742) (-621.055) * (-624.157) [-619.575] (-621.440) (-621.904) -- 0:00:31
568500 -- (-622.871) (-621.438) [-621.769] (-623.001) * (-621.399) (-618.739) (-623.144) [-622.444] -- 0:00:31
569000 -- [-619.836] (-626.835) (-621.932) (-627.159) * (-623.286) (-619.021) (-621.484) [-623.134] -- 0:00:31
569500 -- [-618.614] (-625.290) (-622.614) (-623.325) * [-623.022] (-622.394) (-622.899) (-625.671) -- 0:00:30
570000 -- (-621.565) (-618.461) (-622.293) [-621.616] * (-622.386) (-622.343) [-620.238] (-627.864) -- 0:00:30
Average standard deviation of split frequencies: 0.007589
570500 -- (-620.781) (-620.954) [-623.048] (-622.619) * (-620.271) (-620.809) [-621.858] (-621.266) -- 0:00:30
571000 -- (-621.698) [-622.282] (-621.690) (-624.104) * (-620.066) [-621.076] (-619.028) (-620.746) -- 0:00:30
571500 -- (-621.411) (-619.789) (-620.072) [-620.407] * (-618.900) [-620.614] (-621.979) (-621.232) -- 0:00:30
572000 -- (-621.411) (-618.585) (-623.426) [-624.036] * (-619.305) [-620.003] (-621.275) (-620.542) -- 0:00:30
572500 -- (-623.110) [-619.406] (-622.345) (-622.195) * (-620.074) [-620.147] (-621.667) (-620.885) -- 0:00:30
573000 -- [-621.157] (-620.306) (-623.471) (-623.491) * (-620.035) (-620.659) (-620.272) [-619.835] -- 0:00:30
573500 -- (-620.594) (-620.341) (-626.490) [-621.176] * (-622.658) [-618.586] (-624.823) (-622.828) -- 0:00:30
574000 -- (-620.991) [-623.585] (-620.418) (-621.042) * (-619.828) (-619.139) (-619.034) [-620.023] -- 0:00:30
574500 -- (-620.498) (-624.738) [-622.533] (-622.711) * (-620.502) [-626.634] (-620.051) (-623.486) -- 0:00:30
575000 -- (-620.835) [-624.157] (-622.316) (-620.016) * (-619.234) [-620.953] (-623.165) (-621.598) -- 0:00:30
Average standard deviation of split frequencies: 0.007008
575500 -- (-622.191) [-621.095] (-622.795) (-623.069) * (-619.813) (-621.791) (-623.825) [-619.719] -- 0:00:30
576000 -- [-621.541] (-622.217) (-620.706) (-622.768) * [-618.921] (-622.760) (-621.048) (-622.002) -- 0:00:30
576500 -- [-620.778] (-620.286) (-622.293) (-622.383) * [-620.631] (-622.646) (-623.826) (-622.159) -- 0:00:30
577000 -- (-622.030) (-620.685) (-620.559) [-620.973] * [-620.848] (-624.213) (-623.513) (-625.275) -- 0:00:30
577500 -- [-622.197] (-619.420) (-621.747) (-623.632) * (-621.696) (-623.273) [-626.262] (-626.756) -- 0:00:29
578000 -- [-625.769] (-619.999) (-622.093) (-621.054) * (-619.827) [-619.985] (-621.400) (-623.613) -- 0:00:29
578500 -- [-621.175] (-621.132) (-623.572) (-621.495) * (-623.748) (-620.913) [-624.448] (-620.801) -- 0:00:29
579000 -- (-622.298) (-620.354) (-621.576) [-619.507] * (-622.956) (-617.989) (-624.801) [-621.417] -- 0:00:29
579500 -- (-620.883) [-620.648] (-621.152) (-621.007) * (-621.886) (-621.618) (-621.566) [-620.404] -- 0:00:29
580000 -- (-625.015) [-621.552] (-621.643) (-624.993) * [-619.199] (-621.588) (-619.296) (-621.435) -- 0:00:29
Average standard deviation of split frequencies: 0.007205
580500 -- [-623.003] (-624.843) (-620.931) (-625.252) * (-619.717) (-619.024) [-622.036] (-623.141) -- 0:00:30
581000 -- (-621.999) [-622.339] (-622.051) (-623.031) * (-621.241) [-620.717] (-620.416) (-622.343) -- 0:00:30
581500 -- (-620.682) (-623.738) (-621.866) [-621.094] * (-627.116) [-623.183] (-625.973) (-620.301) -- 0:00:30
582000 -- [-623.012] (-625.603) (-621.409) (-622.786) * (-620.429) (-624.429) [-620.093] (-622.806) -- 0:00:30
582500 -- [-622.469] (-620.296) (-622.378) (-621.080) * (-622.468) (-619.706) (-618.744) [-620.528] -- 0:00:30
583000 -- [-621.523] (-625.132) (-619.870) (-622.000) * [-626.187] (-623.395) (-622.688) (-627.851) -- 0:00:30
583500 -- (-619.686) (-624.377) [-621.623] (-622.168) * [-622.067] (-620.141) (-619.550) (-621.842) -- 0:00:29
584000 -- (-621.409) (-622.987) [-624.084] (-621.047) * (-623.924) [-621.410] (-622.223) (-620.346) -- 0:00:29
584500 -- [-623.679] (-618.699) (-620.729) (-622.242) * (-632.062) [-623.425] (-620.488) (-621.148) -- 0:00:29
585000 -- (-623.506) [-621.192] (-624.189) (-620.931) * (-627.150) [-621.239] (-623.226) (-622.194) -- 0:00:29
Average standard deviation of split frequencies: 0.007542
585500 -- [-622.863] (-624.812) (-622.947) (-620.484) * (-624.256) (-623.324) (-619.317) [-621.967] -- 0:00:29
586000 -- [-620.786] (-620.186) (-619.726) (-620.333) * (-621.834) (-622.089) [-621.991] (-622.454) -- 0:00:29
586500 -- (-620.456) [-619.479] (-622.137) (-622.229) * (-620.902) [-621.961] (-621.747) (-622.363) -- 0:00:29
587000 -- (-621.645) (-622.651) (-623.496) [-619.817] * (-620.264) (-624.778) [-622.675] (-622.106) -- 0:00:29
587500 -- (-621.123) (-620.961) (-624.152) [-619.528] * (-623.338) (-620.818) [-623.320] (-620.216) -- 0:00:29
588000 -- [-622.691] (-620.691) (-624.040) (-621.373) * [-620.649] (-622.012) (-624.655) (-618.639) -- 0:00:29
588500 -- [-620.634] (-620.891) (-623.043) (-622.450) * (-620.213) [-620.293] (-621.401) (-618.682) -- 0:00:29
589000 -- (-621.587) (-620.914) (-626.902) [-620.127] * (-623.319) (-620.578) (-622.379) [-620.671] -- 0:00:29
589500 -- (-620.365) (-621.130) [-625.703] (-622.132) * [-623.080] (-620.869) (-622.281) (-620.522) -- 0:00:29
590000 -- (-622.104) [-625.957] (-626.555) (-620.557) * (-621.534) (-623.146) [-624.603] (-621.179) -- 0:00:29
Average standard deviation of split frequencies: 0.008131
590500 -- (-622.577) (-625.816) [-619.394] (-621.193) * (-619.824) (-626.574) (-623.352) [-619.880] -- 0:00:29
591000 -- (-621.441) [-623.165] (-620.771) (-624.949) * (-625.975) (-623.246) (-621.181) [-621.422] -- 0:00:29
591500 -- (-623.526) (-620.793) (-622.126) [-624.419] * (-626.681) [-621.175] (-621.375) (-619.599) -- 0:00:29
592000 -- (-619.887) (-621.278) [-622.517] (-626.534) * [-623.367] (-620.827) (-621.661) (-621.182) -- 0:00:28
592500 -- (-620.231) (-622.463) (-624.046) [-620.086] * (-624.062) (-622.247) (-621.008) [-622.474] -- 0:00:28
593000 -- (-620.436) [-620.923] (-620.417) (-621.269) * (-620.585) (-625.107) (-621.453) [-619.963] -- 0:00:28
593500 -- [-619.865] (-622.546) (-622.449) (-621.965) * (-623.834) [-621.940] (-621.464) (-620.586) -- 0:00:28
594000 -- (-619.136) (-622.023) [-623.956] (-622.086) * (-622.934) (-620.724) (-620.456) [-620.064] -- 0:00:28
594500 -- (-620.552) (-621.779) (-624.384) [-620.848] * (-621.517) (-625.071) (-619.551) [-623.313] -- 0:00:28
595000 -- (-622.544) [-623.980] (-621.025) (-621.270) * [-624.900] (-621.814) (-625.998) (-624.835) -- 0:00:28
Average standard deviation of split frequencies: 0.007514
595500 -- (-623.401) (-620.266) [-621.207] (-620.721) * (-621.372) [-623.078] (-621.398) (-621.495) -- 0:00:28
596000 -- [-625.963] (-622.866) (-621.340) (-623.419) * (-622.164) (-622.746) [-618.841] (-622.359) -- 0:00:28
596500 -- [-626.315] (-619.513) (-623.601) (-621.517) * (-621.414) (-629.115) (-622.217) [-619.655] -- 0:00:29
597000 -- (-622.983) [-621.563] (-622.699) (-628.940) * (-625.917) (-622.979) (-623.602) [-620.477] -- 0:00:29
597500 -- (-624.779) [-618.951] (-621.583) (-624.127) * (-621.746) [-622.863] (-623.206) (-621.473) -- 0:00:28
598000 -- (-621.049) [-620.297] (-623.875) (-629.057) * (-623.960) (-622.063) (-619.105) [-622.021] -- 0:00:28
598500 -- [-621.280] (-621.289) (-627.608) (-628.378) * (-619.200) [-624.267] (-620.452) (-621.281) -- 0:00:28
599000 -- [-621.017] (-626.694) (-621.032) (-622.132) * [-621.392] (-624.169) (-620.360) (-621.240) -- 0:00:28
599500 -- (-622.182) (-622.100) [-620.509] (-622.772) * [-623.724] (-622.060) (-624.281) (-621.379) -- 0:00:28
600000 -- [-623.884] (-621.702) (-622.268) (-623.405) * (-621.134) (-623.873) (-622.554) [-622.634] -- 0:00:28
Average standard deviation of split frequencies: 0.007617
600500 -- (-621.989) (-621.712) [-621.352] (-620.381) * (-624.603) (-621.868) [-622.587] (-621.472) -- 0:00:28
601000 -- (-622.467) (-623.526) [-619.774] (-622.733) * [-620.249] (-621.972) (-621.193) (-621.777) -- 0:00:28
601500 -- (-623.878) [-623.061] (-619.936) (-623.897) * (-622.355) (-623.690) [-618.938] (-624.582) -- 0:00:28
602000 -- (-621.988) (-624.665) [-620.695] (-623.013) * (-620.816) [-622.580] (-621.218) (-622.910) -- 0:00:28
602500 -- (-621.977) (-621.683) (-621.770) [-627.371] * (-622.542) (-623.691) (-621.866) [-625.291] -- 0:00:28
603000 -- [-619.901] (-621.916) (-621.666) (-621.062) * (-619.254) (-621.128) (-622.888) [-621.491] -- 0:00:28
603500 -- [-619.511] (-621.991) (-622.333) (-619.899) * (-621.743) (-623.211) (-621.649) [-620.324] -- 0:00:28
604000 -- (-622.078) (-629.316) (-618.115) [-620.627] * [-621.701] (-620.898) (-623.706) (-621.269) -- 0:00:28
604500 -- (-621.615) [-620.486] (-618.885) (-622.813) * [-623.846] (-620.983) (-621.618) (-621.763) -- 0:00:28
605000 -- (-620.690) (-620.935) [-619.738] (-622.301) * (-621.534) [-625.236] (-623.952) (-620.877) -- 0:00:28
Average standard deviation of split frequencies: 0.008191
605500 -- (-622.090) (-621.013) (-624.645) [-621.739] * (-622.783) (-620.405) (-621.664) [-622.332] -- 0:00:28
606000 -- (-621.732) (-619.067) [-619.560] (-622.420) * (-620.095) [-618.649] (-621.408) (-619.871) -- 0:00:27
606500 -- (-620.967) (-621.036) [-622.300] (-620.458) * (-620.291) [-624.218] (-623.161) (-621.594) -- 0:00:27
607000 -- (-622.614) (-619.588) [-620.731] (-624.177) * (-619.195) [-626.907] (-624.049) (-620.457) -- 0:00:27
607500 -- (-620.523) [-621.689] (-621.929) (-620.986) * (-619.376) (-622.460) (-621.965) [-622.016] -- 0:00:27
608000 -- (-620.311) [-622.334] (-624.627) (-622.560) * (-618.086) (-619.807) [-624.676] (-620.934) -- 0:00:27
608500 -- [-622.474] (-621.083) (-625.387) (-622.393) * (-621.413) [-620.084] (-622.167) (-621.512) -- 0:00:27
609000 -- (-622.030) [-619.486] (-624.371) (-621.085) * (-621.199) (-620.943) (-621.052) [-621.881] -- 0:00:27
609500 -- (-621.938) [-619.043] (-624.593) (-624.862) * (-623.875) (-619.827) [-624.643] (-621.996) -- 0:00:27
610000 -- (-620.452) [-620.270] (-624.892) (-622.105) * (-622.419) [-619.620] (-619.403) (-620.836) -- 0:00:27
Average standard deviation of split frequencies: 0.008491
610500 -- (-623.978) (-619.675) [-622.651] (-624.692) * (-620.051) (-621.563) [-620.458] (-621.290) -- 0:00:27
611000 -- [-623.890] (-622.442) (-621.883) (-620.364) * (-621.739) (-619.910) (-621.888) [-621.623] -- 0:00:27
611500 -- (-621.592) (-619.860) [-619.561] (-622.232) * (-622.537) (-619.805) (-620.316) [-622.946] -- 0:00:27
612000 -- (-621.008) (-621.833) [-620.556] (-626.513) * (-622.880) [-619.763] (-622.230) (-622.023) -- 0:00:27
612500 -- (-620.405) (-621.632) [-622.261] (-620.639) * (-622.739) [-619.954] (-620.933) (-619.646) -- 0:00:27
613000 -- (-621.581) (-622.060) (-619.281) [-621.423] * (-621.550) [-621.169] (-626.241) (-621.088) -- 0:00:27
613500 -- (-622.059) (-625.639) (-619.799) [-621.478] * [-623.875] (-621.714) (-622.845) (-621.315) -- 0:00:27
614000 -- (-621.492) (-622.151) (-621.411) [-621.020] * [-623.567] (-623.426) (-621.446) (-622.348) -- 0:00:27
614500 -- (-620.262) (-622.271) (-622.658) [-619.128] * (-622.664) [-621.491] (-624.938) (-621.587) -- 0:00:27
615000 -- (-622.939) (-623.570) (-621.404) [-618.977] * (-621.963) (-622.128) [-620.605] (-621.431) -- 0:00:27
Average standard deviation of split frequencies: 0.008274
615500 -- (-619.262) (-627.880) (-624.389) [-621.962] * (-620.080) (-623.756) [-622.558] (-619.588) -- 0:00:27
616000 -- (-623.362) (-622.265) (-624.953) [-620.306] * (-621.328) (-622.436) [-619.717] (-623.079) -- 0:00:27
616500 -- (-619.274) (-625.015) (-620.640) [-622.065] * (-622.014) [-619.272] (-624.179) (-621.547) -- 0:00:27
617000 -- (-622.788) (-623.393) [-619.392] (-619.843) * (-620.587) [-624.499] (-621.404) (-622.339) -- 0:00:27
617500 -- (-621.131) (-622.687) (-621.349) [-621.909] * [-620.231] (-621.949) (-622.234) (-622.378) -- 0:00:27
618000 -- [-622.288] (-620.939) (-620.794) (-621.899) * (-620.146) [-622.096] (-621.919) (-622.072) -- 0:00:27
618500 -- (-624.111) (-623.035) [-622.084] (-622.353) * [-619.364] (-620.067) (-622.482) (-621.758) -- 0:00:27
619000 -- (-626.091) (-619.906) (-622.336) [-620.747] * (-618.273) (-622.041) (-621.838) [-621.375] -- 0:00:27
619500 -- (-625.326) (-618.373) (-626.832) [-621.118] * (-622.518) [-621.564] (-622.655) (-621.341) -- 0:00:27
620000 -- (-624.634) (-626.033) (-623.039) [-618.404] * (-620.899) [-627.056] (-633.242) (-621.031) -- 0:00:26
Average standard deviation of split frequencies: 0.008402
620500 -- (-621.496) (-620.519) (-621.055) [-618.631] * (-623.293) (-620.525) (-626.349) [-620.242] -- 0:00:26
621000 -- (-619.550) [-620.383] (-623.262) (-623.666) * [-622.587] (-619.924) (-619.177) (-618.187) -- 0:00:26
621500 -- [-624.156] (-621.711) (-619.683) (-620.679) * (-621.027) [-621.099] (-619.341) (-622.241) -- 0:00:26
622000 -- (-623.490) [-620.482] (-622.987) (-623.199) * (-622.252) (-622.353) [-619.923] (-626.685) -- 0:00:26
622500 -- (-620.811) (-621.890) (-621.695) [-619.613] * (-621.389) (-624.163) (-620.367) [-620.574] -- 0:00:26
623000 -- [-621.991] (-625.042) (-620.977) (-621.704) * (-622.237) (-617.820) [-621.188] (-620.842) -- 0:00:26
623500 -- (-621.789) (-624.581) [-621.141] (-625.980) * [-623.423] (-623.743) (-621.397) (-621.894) -- 0:00:26
624000 -- [-621.974] (-623.106) (-624.281) (-621.462) * (-619.632) [-623.290] (-621.196) (-620.466) -- 0:00:26
624500 -- (-621.243) (-620.583) (-620.684) [-622.273] * (-624.445) (-630.494) [-621.228] (-621.695) -- 0:00:26
625000 -- (-623.117) [-621.428] (-621.654) (-622.961) * (-623.552) [-624.394] (-624.914) (-618.008) -- 0:00:26
Average standard deviation of split frequencies: 0.009178
625500 -- (-622.314) (-623.661) [-620.872] (-621.674) * (-623.627) (-620.290) (-621.706) [-620.527] -- 0:00:26
626000 -- (-619.992) [-621.319] (-621.782) (-621.807) * (-620.722) (-620.305) (-621.991) [-619.249] -- 0:00:26
626500 -- (-621.130) (-620.708) [-622.146] (-620.208) * (-622.293) (-621.725) (-621.895) [-622.070] -- 0:00:26
627000 -- (-619.889) (-624.093) [-625.256] (-620.245) * (-621.978) (-621.242) [-621.476] (-622.804) -- 0:00:26
627500 -- (-620.487) (-619.115) [-620.044] (-624.869) * [-619.632] (-624.011) (-622.780) (-623.625) -- 0:00:26
628000 -- (-622.120) [-622.025] (-619.038) (-620.657) * (-620.365) (-618.958) [-620.878] (-622.962) -- 0:00:26
628500 -- (-621.113) (-630.263) [-621.967] (-619.337) * (-620.377) (-619.814) (-624.254) [-622.572] -- 0:00:26
629000 -- (-626.598) [-621.997] (-621.458) (-620.649) * [-620.361] (-626.607) (-622.821) (-620.795) -- 0:00:26
629500 -- (-621.940) (-626.080) [-618.502] (-620.758) * (-621.419) (-623.096) (-620.766) [-622.398] -- 0:00:26
630000 -- (-623.992) (-621.890) [-621.426] (-621.515) * (-621.535) (-622.582) [-620.593] (-629.552) -- 0:00:26
Average standard deviation of split frequencies: 0.009189
630500 -- (-624.230) (-623.792) [-618.939] (-621.823) * (-625.410) (-622.924) [-623.752] (-625.692) -- 0:00:26
631000 -- (-624.070) [-621.814] (-620.194) (-620.775) * (-622.038) (-622.480) (-622.762) [-623.254] -- 0:00:26
631500 -- (-623.566) (-620.829) (-620.183) [-620.956] * [-620.754] (-619.738) (-622.728) (-620.449) -- 0:00:26
632000 -- [-624.685] (-625.186) (-622.058) (-618.784) * (-620.302) (-620.428) [-621.128] (-623.061) -- 0:00:26
632500 -- [-620.715] (-624.755) (-622.334) (-621.383) * (-620.816) [-619.327] (-623.851) (-621.801) -- 0:00:26
633000 -- [-625.320] (-623.703) (-621.060) (-626.819) * (-623.094) (-624.776) (-618.988) [-621.451] -- 0:00:26
633500 -- [-623.106] (-618.840) (-621.231) (-620.061) * (-622.386) (-627.277) [-619.370] (-621.079) -- 0:00:26
634000 -- (-622.645) (-619.470) (-622.329) [-621.919] * [-625.735] (-622.169) (-618.632) (-619.188) -- 0:00:25
634500 -- (-628.304) [-619.897] (-620.679) (-619.476) * (-620.848) (-622.565) (-620.486) [-621.619] -- 0:00:25
635000 -- (-621.497) [-622.450] (-621.116) (-620.497) * (-621.423) (-620.770) [-620.011] (-619.822) -- 0:00:25
Average standard deviation of split frequencies: 0.009025
635500 -- (-623.528) (-620.529) [-622.208] (-622.130) * (-621.707) (-623.985) [-620.579] (-620.442) -- 0:00:25
636000 -- (-622.310) [-620.704] (-620.035) (-621.253) * (-624.073) [-622.410] (-620.380) (-622.253) -- 0:00:25
636500 -- (-621.278) (-625.459) (-619.487) [-621.721] * (-622.980) (-618.720) (-618.725) [-620.132] -- 0:00:25
637000 -- (-622.460) [-623.784] (-619.454) (-627.991) * (-624.349) (-620.605) [-620.447] (-620.575) -- 0:00:25
637500 -- (-622.823) (-621.345) (-620.733) [-621.068] * [-622.523] (-622.445) (-620.251) (-620.200) -- 0:00:25
638000 -- (-621.181) [-619.497] (-619.503) (-621.575) * (-620.160) (-622.601) [-620.884] (-620.555) -- 0:00:25
638500 -- (-621.230) [-627.443] (-621.820) (-621.786) * [-621.320] (-623.907) (-622.875) (-620.778) -- 0:00:25
639000 -- (-623.776) [-621.867] (-621.748) (-622.448) * (-621.224) (-622.529) (-619.239) [-622.153] -- 0:00:25
639500 -- (-620.722) [-619.852] (-621.398) (-623.516) * (-622.223) [-623.591] (-621.841) (-619.725) -- 0:00:25
640000 -- (-625.661) (-619.711) [-619.612] (-620.984) * [-621.899] (-621.747) (-621.402) (-620.216) -- 0:00:25
Average standard deviation of split frequencies: 0.008738
640500 -- (-620.345) [-619.816] (-623.525) (-619.391) * (-622.437) (-620.593) (-620.641) [-623.954] -- 0:00:25
641000 -- (-621.164) [-620.303] (-623.505) (-622.738) * [-623.102] (-621.217) (-620.443) (-622.180) -- 0:00:25
641500 -- [-621.708] (-621.263) (-626.800) (-621.509) * (-621.111) (-621.775) [-623.176] (-622.104) -- 0:00:25
642000 -- (-620.813) (-620.454) [-618.962] (-622.988) * (-619.661) [-620.766] (-621.993) (-621.041) -- 0:00:25
642500 -- (-620.280) [-621.891] (-620.160) (-625.336) * (-622.631) (-621.118) (-620.355) [-620.187] -- 0:00:25
643000 -- (-620.310) [-620.495] (-620.413) (-621.138) * (-627.611) [-625.357] (-620.166) (-622.546) -- 0:00:24
643500 -- (-621.673) (-619.723) [-625.300] (-623.416) * (-628.715) [-618.850] (-619.837) (-625.676) -- 0:00:25
644000 -- [-621.106] (-625.786) (-621.567) (-621.783) * (-622.598) (-621.406) [-620.343] (-620.313) -- 0:00:25
644500 -- [-619.297] (-620.078) (-620.080) (-621.896) * (-622.837) [-619.577] (-622.066) (-620.687) -- 0:00:25
645000 -- [-620.363] (-619.683) (-620.848) (-621.163) * [-621.442] (-625.999) (-624.527) (-624.724) -- 0:00:25
Average standard deviation of split frequencies: 0.009572
645500 -- (-618.980) (-620.843) [-620.761] (-620.942) * [-622.244] (-624.952) (-621.380) (-624.175) -- 0:00:25
646000 -- [-620.037] (-622.920) (-624.019) (-623.493) * (-621.368) (-621.737) [-621.073] (-619.883) -- 0:00:25
646500 -- (-620.524) [-622.735] (-628.789) (-624.219) * (-621.947) (-623.225) (-624.721) [-621.013] -- 0:00:25
647000 -- (-620.479) [-621.197] (-621.459) (-620.260) * (-623.979) [-622.072] (-623.137) (-623.376) -- 0:00:25
647500 -- (-620.582) (-623.610) (-622.012) [-622.439] * [-621.853] (-621.804) (-624.488) (-620.559) -- 0:00:25
648000 -- (-623.128) [-620.870] (-620.586) (-621.122) * (-620.600) (-623.025) (-625.606) [-620.618] -- 0:00:24
648500 -- [-622.178] (-621.151) (-621.474) (-622.373) * (-621.848) (-624.335) [-622.240] (-621.163) -- 0:00:24
649000 -- (-621.178) [-620.862] (-622.688) (-621.743) * [-621.591] (-621.356) (-621.697) (-620.142) -- 0:00:24
649500 -- (-620.847) [-622.376] (-623.567) (-623.520) * (-625.919) (-623.114) (-624.134) [-619.747] -- 0:00:24
650000 -- [-621.812] (-621.108) (-626.714) (-624.704) * (-626.840) (-624.567) (-620.716) [-621.354] -- 0:00:24
Average standard deviation of split frequencies: 0.009972
650500 -- [-620.775] (-621.933) (-620.882) (-623.560) * (-623.730) [-624.654] (-624.110) (-620.063) -- 0:00:24
651000 -- [-620.483] (-623.012) (-623.074) (-623.932) * (-624.468) (-623.227) (-623.385) [-622.613] -- 0:00:24
651500 -- (-621.751) (-621.104) [-618.919] (-621.396) * (-623.431) (-626.845) [-619.341] (-618.865) -- 0:00:24
652000 -- [-623.157] (-623.343) (-621.370) (-621.878) * [-620.994] (-620.527) (-622.086) (-620.311) -- 0:00:24
652500 -- (-622.487) [-620.793] (-625.478) (-622.346) * (-618.639) (-620.880) (-622.280) [-622.629] -- 0:00:24
653000 -- [-620.442] (-624.790) (-622.433) (-621.192) * [-621.550] (-620.798) (-622.853) (-623.170) -- 0:00:24
653500 -- [-622.652] (-622.520) (-625.955) (-621.624) * (-618.974) [-622.223] (-621.214) (-620.551) -- 0:00:24
654000 -- [-619.535] (-620.303) (-621.002) (-620.070) * (-620.404) (-621.720) (-623.553) [-619.981] -- 0:00:24
654500 -- [-622.851] (-623.603) (-619.528) (-620.036) * (-620.855) (-625.225) (-622.580) [-619.232] -- 0:00:24
655000 -- [-625.366] (-622.338) (-621.130) (-621.575) * (-620.854) (-624.676) [-619.515] (-623.080) -- 0:00:24
Average standard deviation of split frequencies: 0.008623
655500 -- (-620.487) (-623.725) (-624.688) [-620.401] * (-621.489) [-621.013] (-624.330) (-620.295) -- 0:00:24
656000 -- (-621.567) [-620.678] (-622.816) (-621.264) * (-623.859) (-622.551) (-620.717) [-620.010] -- 0:00:24
656500 -- [-624.583] (-622.221) (-622.475) (-621.791) * (-622.356) (-624.782) [-620.924] (-619.213) -- 0:00:24
657000 -- (-622.876) [-620.408] (-621.268) (-621.276) * (-622.779) [-628.911] (-621.916) (-621.723) -- 0:00:24
657500 -- (-624.528) [-622.852] (-620.763) (-620.765) * (-621.340) (-625.454) [-621.764] (-622.793) -- 0:00:23
658000 -- (-624.263) (-618.935) (-620.207) [-619.005] * (-622.521) [-621.015] (-623.450) (-622.923) -- 0:00:23
658500 -- (-622.450) (-623.215) (-621.839) [-619.131] * (-623.580) (-623.107) (-621.854) [-619.420] -- 0:00:23
659000 -- [-620.647] (-625.272) (-622.299) (-619.809) * (-624.527) [-623.419] (-622.152) (-620.484) -- 0:00:23
659500 -- (-624.746) [-622.439] (-620.787) (-621.228) * (-623.874) [-621.702] (-622.197) (-620.613) -- 0:00:24
660000 -- (-623.506) [-624.016] (-621.240) (-622.288) * (-622.082) [-621.323] (-619.421) (-622.340) -- 0:00:24
Average standard deviation of split frequencies: 0.008562
660500 -- (-623.440) (-621.253) (-626.335) [-617.294] * (-624.885) [-620.436] (-623.569) (-621.828) -- 0:00:24
661000 -- [-619.724] (-621.436) (-626.371) (-621.403) * (-622.305) (-620.038) [-622.126] (-625.096) -- 0:00:24
661500 -- [-619.828] (-624.306) (-622.815) (-621.587) * (-620.128) (-626.063) (-623.911) [-623.898] -- 0:00:24
662000 -- (-620.667) (-621.950) [-621.013] (-624.224) * (-621.326) (-627.434) (-622.112) [-621.469] -- 0:00:23
662500 -- (-621.621) (-623.745) [-624.735] (-624.681) * (-622.289) (-620.366) (-618.949) [-621.221] -- 0:00:23
663000 -- (-619.442) [-622.951] (-624.014) (-621.087) * (-624.849) (-621.869) (-622.612) [-621.303] -- 0:00:23
663500 -- (-619.803) (-621.164) [-622.060] (-619.553) * (-624.350) (-619.836) (-620.408) [-621.555] -- 0:00:23
664000 -- (-619.772) (-620.968) [-619.226] (-621.828) * (-624.863) (-622.285) (-621.906) [-623.013] -- 0:00:23
664500 -- (-621.411) (-622.245) [-618.762] (-621.245) * [-621.712] (-626.366) (-621.033) (-623.480) -- 0:00:23
665000 -- (-621.162) (-622.860) [-621.294] (-620.019) * (-620.293) (-623.139) [-621.981] (-621.808) -- 0:00:23
Average standard deviation of split frequencies: 0.008777
665500 -- [-621.679] (-621.474) (-622.279) (-622.741) * (-621.071) (-622.523) (-627.104) [-621.469] -- 0:00:23
666000 -- (-620.183) (-621.598) (-621.837) [-619.612] * (-621.578) (-623.857) (-621.204) [-624.073] -- 0:00:23
666500 -- [-619.526] (-623.215) (-625.833) (-619.943) * (-622.091) (-622.112) [-620.543] (-627.765) -- 0:00:23
667000 -- [-621.793] (-620.997) (-620.602) (-620.617) * (-622.208) [-625.752] (-621.316) (-624.433) -- 0:00:23
667500 -- (-623.290) (-620.652) (-619.997) [-620.481] * [-620.228] (-622.698) (-622.486) (-624.474) -- 0:00:23
668000 -- [-622.871] (-621.632) (-621.120) (-619.333) * [-620.731] (-623.290) (-620.975) (-621.699) -- 0:00:23
668500 -- (-618.629) (-621.746) [-621.088] (-622.638) * (-623.020) (-622.030) [-623.284] (-620.401) -- 0:00:23
669000 -- (-621.026) [-620.663] (-621.623) (-622.207) * [-621.850] (-621.363) (-619.592) (-620.935) -- 0:00:23
669500 -- (-619.605) (-620.224) [-619.676] (-622.005) * (-621.853) (-620.872) [-617.844] (-623.233) -- 0:00:23
670000 -- (-623.954) (-621.264) [-621.915] (-619.735) * (-620.244) (-622.531) [-620.404] (-622.653) -- 0:00:23
Average standard deviation of split frequencies: 0.008903
670500 -- (-621.002) (-620.417) [-619.400] (-624.676) * (-621.214) (-621.969) [-621.868] (-623.706) -- 0:00:23
671000 -- (-622.669) [-620.478] (-620.197) (-622.996) * (-621.347) [-619.124] (-623.620) (-624.302) -- 0:00:23
671500 -- (-623.732) (-621.994) (-623.359) [-619.246] * (-627.632) [-620.702] (-624.230) (-623.889) -- 0:00:22
672000 -- (-618.252) (-625.870) (-623.886) [-619.972] * (-623.536) [-621.749] (-623.009) (-623.497) -- 0:00:22
672500 -- [-621.954] (-621.903) (-621.207) (-623.617) * (-625.876) [-624.472] (-623.014) (-621.007) -- 0:00:22
673000 -- [-622.092] (-622.670) (-625.560) (-622.556) * (-624.944) [-619.979] (-622.427) (-622.152) -- 0:00:22
673500 -- (-622.017) (-623.048) [-620.602] (-620.979) * [-618.866] (-622.089) (-621.476) (-621.561) -- 0:00:22
674000 -- [-620.720] (-621.472) (-623.593) (-620.501) * (-619.479) (-619.944) [-622.596] (-624.665) -- 0:00:22
674500 -- [-622.340] (-622.498) (-624.144) (-621.177) * (-620.501) [-617.721] (-623.274) (-622.395) -- 0:00:22
675000 -- [-627.091] (-620.168) (-623.704) (-621.432) * [-621.076] (-624.244) (-624.589) (-622.460) -- 0:00:23
Average standard deviation of split frequencies: 0.009112
675500 -- (-622.117) [-621.454] (-622.279) (-627.443) * [-620.256] (-623.358) (-624.163) (-624.790) -- 0:00:23
676000 -- (-623.721) [-622.398] (-622.700) (-623.337) * (-621.252) (-621.325) [-621.641] (-623.535) -- 0:00:23
676500 -- [-621.254] (-623.085) (-621.836) (-623.484) * (-620.964) (-621.015) (-625.366) [-622.474] -- 0:00:22
677000 -- (-620.499) (-621.772) [-621.053] (-623.327) * [-622.255] (-619.730) (-621.347) (-622.413) -- 0:00:22
677500 -- (-621.143) (-621.866) (-621.628) [-621.456] * (-622.920) (-623.325) [-620.772] (-621.167) -- 0:00:22
678000 -- (-621.959) (-621.640) (-622.441) [-619.084] * (-621.298) (-623.166) (-621.144) [-622.914] -- 0:00:22
678500 -- (-622.338) [-621.244] (-622.493) (-620.204) * [-622.115] (-620.500) (-621.660) (-623.520) -- 0:00:22
679000 -- (-621.715) [-620.980] (-627.409) (-622.330) * (-621.962) (-621.004) (-621.270) [-621.941] -- 0:00:22
679500 -- (-621.375) (-623.911) (-619.758) [-622.171] * (-621.041) (-620.555) [-623.703] (-623.891) -- 0:00:22
680000 -- [-619.958] (-622.083) (-622.077) (-625.244) * (-620.074) (-624.915) [-620.735] (-620.853) -- 0:00:22
Average standard deviation of split frequencies: 0.009049
680500 -- (-621.558) [-622.006] (-622.334) (-623.640) * (-621.424) (-622.500) [-621.121] (-623.013) -- 0:00:22
681000 -- (-623.612) [-621.747] (-620.893) (-623.455) * (-620.372) [-619.092] (-620.033) (-623.108) -- 0:00:22
681500 -- (-621.591) [-623.521] (-621.893) (-621.654) * (-620.963) (-623.739) (-625.026) [-623.012] -- 0:00:22
682000 -- [-621.308] (-624.302) (-621.647) (-622.624) * (-619.558) (-619.436) (-622.631) [-620.859] -- 0:00:22
682500 -- [-619.379] (-621.953) (-621.333) (-625.070) * (-620.705) (-619.990) (-623.901) [-626.448] -- 0:00:22
683000 -- (-620.559) [-621.195] (-620.769) (-621.228) * (-619.927) (-621.134) (-623.681) [-619.019] -- 0:00:22
683500 -- (-621.921) (-623.549) (-620.425) [-619.861] * (-624.920) [-619.024] (-621.571) (-620.568) -- 0:00:22
684000 -- (-621.033) (-625.105) [-622.003] (-620.916) * (-624.124) (-621.034) [-621.861] (-620.463) -- 0:00:22
684500 -- (-620.646) (-622.446) [-623.973] (-620.587) * (-620.727) [-619.235] (-625.623) (-621.533) -- 0:00:22
685000 -- (-620.347) (-623.405) (-622.478) [-621.881] * (-627.240) (-620.484) (-625.861) [-620.186] -- 0:00:22
Average standard deviation of split frequencies: 0.009346
685500 -- (-621.905) (-621.352) (-622.170) [-620.284] * (-621.949) (-619.346) (-626.579) [-618.754] -- 0:00:22
686000 -- [-623.764] (-621.472) (-622.205) (-621.012) * (-620.496) (-618.921) (-623.138) [-622.369] -- 0:00:21
686500 -- (-620.891) [-620.763] (-623.856) (-623.571) * (-619.677) (-618.988) (-621.936) [-624.837] -- 0:00:21
687000 -- (-624.359) [-621.730] (-622.531) (-620.353) * [-619.806] (-619.201) (-620.491) (-621.190) -- 0:00:21
687500 -- (-623.275) (-620.174) (-624.785) [-624.548] * (-621.368) (-620.099) [-620.356] (-621.353) -- 0:00:21
688000 -- (-624.881) (-621.969) (-621.433) [-620.005] * (-621.829) (-619.387) (-620.283) [-620.753] -- 0:00:21
688500 -- [-621.970] (-620.773) (-620.449) (-621.041) * [-620.791] (-620.657) (-619.628) (-624.265) -- 0:00:21
689000 -- (-620.941) (-620.375) [-620.690] (-622.688) * (-619.591) [-620.922] (-620.774) (-624.623) -- 0:00:21
689500 -- [-618.356] (-619.260) (-619.942) (-619.580) * (-623.524) [-619.572] (-619.568) (-621.876) -- 0:00:21
690000 -- (-622.518) (-621.727) (-620.823) [-622.585] * (-628.591) (-623.089) (-623.405) [-625.781] -- 0:00:21
Average standard deviation of split frequencies: 0.009464
690500 -- (-621.373) (-620.524) [-620.874] (-621.773) * (-621.191) (-621.713) [-622.814] (-622.293) -- 0:00:21
691000 -- [-619.180] (-620.812) (-621.626) (-621.545) * (-621.538) (-622.435) (-621.997) [-622.165] -- 0:00:21
691500 -- [-622.009] (-620.961) (-621.161) (-622.812) * (-622.548) [-620.596] (-622.814) (-623.364) -- 0:00:21
692000 -- [-626.651] (-621.205) (-623.301) (-622.846) * (-621.722) (-619.973) (-621.169) [-620.034] -- 0:00:21
692500 -- (-623.358) (-619.438) (-623.296) [-622.958] * (-623.845) (-619.746) [-620.928] (-620.958) -- 0:00:21
693000 -- (-623.600) (-621.519) [-621.197] (-621.163) * [-621.437] (-621.477) (-625.425) (-624.110) -- 0:00:21
693500 -- (-619.960) (-621.859) (-622.701) [-622.517] * (-622.503) (-620.972) [-621.813] (-618.777) -- 0:00:21
694000 -- (-620.184) (-623.100) [-620.824] (-621.467) * (-619.758) (-622.040) (-618.736) [-621.058] -- 0:00:21
694500 -- [-620.773] (-630.429) (-623.105) (-621.754) * (-620.664) (-621.747) (-622.060) [-621.566] -- 0:00:21
695000 -- (-618.936) (-622.258) [-620.672] (-620.881) * (-626.433) (-621.078) [-623.843] (-621.510) -- 0:00:21
Average standard deviation of split frequencies: 0.009573
695500 -- [-620.823] (-626.666) (-621.762) (-622.864) * (-621.084) [-623.230] (-624.335) (-622.107) -- 0:00:21
696000 -- [-620.332] (-622.997) (-620.303) (-620.683) * (-624.386) [-621.145] (-622.052) (-623.055) -- 0:00:21
696500 -- (-622.234) (-622.955) [-620.916] (-621.882) * (-619.617) [-622.635] (-623.301) (-623.399) -- 0:00:21
697000 -- (-623.902) (-623.329) (-620.485) [-619.350] * [-623.327] (-622.456) (-625.096) (-626.675) -- 0:00:21
697500 -- [-622.842] (-624.583) (-622.839) (-623.485) * (-622.158) (-620.170) (-622.783) [-623.380] -- 0:00:21
698000 -- (-622.090) [-624.212] (-621.706) (-621.188) * (-620.827) [-620.742] (-625.130) (-622.455) -- 0:00:21
698500 -- [-619.984] (-627.255) (-621.591) (-619.972) * (-619.155) [-623.204] (-621.903) (-622.460) -- 0:00:21
699000 -- (-624.281) [-624.009] (-620.426) (-622.191) * [-621.330] (-620.026) (-628.241) (-620.401) -- 0:00:21
699500 -- (-622.190) (-622.409) [-621.947] (-627.623) * (-620.693) (-621.038) [-623.861] (-625.258) -- 0:00:21
700000 -- (-622.481) (-621.553) (-626.586) [-622.161] * (-620.427) (-619.812) [-621.984] (-620.648) -- 0:00:20
Average standard deviation of split frequencies: 0.009688
700500 -- [-620.440] (-623.437) (-625.142) (-625.891) * (-621.688) (-623.512) [-622.653] (-619.211) -- 0:00:20
701000 -- [-620.610] (-623.143) (-623.569) (-622.928) * (-619.527) [-619.574] (-628.313) (-621.129) -- 0:00:20
701500 -- (-621.372) (-625.780) [-621.467] (-619.817) * [-619.393] (-620.686) (-626.291) (-622.909) -- 0:00:20
702000 -- (-625.693) (-621.556) [-620.052] (-621.274) * [-623.158] (-625.926) (-620.345) (-621.208) -- 0:00:20
702500 -- (-622.481) (-623.950) (-620.101) [-620.801] * (-621.326) [-621.670] (-620.434) (-617.428) -- 0:00:20
703000 -- (-620.462) [-622.591] (-621.420) (-620.664) * (-619.569) (-623.095) [-622.508] (-621.671) -- 0:00:20
703500 -- [-619.357] (-622.183) (-624.093) (-620.919) * (-623.405) [-619.176] (-620.937) (-621.747) -- 0:00:20
704000 -- (-620.549) [-623.679] (-626.185) (-620.093) * (-621.688) (-620.489) [-620.276] (-628.994) -- 0:00:20
704500 -- [-623.631] (-622.053) (-623.518) (-620.599) * [-619.950] (-620.654) (-621.443) (-626.677) -- 0:00:20
705000 -- (-624.544) (-620.575) [-626.138] (-618.521) * [-619.611] (-621.998) (-621.394) (-624.003) -- 0:00:20
Average standard deviation of split frequencies: 0.009615
705500 -- (-619.686) (-621.831) (-627.295) [-619.468] * (-622.069) (-619.857) [-623.606] (-620.963) -- 0:00:20
706000 -- [-621.709] (-624.572) (-621.290) (-621.646) * (-620.369) [-619.010] (-622.161) (-624.841) -- 0:00:20
706500 -- [-619.867] (-621.438) (-619.851) (-619.702) * (-619.906) (-619.223) [-620.632] (-621.412) -- 0:00:20
707000 -- (-618.083) (-623.542) (-623.440) [-620.402] * (-620.701) (-620.576) [-628.034] (-620.389) -- 0:00:20
707500 -- [-621.105] (-621.669) (-623.501) (-620.424) * (-621.707) [-620.347] (-621.863) (-624.979) -- 0:00:20
708000 -- [-620.451] (-623.955) (-620.875) (-620.281) * (-619.296) (-620.365) [-621.322] (-625.172) -- 0:00:20
708500 -- (-624.002) (-620.552) [-620.838] (-619.054) * (-622.349) (-619.150) [-622.027] (-620.424) -- 0:00:20
709000 -- [-618.812] (-621.884) (-622.828) (-621.861) * (-621.056) (-620.015) [-621.371] (-620.716) -- 0:00:20
709500 -- (-622.857) (-622.647) (-623.228) [-621.666] * (-623.504) (-620.597) [-620.047] (-619.757) -- 0:00:20
710000 -- (-621.875) (-622.622) (-622.716) [-618.776] * (-619.737) (-620.035) (-622.010) [-620.832] -- 0:00:20
Average standard deviation of split frequencies: 0.009906
710500 -- [-620.907] (-626.495) (-622.603) (-624.063) * (-620.150) [-619.490] (-621.256) (-621.448) -- 0:00:20
711000 -- (-623.871) (-623.972) [-621.208] (-627.467) * (-621.178) [-619.703] (-621.228) (-619.310) -- 0:00:20
711500 -- (-619.904) (-620.791) [-621.279] (-625.987) * (-620.348) [-620.179] (-622.437) (-620.509) -- 0:00:20
712000 -- (-621.087) [-620.657] (-622.286) (-623.582) * (-624.253) [-619.542] (-624.251) (-618.409) -- 0:00:20
712500 -- (-621.161) (-621.160) [-620.997] (-620.863) * (-623.329) [-621.579] (-621.919) (-620.380) -- 0:00:20
713000 -- (-622.295) (-623.438) [-622.431] (-622.008) * [-624.053] (-628.387) (-624.424) (-623.596) -- 0:00:20
713500 -- (-621.898) (-622.687) [-622.144] (-623.052) * (-622.235) (-621.074) [-621.334] (-620.935) -- 0:00:20
714000 -- (-619.548) (-620.435) [-620.780] (-621.939) * (-620.818) [-618.531] (-621.794) (-620.753) -- 0:00:20
714500 -- (-619.226) [-619.779] (-620.223) (-622.390) * (-620.470) (-623.542) (-620.900) [-621.437] -- 0:00:19
715000 -- (-622.857) (-620.625) [-622.640] (-623.168) * (-622.158) (-623.536) [-622.266] (-622.843) -- 0:00:19
Average standard deviation of split frequencies: 0.010710
715500 -- (-630.100) [-621.790] (-621.311) (-625.174) * [-621.506] (-621.595) (-619.768) (-620.682) -- 0:00:19
716000 -- (-624.016) (-623.669) (-622.342) [-623.427] * (-621.966) [-620.312] (-621.182) (-621.976) -- 0:00:19
716500 -- (-625.062) (-626.319) [-619.963] (-621.494) * (-623.183) (-623.500) (-620.309) [-620.234] -- 0:00:19
717000 -- [-622.784] (-626.566) (-620.852) (-622.569) * (-622.399) (-622.616) [-622.546] (-620.602) -- 0:00:19
717500 -- [-620.903] (-619.324) (-625.752) (-621.426) * (-619.732) (-624.035) [-621.930] (-620.945) -- 0:00:19
718000 -- (-620.847) [-621.998] (-620.033) (-620.626) * (-621.768) (-620.921) [-620.482] (-619.388) -- 0:00:19
718500 -- [-620.713] (-619.292) (-620.261) (-619.775) * (-626.633) [-621.227] (-624.178) (-621.026) -- 0:00:19
719000 -- [-618.028] (-620.848) (-621.634) (-623.449) * (-622.438) (-622.332) [-621.879] (-621.973) -- 0:00:19
719500 -- (-619.460) [-623.357] (-621.511) (-622.575) * (-620.889) [-624.760] (-619.956) (-619.001) -- 0:00:19
720000 -- (-621.700) (-621.520) (-620.164) [-628.667] * (-625.394) (-621.022) [-620.757] (-623.823) -- 0:00:19
Average standard deviation of split frequencies: 0.011120
720500 -- (-625.953) [-619.241] (-623.322) (-620.437) * (-622.087) (-623.984) [-620.673] (-620.831) -- 0:00:19
721000 -- (-621.109) [-620.583] (-622.243) (-623.495) * (-626.389) [-622.556] (-621.171) (-619.714) -- 0:00:19
721500 -- [-619.545] (-624.662) (-621.647) (-622.195) * (-621.331) (-627.491) (-621.099) [-620.036] -- 0:00:19
722000 -- (-618.772) [-623.617] (-622.895) (-622.749) * [-620.831] (-620.641) (-621.629) (-625.063) -- 0:00:19
722500 -- (-620.717) [-619.782] (-621.066) (-623.610) * (-625.158) [-620.695] (-621.227) (-624.938) -- 0:00:19
723000 -- (-623.249) (-618.978) [-622.583] (-621.847) * (-622.380) (-623.170) (-619.704) [-625.763] -- 0:00:19
723500 -- [-622.247] (-620.600) (-624.804) (-627.549) * (-623.125) (-624.901) [-620.865] (-620.870) -- 0:00:19
724000 -- (-620.115) [-620.202] (-620.053) (-622.188) * (-619.119) (-627.216) (-620.084) [-620.422] -- 0:00:19
724500 -- (-620.614) (-620.029) [-623.285] (-620.214) * [-620.597] (-621.899) (-625.859) (-618.599) -- 0:00:19
725000 -- (-620.230) (-626.908) [-620.139] (-623.788) * (-622.959) (-622.396) (-623.391) [-622.108] -- 0:00:19
Average standard deviation of split frequencies: 0.010649
725500 -- (-620.606) (-622.897) [-622.184] (-622.241) * (-621.346) (-625.585) [-621.185] (-623.561) -- 0:00:19
726000 -- (-623.629) [-621.277] (-619.781) (-621.468) * (-620.450) [-623.320] (-620.685) (-622.560) -- 0:00:19
726500 -- (-624.166) (-625.157) (-623.822) [-624.494] * [-620.549] (-622.990) (-624.815) (-621.182) -- 0:00:19
727000 -- (-618.546) [-622.271] (-622.709) (-622.896) * (-619.463) (-619.457) (-622.725) [-620.611] -- 0:00:19
727500 -- (-621.053) (-621.735) (-620.773) [-622.897] * (-621.720) [-622.783] (-620.874) (-623.522) -- 0:00:19
728000 -- (-621.986) (-621.990) [-620.866] (-621.357) * [-621.706] (-623.215) (-619.776) (-623.380) -- 0:00:19
728500 -- (-621.365) [-622.203] (-619.590) (-621.207) * (-622.051) [-621.851] (-618.987) (-622.661) -- 0:00:19
729000 -- (-621.699) (-619.647) [-621.068] (-621.200) * (-623.448) [-621.012] (-620.380) (-620.610) -- 0:00:18
729500 -- (-621.432) [-622.205] (-621.075) (-620.921) * [-622.484] (-621.433) (-620.053) (-620.756) -- 0:00:18
730000 -- (-627.402) (-623.136) [-623.837] (-622.802) * [-620.328] (-620.672) (-619.298) (-619.624) -- 0:00:18
Average standard deviation of split frequencies: 0.010710
730500 -- (-623.118) (-624.758) (-621.738) [-621.106] * (-620.483) [-621.945] (-618.934) (-621.526) -- 0:00:18
731000 -- (-620.875) [-619.540] (-621.637) (-622.086) * [-621.962] (-620.275) (-626.648) (-621.521) -- 0:00:18
731500 -- (-623.240) [-621.052] (-624.709) (-627.728) * (-624.413) (-621.401) (-623.187) [-621.973] -- 0:00:18
732000 -- [-620.586] (-621.024) (-619.306) (-628.128) * (-624.282) (-623.053) (-621.052) [-621.332] -- 0:00:18
732500 -- [-621.095] (-620.771) (-620.355) (-622.874) * (-622.170) (-619.910) (-623.453) [-621.683] -- 0:00:18
733000 -- (-621.824) [-620.694] (-621.410) (-626.432) * (-626.403) [-618.597] (-620.970) (-621.327) -- 0:00:18
733500 -- (-619.815) (-624.247) [-623.294] (-621.881) * (-621.391) (-619.316) (-619.959) [-623.294] -- 0:00:18
734000 -- (-621.805) (-623.203) [-619.392] (-624.753) * (-622.314) (-622.157) (-618.950) [-621.095] -- 0:00:18
734500 -- (-621.430) (-621.624) [-620.780] (-622.937) * [-622.338] (-620.401) (-620.547) (-628.548) -- 0:00:18
735000 -- (-621.066) (-621.541) (-620.400) [-619.533] * (-624.736) (-622.717) [-619.083] (-627.223) -- 0:00:18
Average standard deviation of split frequencies: 0.010547
735500 -- (-622.792) (-620.678) (-621.483) [-623.473] * (-622.415) [-620.231] (-619.278) (-620.927) -- 0:00:18
736000 -- (-620.751) [-622.900] (-619.755) (-622.865) * (-624.638) (-622.870) [-625.081] (-623.941) -- 0:00:18
736500 -- (-624.734) (-623.798) [-620.947] (-623.417) * (-622.264) (-621.471) (-621.180) [-623.586] -- 0:00:18
737000 -- (-621.326) [-620.292] (-619.910) (-623.148) * (-622.390) (-624.715) [-619.209] (-620.433) -- 0:00:18
737500 -- (-620.439) (-620.055) [-620.860] (-623.078) * (-621.294) (-625.512) (-623.687) [-621.629] -- 0:00:18
738000 -- [-621.683] (-620.424) (-624.623) (-622.693) * (-624.246) (-621.449) (-621.407) [-622.390] -- 0:00:18
738500 -- (-621.118) (-619.873) (-623.446) [-620.473] * [-622.372] (-623.453) (-620.578) (-619.584) -- 0:00:18
739000 -- (-620.853) [-623.331] (-622.259) (-621.703) * (-621.050) (-620.810) (-620.524) [-619.432] -- 0:00:18
739500 -- (-624.526) [-624.850] (-625.095) (-620.754) * (-621.199) [-623.286] (-625.068) (-621.944) -- 0:00:18
740000 -- [-622.804] (-621.799) (-621.739) (-621.555) * [-621.602] (-621.208) (-624.720) (-622.933) -- 0:00:18
Average standard deviation of split frequencies: 0.010353
740500 -- (-621.966) (-621.888) [-622.994] (-619.747) * (-627.423) [-625.173] (-626.318) (-623.354) -- 0:00:18
741000 -- (-618.929) (-621.737) [-620.147] (-626.290) * (-623.115) (-626.226) (-619.559) [-622.506] -- 0:00:18
741500 -- [-619.225] (-625.251) (-620.706) (-621.408) * (-622.237) (-622.104) (-621.249) [-623.460] -- 0:00:18
742000 -- [-619.089] (-623.693) (-619.867) (-623.386) * (-622.845) (-622.633) (-620.531) [-622.056] -- 0:00:18
742500 -- (-621.641) (-622.636) (-620.881) [-621.858] * (-625.519) (-621.544) [-619.912] (-619.428) -- 0:00:18
743000 -- (-621.785) (-625.188) (-620.207) [-624.234] * (-630.077) [-621.703] (-622.234) (-618.873) -- 0:00:17
743500 -- (-623.285) (-622.846) [-622.592] (-621.201) * (-620.855) (-621.272) [-620.806] (-620.000) -- 0:00:17
744000 -- (-624.777) (-622.301) [-620.614] (-624.212) * (-619.041) [-622.434] (-620.140) (-618.233) -- 0:00:17
744500 -- [-621.085] (-622.924) (-621.333) (-622.415) * (-624.978) [-620.081] (-621.225) (-619.587) -- 0:00:17
745000 -- (-624.385) [-620.087] (-622.784) (-618.947) * (-619.479) (-622.063) (-622.477) [-619.450] -- 0:00:17
Average standard deviation of split frequencies: 0.010068
745500 -- (-627.154) (-621.919) [-618.370] (-622.040) * (-623.349) (-621.969) (-621.294) [-619.830] -- 0:00:17
746000 -- (-623.264) [-622.242] (-620.921) (-622.879) * [-620.295] (-622.327) (-622.124) (-620.692) -- 0:00:17
746500 -- [-623.673] (-620.521) (-619.913) (-622.657) * (-618.619) (-620.522) [-621.205] (-620.802) -- 0:00:17
747000 -- (-622.780) (-619.626) [-622.756] (-621.206) * [-621.427] (-622.207) (-619.840) (-624.870) -- 0:00:17
747500 -- (-627.688) (-621.095) [-621.596] (-621.567) * [-623.135] (-621.258) (-624.001) (-622.113) -- 0:00:17
748000 -- (-626.159) (-622.905) (-621.489) [-620.216] * (-623.564) (-621.894) [-624.980] (-621.529) -- 0:00:17
748500 -- (-622.455) (-624.935) [-621.502] (-622.386) * (-622.078) [-622.992] (-623.829) (-621.318) -- 0:00:17
749000 -- [-620.562] (-624.647) (-621.002) (-619.819) * [-620.412] (-621.191) (-623.396) (-621.127) -- 0:00:17
749500 -- (-622.613) (-621.654) [-620.442] (-620.312) * (-622.397) (-622.490) [-623.127] (-622.554) -- 0:00:17
750000 -- (-622.829) (-623.652) (-621.407) [-622.135] * (-619.141) (-622.323) (-619.577) [-620.190] -- 0:00:17
Average standard deviation of split frequencies: 0.010090
750500 -- (-620.706) (-622.203) [-621.924] (-622.777) * (-620.991) (-622.604) (-620.233) [-624.579] -- 0:00:17
751000 -- (-620.694) [-621.959] (-620.444) (-621.927) * (-621.065) [-622.100] (-621.038) (-626.562) -- 0:00:17
751500 -- (-621.666) [-621.651] (-620.869) (-622.131) * [-619.060] (-622.248) (-620.269) (-623.452) -- 0:00:17
752000 -- (-621.331) (-620.567) [-619.694] (-620.432) * [-622.309] (-622.173) (-623.872) (-621.294) -- 0:00:17
752500 -- (-624.608) (-620.845) [-623.473] (-621.380) * [-622.802] (-624.751) (-622.342) (-623.360) -- 0:00:17
753000 -- (-624.317) (-622.101) [-623.899] (-622.109) * (-622.167) (-620.553) (-621.286) [-623.405] -- 0:00:17
753500 -- (-622.232) (-620.469) [-621.239] (-624.868) * [-626.251] (-619.090) (-625.390) (-624.159) -- 0:00:17
754000 -- (-620.967) (-624.124) [-621.283] (-624.986) * (-620.991) (-624.362) [-623.392] (-621.531) -- 0:00:17
754500 -- [-621.714] (-620.828) (-620.295) (-619.832) * [-620.705] (-619.494) (-622.081) (-620.571) -- 0:00:17
755000 -- [-622.066] (-622.595) (-622.554) (-619.682) * (-623.148) (-623.592) [-620.149] (-620.707) -- 0:00:17
Average standard deviation of split frequencies: 0.010642
755500 -- (-622.132) [-621.695] (-620.109) (-623.491) * (-624.254) (-620.076) [-621.171] (-621.460) -- 0:00:17
756000 -- (-622.446) [-619.556] (-626.180) (-623.169) * (-622.611) (-619.051) (-620.903) [-621.486] -- 0:00:17
756500 -- [-621.159] (-622.544) (-627.004) (-622.317) * [-622.514] (-619.713) (-620.894) (-625.876) -- 0:00:17
757000 -- (-623.505) [-621.225] (-626.633) (-622.669) * [-620.725] (-620.835) (-620.858) (-621.305) -- 0:00:17
757500 -- [-623.936] (-623.343) (-623.194) (-621.019) * (-622.570) (-621.782) (-621.540) [-621.806] -- 0:00:16
758000 -- (-624.588) (-621.910) [-625.418] (-626.159) * (-623.339) (-624.184) (-620.509) [-620.804] -- 0:00:16
758500 -- [-624.100] (-626.193) (-622.700) (-624.813) * (-624.072) [-627.722] (-622.936) (-620.979) -- 0:00:16
759000 -- (-624.144) [-622.764] (-621.859) (-622.954) * [-620.705] (-622.028) (-620.314) (-621.911) -- 0:00:16
759500 -- (-622.230) [-622.200] (-620.758) (-627.551) * (-620.936) [-621.821] (-623.315) (-623.246) -- 0:00:16
760000 -- (-624.920) (-620.698) [-619.935] (-619.655) * [-622.188] (-621.737) (-622.755) (-622.444) -- 0:00:16
Average standard deviation of split frequencies: 0.010825
760500 -- (-625.215) (-621.021) (-620.800) [-622.772] * (-620.850) [-622.181] (-623.385) (-619.635) -- 0:00:16
761000 -- (-620.530) (-620.957) [-620.691] (-619.726) * [-621.536] (-620.076) (-623.279) (-621.569) -- 0:00:16
761500 -- (-619.521) [-620.937] (-620.211) (-622.173) * [-619.579] (-622.976) (-621.143) (-624.180) -- 0:00:16
762000 -- (-621.030) [-622.986] (-623.871) (-620.569) * [-618.940] (-620.275) (-621.582) (-621.638) -- 0:00:16
762500 -- (-629.300) (-624.256) [-619.502] (-619.952) * (-621.995) (-620.905) [-622.786] (-628.401) -- 0:00:16
763000 -- (-625.321) (-620.993) [-620.017] (-622.057) * [-623.627] (-621.957) (-621.073) (-624.003) -- 0:00:16
763500 -- (-622.198) (-620.880) (-621.835) [-620.196] * [-623.515] (-622.782) (-622.216) (-623.394) -- 0:00:16
764000 -- (-620.399) (-621.069) (-621.546) [-618.773] * (-619.959) [-621.217] (-622.389) (-621.888) -- 0:00:16
764500 -- [-619.979] (-620.667) (-621.203) (-620.447) * (-621.455) (-621.693) (-620.041) [-620.921] -- 0:00:16
765000 -- (-620.484) [-624.593] (-623.201) (-623.549) * (-621.940) [-619.255] (-620.465) (-619.952) -- 0:00:16
Average standard deviation of split frequencies: 0.010626
765500 -- (-623.268) (-619.733) (-620.348) [-622.179] * [-624.774] (-623.725) (-621.766) (-621.057) -- 0:00:16
766000 -- (-623.923) (-620.378) (-619.314) [-621.950] * [-620.899] (-625.180) (-620.947) (-620.734) -- 0:00:16
766500 -- (-626.249) (-619.488) [-621.994] (-625.795) * [-623.894] (-621.596) (-624.692) (-621.453) -- 0:00:16
767000 -- [-620.921] (-619.977) (-620.461) (-622.588) * (-622.539) [-621.478] (-625.234) (-625.079) -- 0:00:16
767500 -- (-622.995) [-620.249] (-620.799) (-620.797) * (-623.788) (-620.798) (-621.907) [-624.196] -- 0:00:16
768000 -- [-622.941] (-620.113) (-623.309) (-621.490) * (-622.997) (-620.436) [-622.217] (-622.608) -- 0:00:16
768500 -- (-627.523) (-620.291) [-619.672] (-620.511) * (-619.443) (-621.418) (-622.495) [-623.887] -- 0:00:16
769000 -- (-622.382) (-621.505) (-619.995) [-620.815] * (-620.278) (-618.594) [-621.863] (-619.509) -- 0:00:16
769500 -- (-619.321) (-621.095) [-622.270] (-623.710) * (-630.219) [-622.418] (-621.529) (-618.343) -- 0:00:16
770000 -- [-620.123] (-623.039) (-623.598) (-621.244) * (-626.546) (-622.849) [-620.510] (-621.474) -- 0:00:16
Average standard deviation of split frequencies: 0.010521
770500 -- (-621.262) (-620.124) [-621.994] (-621.200) * (-621.489) [-620.599] (-621.331) (-620.367) -- 0:00:16
771000 -- (-620.431) (-623.932) [-620.041] (-620.035) * (-621.069) (-621.875) [-620.265] (-621.349) -- 0:00:16
771500 -- (-620.740) [-620.450] (-620.328) (-620.409) * (-623.123) (-623.010) [-620.766] (-620.711) -- 0:00:15
772000 -- (-619.777) (-621.472) [-619.111] (-621.840) * [-619.885] (-627.371) (-620.630) (-621.806) -- 0:00:15
772500 -- (-620.847) (-623.465) (-620.708) [-624.641] * (-622.347) (-622.169) [-619.769] (-623.834) -- 0:00:15
773000 -- (-620.970) (-622.648) (-620.565) [-619.827] * (-621.214) (-622.318) [-624.233] (-622.069) -- 0:00:15
773500 -- (-624.268) (-622.355) [-623.128] (-620.263) * [-621.045] (-621.036) (-622.100) (-622.591) -- 0:00:15
774000 -- (-627.011) (-622.391) (-624.153) [-620.591] * (-622.091) [-622.060] (-622.361) (-621.142) -- 0:00:15
774500 -- (-626.164) (-621.116) (-622.256) [-622.316] * (-621.699) (-619.302) (-622.562) [-620.810] -- 0:00:15
775000 -- (-621.973) [-621.114] (-621.241) (-621.691) * (-621.804) (-619.460) (-627.390) [-621.501] -- 0:00:15
Average standard deviation of split frequencies: 0.010125
775500 -- (-621.470) (-627.444) [-622.589] (-620.299) * (-624.102) [-621.930] (-621.994) (-622.978) -- 0:00:15
776000 -- (-621.572) (-624.781) [-620.093] (-620.026) * (-618.372) (-623.060) [-621.780] (-624.280) -- 0:00:15
776500 -- (-620.766) [-621.212] (-623.670) (-622.075) * (-621.381) [-623.738] (-621.944) (-626.021) -- 0:00:15
777000 -- [-619.547] (-623.017) (-624.287) (-620.826) * (-620.941) [-625.340] (-621.920) (-622.829) -- 0:00:15
777500 -- (-621.371) (-620.262) [-622.720] (-623.560) * (-618.954) (-622.764) [-621.130] (-623.736) -- 0:00:15
778000 -- [-623.143] (-618.747) (-622.508) (-622.262) * (-621.802) (-622.854) [-621.604] (-623.407) -- 0:00:15
778500 -- (-622.023) (-622.099) (-625.870) [-623.382] * (-619.103) (-621.519) (-621.927) [-621.527] -- 0:00:15
779000 -- [-620.538] (-621.715) (-622.305) (-622.216) * (-620.500) (-621.478) (-620.736) [-620.950] -- 0:00:15
779500 -- (-620.973) (-619.109) [-624.777] (-623.205) * (-623.988) [-625.368] (-620.864) (-624.993) -- 0:00:15
780000 -- [-620.640] (-625.110) (-620.537) (-625.179) * (-623.134) (-621.861) [-620.486] (-621.271) -- 0:00:15
Average standard deviation of split frequencies: 0.009984
780500 -- (-620.460) (-626.027) [-620.870] (-621.571) * (-624.997) (-620.887) [-621.421] (-621.468) -- 0:00:15
781000 -- (-620.450) (-621.738) (-621.079) [-619.842] * (-621.493) (-620.141) [-619.304] (-619.768) -- 0:00:15
781500 -- (-622.084) (-620.619) (-623.467) [-619.768] * [-621.190] (-620.885) (-620.828) (-621.683) -- 0:00:15
782000 -- (-620.518) [-621.209] (-628.520) (-621.787) * (-623.977) (-622.124) (-622.443) [-620.030] -- 0:00:15
782500 -- (-620.841) (-621.723) [-620.641] (-619.432) * (-623.323) (-621.469) [-619.452] (-621.586) -- 0:00:15
783000 -- (-621.535) (-619.885) [-621.899] (-628.894) * (-623.646) [-618.949] (-620.612) (-622.404) -- 0:00:15
783500 -- (-620.735) [-621.348] (-622.216) (-621.214) * [-621.053] (-622.616) (-620.531) (-621.225) -- 0:00:15
784000 -- (-622.488) [-620.963] (-623.447) (-619.595) * (-621.349) [-619.911] (-623.025) (-625.001) -- 0:00:15
784500 -- (-623.195) [-617.776] (-623.242) (-619.723) * (-622.083) (-623.175) (-623.627) [-623.583] -- 0:00:15
785000 -- (-622.766) (-619.536) [-619.763] (-618.852) * (-620.305) (-629.869) [-621.439] (-621.610) -- 0:00:15
Average standard deviation of split frequencies: 0.010356
785500 -- (-623.743) (-625.037) [-626.377] (-621.478) * (-622.939) [-621.791] (-623.295) (-620.966) -- 0:00:15
786000 -- (-625.159) [-624.353] (-625.063) (-619.071) * (-622.706) (-623.677) (-621.862) [-621.216] -- 0:00:14
786500 -- (-624.053) (-622.692) [-621.606] (-621.811) * (-620.355) [-621.924] (-620.444) (-621.528) -- 0:00:14
787000 -- (-623.083) (-622.009) [-620.584] (-620.425) * [-621.402] (-620.093) (-622.923) (-624.204) -- 0:00:14
787500 -- (-623.300) (-620.548) (-622.050) [-621.395] * [-620.506] (-621.709) (-627.500) (-621.199) -- 0:00:14
788000 -- (-622.746) [-621.811] (-623.792) (-624.438) * (-620.611) (-622.753) (-622.041) [-623.904] -- 0:00:14
788500 -- (-621.709) [-620.854] (-620.510) (-621.205) * (-625.283) (-622.250) (-621.775) [-625.900] -- 0:00:14
789000 -- (-621.050) (-621.570) (-621.849) [-620.737] * [-623.931] (-623.877) (-621.307) (-619.833) -- 0:00:14
789500 -- (-622.611) [-622.880] (-622.259) (-621.345) * (-622.068) (-622.842) [-620.085] (-623.096) -- 0:00:14
790000 -- (-623.482) [-620.131] (-623.585) (-623.733) * (-625.252) [-623.386] (-618.200) (-619.680) -- 0:00:14
Average standard deviation of split frequencies: 0.009818
790500 -- [-619.225] (-619.221) (-623.400) (-620.737) * (-624.438) (-621.019) (-623.271) [-621.418] -- 0:00:14
791000 -- [-619.402] (-623.604) (-620.841) (-624.033) * (-623.451) (-621.972) [-620.986] (-619.349) -- 0:00:14
791500 -- (-620.468) (-620.024) (-624.519) [-620.177] * (-622.454) (-622.156) (-622.066) [-620.110] -- 0:00:14
792000 -- (-619.366) [-623.419] (-621.621) (-620.535) * [-622.076] (-621.347) (-619.945) (-621.579) -- 0:00:14
792500 -- [-620.549] (-621.786) (-621.732) (-620.525) * (-620.526) [-621.718] (-622.023) (-622.316) -- 0:00:14
793000 -- (-620.355) (-623.563) [-621.938] (-621.205) * (-620.468) (-621.051) [-619.757] (-620.977) -- 0:00:14
793500 -- (-622.680) (-621.661) (-620.376) [-620.289] * (-622.555) (-619.855) (-624.773) [-622.413] -- 0:00:14
794000 -- (-622.776) (-621.677) (-620.088) [-621.501] * (-622.265) (-620.183) [-621.622] (-619.900) -- 0:00:14
794500 -- [-622.087] (-621.963) (-619.423) (-622.222) * (-621.881) (-620.699) (-622.524) [-621.167] -- 0:00:14
795000 -- (-621.282) (-622.494) [-619.644] (-620.825) * (-620.353) (-622.336) (-619.523) [-618.525] -- 0:00:14
Average standard deviation of split frequencies: 0.009633
795500 -- (-621.205) (-620.777) [-619.603] (-620.878) * (-622.745) (-619.989) [-622.302] (-624.464) -- 0:00:14
796000 -- (-619.731) (-622.805) [-620.125] (-620.699) * (-622.714) [-624.496] (-619.432) (-627.493) -- 0:00:14
796500 -- [-620.888] (-622.470) (-620.504) (-621.001) * [-621.063] (-622.891) (-620.624) (-623.650) -- 0:00:14
797000 -- (-622.084) (-623.019) (-622.901) [-620.902] * (-619.570) (-625.426) [-619.440] (-620.414) -- 0:00:14
797500 -- [-621.904] (-621.862) (-622.003) (-620.481) * (-622.089) (-619.569) (-619.255) [-622.422] -- 0:00:14
798000 -- [-620.299] (-621.238) (-621.215) (-623.054) * (-623.038) (-621.464) (-620.319) [-620.242] -- 0:00:14
798500 -- (-623.785) (-629.667) [-621.135] (-622.019) * (-622.590) (-621.543) [-619.758] (-622.632) -- 0:00:14
799000 -- [-624.185] (-625.524) (-620.435) (-623.778) * (-622.665) [-622.435] (-630.273) (-623.727) -- 0:00:14
799500 -- (-622.924) (-621.044) (-622.398) [-620.797] * (-622.278) (-620.774) [-620.967] (-621.541) -- 0:00:14
800000 -- (-620.735) (-621.288) (-617.438) [-621.297] * [-619.125] (-620.661) (-623.387) (-621.881) -- 0:00:13
Average standard deviation of split frequencies: 0.009616
800500 -- (-621.516) [-621.607] (-621.143) (-619.926) * (-621.808) (-621.241) (-621.189) [-622.544] -- 0:00:13
801000 -- (-622.167) (-622.738) [-624.501] (-624.373) * [-621.513] (-620.435) (-619.101) (-626.055) -- 0:00:13
801500 -- (-620.541) (-623.011) [-619.048] (-622.364) * (-624.019) (-621.057) [-622.723] (-619.221) -- 0:00:13
802000 -- (-621.616) [-621.593] (-621.588) (-620.193) * (-621.403) (-621.730) [-622.638] (-621.354) -- 0:00:13
802500 -- (-622.214) (-622.045) [-619.067] (-623.502) * (-623.033) (-621.096) [-621.472] (-621.988) -- 0:00:13
803000 -- (-621.298) (-621.363) [-621.278] (-620.117) * (-618.933) [-623.255] (-624.877) (-619.536) -- 0:00:13
803500 -- (-621.414) (-621.627) (-621.866) [-619.729] * (-619.490) [-623.166] (-626.814) (-621.611) -- 0:00:13
804000 -- (-621.751) (-624.002) (-624.313) [-620.843] * (-622.245) (-622.350) (-628.264) [-621.503] -- 0:00:13
804500 -- (-621.421) (-623.226) (-621.247) [-623.219] * (-620.801) (-622.870) [-621.477] (-624.179) -- 0:00:13
805000 -- [-621.023] (-624.802) (-622.338) (-620.660) * [-620.748] (-625.949) (-621.475) (-625.059) -- 0:00:13
Average standard deviation of split frequencies: 0.009475
805500 -- (-622.382) (-627.820) (-621.814) [-623.297] * (-620.906) (-626.388) (-623.383) [-624.036] -- 0:00:13
806000 -- (-619.746) (-627.541) (-621.546) [-620.870] * (-619.807) (-623.154) [-620.406] (-620.734) -- 0:00:13
806500 -- (-623.316) (-623.172) [-620.618] (-624.326) * (-617.930) (-623.132) [-619.966] (-621.611) -- 0:00:13
807000 -- (-620.786) [-623.264] (-621.623) (-625.662) * (-620.849) (-622.418) (-621.377) [-618.971] -- 0:00:13
807500 -- (-623.321) (-622.269) (-621.321) [-623.206] * (-621.620) (-620.508) [-621.476] (-622.161) -- 0:00:13
808000 -- (-623.712) (-622.220) [-620.914] (-623.231) * [-620.318] (-620.218) (-621.072) (-621.563) -- 0:00:13
808500 -- (-625.736) (-621.571) (-620.047) [-621.233] * (-622.312) (-622.982) [-619.598] (-620.558) -- 0:00:13
809000 -- (-620.754) [-623.023] (-623.604) (-621.332) * [-621.468] (-621.935) (-621.467) (-624.091) -- 0:00:13
809500 -- (-621.332) [-622.247] (-621.334) (-627.019) * (-623.042) [-621.563] (-620.537) (-623.231) -- 0:00:13
810000 -- (-621.645) (-620.985) [-623.182] (-625.196) * (-620.563) (-620.351) [-620.366] (-622.474) -- 0:00:13
Average standard deviation of split frequencies: 0.009382
810500 -- (-620.158) (-623.440) (-620.933) [-621.811] * (-623.042) (-622.545) (-621.900) [-621.915] -- 0:00:13
811000 -- [-620.142] (-621.502) (-620.864) (-625.748) * (-624.718) (-620.268) [-620.315] (-621.986) -- 0:00:13
811500 -- (-618.857) (-622.601) [-618.541] (-628.031) * [-625.741] (-620.810) (-621.704) (-626.370) -- 0:00:13
812000 -- (-623.317) (-621.752) (-621.279) [-621.042] * (-622.014) (-621.512) [-618.565] (-621.022) -- 0:00:13
812500 -- [-620.172] (-622.406) (-621.850) (-623.366) * [-622.711] (-620.153) (-621.648) (-621.125) -- 0:00:13
813000 -- (-620.439) (-622.805) [-618.488] (-620.178) * (-619.532) [-619.597] (-620.135) (-620.942) -- 0:00:13
813500 -- (-621.623) (-622.656) (-620.341) [-620.590] * [-623.413] (-620.470) (-625.733) (-622.728) -- 0:00:13
814000 -- (-622.243) [-622.119] (-621.371) (-621.110) * (-625.418) (-619.548) [-619.945] (-618.112) -- 0:00:13
814500 -- [-619.276] (-621.984) (-621.535) (-622.081) * (-621.754) (-620.148) (-619.695) [-619.766] -- 0:00:12
815000 -- (-623.489) (-621.333) (-623.264) [-622.205] * (-620.666) (-622.185) (-621.218) [-623.265] -- 0:00:12
Average standard deviation of split frequencies: 0.009205
815500 -- (-622.284) (-622.453) (-621.119) [-620.026] * (-620.857) (-621.232) (-624.308) [-621.063] -- 0:00:12
816000 -- (-623.832) [-621.924] (-622.907) (-621.327) * [-621.676] (-620.921) (-617.550) (-620.753) -- 0:00:12
816500 -- (-621.460) (-623.047) [-623.064] (-623.340) * [-623.635] (-621.061) (-619.394) (-622.027) -- 0:00:12
817000 -- (-620.716) [-620.238] (-622.174) (-621.704) * [-620.833] (-622.739) (-619.850) (-622.372) -- 0:00:12
817500 -- [-622.402] (-623.402) (-621.431) (-621.110) * [-622.940] (-624.772) (-620.116) (-619.488) -- 0:00:12
818000 -- (-620.689) (-629.632) [-621.619] (-622.216) * (-623.978) (-620.398) (-619.540) [-621.451] -- 0:00:12
818500 -- (-620.842) (-623.265) [-621.896] (-622.351) * (-620.785) [-621.497] (-625.898) (-620.633) -- 0:00:12
819000 -- (-620.526) [-625.680] (-621.536) (-621.131) * (-621.213) (-626.311) (-619.998) [-622.181] -- 0:00:12
819500 -- (-621.446) [-620.054] (-623.193) (-622.856) * (-619.482) (-624.066) (-621.062) [-621.750] -- 0:00:12
820000 -- (-620.409) (-624.284) [-621.768] (-621.679) * (-619.825) (-624.205) (-619.424) [-620.824] -- 0:00:12
Average standard deviation of split frequencies: 0.009037
820500 -- (-621.657) (-621.171) (-620.783) [-621.725] * [-619.012] (-622.728) (-618.793) (-620.828) -- 0:00:12
821000 -- (-622.007) [-620.835] (-628.968) (-621.062) * [-620.157] (-621.040) (-625.060) (-619.551) -- 0:00:12
821500 -- (-620.113) [-620.636] (-620.874) (-621.619) * (-623.493) (-623.443) (-622.091) [-620.617] -- 0:00:12
822000 -- [-620.306] (-620.331) (-623.192) (-621.868) * (-620.182) [-623.356] (-622.055) (-626.724) -- 0:00:12
822500 -- (-625.242) (-621.811) [-620.284] (-620.834) * (-620.309) [-623.911] (-622.139) (-626.533) -- 0:00:12
823000 -- (-620.191) (-622.726) (-624.711) [-620.908] * [-619.293] (-619.606) (-623.169) (-620.636) -- 0:00:12
823500 -- (-622.775) [-620.357] (-621.750) (-620.907) * (-623.006) (-623.118) [-621.409] (-623.138) -- 0:00:12
824000 -- (-617.801) [-621.988] (-621.648) (-622.166) * (-621.574) [-620.731] (-621.024) (-621.565) -- 0:00:12
824500 -- (-619.801) (-622.106) (-620.494) [-624.540] * (-620.641) (-620.856) [-622.767] (-620.009) -- 0:00:12
825000 -- (-628.594) [-619.890] (-621.393) (-621.254) * (-625.720) (-621.772) (-620.884) [-620.219] -- 0:00:12
Average standard deviation of split frequencies: 0.008789
825500 -- (-622.572) (-620.743) (-621.471) [-622.010] * (-623.451) (-619.843) [-620.218] (-620.196) -- 0:00:12
826000 -- [-623.289] (-623.020) (-621.315) (-624.772) * (-621.543) (-619.768) (-618.082) [-619.382] -- 0:00:12
826500 -- (-619.738) [-623.186] (-622.744) (-620.654) * (-618.765) (-619.676) (-622.050) [-619.223] -- 0:00:12
827000 -- (-623.072) (-619.354) [-620.253] (-619.849) * (-620.665) (-620.042) (-621.230) [-620.002] -- 0:00:12
827500 -- (-623.705) [-621.580] (-619.324) (-622.380) * (-619.573) [-619.941] (-620.717) (-623.694) -- 0:00:12
828000 -- (-622.469) (-620.230) [-621.387] (-621.008) * (-619.805) (-623.533) (-621.426) [-620.139] -- 0:00:12
828500 -- (-624.627) (-622.545) (-619.123) [-619.092] * (-620.863) [-620.356] (-622.248) (-620.378) -- 0:00:12
829000 -- [-621.105] (-626.230) (-623.431) (-619.058) * [-620.787] (-617.933) (-621.700) (-623.065) -- 0:00:11
829500 -- (-620.877) [-621.454] (-621.499) (-629.467) * (-625.882) (-624.191) (-620.449) [-621.027] -- 0:00:11
830000 -- (-622.653) (-622.050) [-620.266] (-621.303) * (-620.686) [-619.956] (-619.638) (-622.130) -- 0:00:11
Average standard deviation of split frequencies: 0.008664
830500 -- [-622.055] (-621.091) (-620.273) (-626.413) * (-622.646) [-617.650] (-621.663) (-619.393) -- 0:00:11
831000 -- (-621.327) [-618.922] (-621.327) (-624.744) * (-621.986) (-624.976) [-621.134] (-619.862) -- 0:00:11
831500 -- (-620.967) (-621.013) (-621.045) [-621.636] * [-620.135] (-623.862) (-621.504) (-620.376) -- 0:00:11
832000 -- (-620.876) (-620.281) (-622.194) [-619.640] * (-623.145) [-622.619] (-621.825) (-619.529) -- 0:00:11
832500 -- [-624.949] (-621.142) (-622.314) (-621.518) * [-622.668] (-621.902) (-619.357) (-620.932) -- 0:00:11
833000 -- (-623.832) (-620.397) (-620.223) [-623.700] * (-621.836) [-621.632] (-624.771) (-622.756) -- 0:00:11
833500 -- [-621.390] (-618.909) (-624.988) (-628.053) * [-622.057] (-624.790) (-621.538) (-621.718) -- 0:00:11
834000 -- (-621.940) (-619.422) (-622.353) [-621.608] * (-624.812) (-621.163) (-620.944) [-619.268] -- 0:00:11
834500 -- (-620.955) (-623.946) (-624.236) [-623.080] * (-623.307) (-627.018) (-620.618) [-622.144] -- 0:00:11
835000 -- [-621.174] (-621.768) (-622.497) (-623.177) * (-621.826) (-620.271) (-620.190) [-619.983] -- 0:00:11
Average standard deviation of split frequencies: 0.008947
835500 -- [-621.496] (-622.658) (-620.786) (-626.273) * (-624.347) (-621.499) (-619.537) [-619.089] -- 0:00:11
836000 -- (-625.533) [-625.741] (-627.409) (-624.048) * (-622.774) (-623.395) (-620.409) [-620.990] -- 0:00:11
836500 -- (-627.944) (-624.366) [-620.571] (-620.250) * (-623.367) [-621.186] (-621.439) (-619.140) -- 0:00:11
837000 -- (-622.195) (-624.815) (-622.087) [-620.140] * (-623.505) (-621.178) (-620.989) [-620.516] -- 0:00:11
837500 -- (-621.676) [-625.188] (-623.282) (-625.678) * (-620.448) [-620.236] (-621.567) (-623.165) -- 0:00:11
838000 -- (-623.925) (-621.287) [-621.624] (-626.217) * (-619.563) [-619.681] (-625.765) (-620.878) -- 0:00:11
838500 -- (-623.919) (-624.078) [-621.740] (-623.902) * (-621.228) (-620.081) [-623.447] (-620.253) -- 0:00:11
839000 -- (-621.833) (-622.530) (-621.382) [-625.871] * (-621.513) (-620.526) [-624.135] (-622.898) -- 0:00:11
839500 -- (-621.512) (-621.708) [-621.681] (-626.105) * (-621.584) (-620.194) (-621.133) [-621.271] -- 0:00:11
840000 -- (-625.243) [-622.531] (-621.804) (-623.238) * (-622.956) [-620.638] (-622.558) (-621.023) -- 0:00:11
Average standard deviation of split frequencies: 0.009047
840500 -- (-625.967) [-622.599] (-621.193) (-626.768) * (-623.181) (-623.251) (-622.635) [-620.086] -- 0:00:11
841000 -- (-624.445) (-621.889) (-621.055) [-621.043] * (-620.001) (-619.176) (-622.516) [-620.284] -- 0:00:11
841500 -- [-622.058] (-621.081) (-620.982) (-620.757) * (-622.327) (-620.519) (-621.438) [-619.585] -- 0:00:11
842000 -- (-625.471) (-620.976) [-622.735] (-621.017) * [-622.477] (-620.836) (-622.909) (-621.531) -- 0:00:11
842500 -- (-621.749) (-622.022) (-622.547) [-620.834] * (-622.590) [-623.107] (-624.879) (-621.230) -- 0:00:11
843000 -- [-620.613] (-624.477) (-621.463) (-621.243) * [-620.657] (-622.381) (-620.779) (-621.001) -- 0:00:10
843500 -- (-620.901) (-618.926) (-622.527) [-620.463] * (-622.236) (-619.376) (-622.559) [-620.597] -- 0:00:10
844000 -- [-621.354] (-620.059) (-622.350) (-620.916) * (-621.948) [-620.936] (-621.917) (-623.199) -- 0:00:10
844500 -- (-623.107) (-620.446) [-620.115] (-621.773) * (-628.105) (-622.923) (-622.896) [-622.763] -- 0:00:10
845000 -- (-626.511) [-620.548] (-624.887) (-622.114) * (-629.366) [-620.878] (-619.672) (-622.023) -- 0:00:10
Average standard deviation of split frequencies: 0.009175
845500 -- (-625.488) [-621.499] (-621.551) (-622.524) * [-625.600] (-623.680) (-620.670) (-621.614) -- 0:00:10
846000 -- [-620.487] (-622.301) (-624.427) (-621.551) * [-620.328] (-620.393) (-622.416) (-621.414) -- 0:00:10
846500 -- [-623.647] (-623.436) (-621.025) (-625.265) * (-620.599) [-619.566] (-621.106) (-622.945) -- 0:00:10
847000 -- (-623.063) (-623.875) [-620.929] (-620.518) * (-622.622) (-621.934) (-625.150) [-620.662] -- 0:00:10
847500 -- [-622.878] (-621.906) (-622.413) (-621.675) * (-626.332) (-620.140) [-619.126] (-626.158) -- 0:00:10
848000 -- (-621.954) (-622.856) [-621.267] (-621.879) * (-624.164) (-620.647) (-618.893) [-620.972] -- 0:00:10
848500 -- (-619.582) (-624.845) [-625.073] (-622.010) * (-625.262) (-620.874) [-621.910] (-619.403) -- 0:00:10
849000 -- [-619.219] (-621.940) (-623.550) (-622.508) * [-621.500] (-622.829) (-620.557) (-620.440) -- 0:00:10
849500 -- (-621.017) [-620.895] (-621.001) (-623.623) * [-620.238] (-623.263) (-623.051) (-620.025) -- 0:00:10
850000 -- (-622.781) (-621.155) (-619.893) [-625.551] * (-623.781) (-620.719) [-620.023] (-621.787) -- 0:00:10
Average standard deviation of split frequencies: 0.009125
850500 -- (-620.264) [-620.753] (-624.284) (-620.755) * [-621.248] (-620.871) (-621.673) (-622.402) -- 0:00:10
851000 -- (-622.398) (-621.937) (-623.329) [-620.864] * [-620.982] (-622.749) (-620.362) (-620.211) -- 0:00:10
851500 -- (-624.754) (-621.775) [-620.613] (-620.565) * (-621.581) (-619.212) (-620.898) [-622.851] -- 0:00:10
852000 -- [-622.534] (-620.974) (-622.152) (-620.121) * (-620.396) [-619.368] (-621.465) (-620.944) -- 0:00:10
852500 -- (-621.316) [-623.530] (-623.363) (-619.875) * [-620.523] (-625.193) (-619.830) (-619.184) -- 0:00:10
853000 -- [-619.373] (-620.595) (-621.722) (-621.996) * [-619.484] (-622.288) (-619.116) (-626.025) -- 0:00:10
853500 -- (-621.636) (-620.547) (-619.976) [-620.422] * (-623.784) [-620.071] (-620.897) (-620.729) -- 0:00:10
854000 -- (-623.826) (-620.769) (-617.792) [-622.772] * (-621.862) [-621.610] (-625.088) (-620.856) -- 0:00:10
854500 -- (-619.898) (-620.511) (-625.435) [-622.944] * [-619.901] (-621.474) (-623.569) (-625.467) -- 0:00:10
855000 -- (-622.034) [-619.283] (-626.090) (-622.116) * [-619.733] (-623.172) (-621.938) (-623.943) -- 0:00:10
Average standard deviation of split frequencies: 0.009215
855500 -- (-622.548) (-621.153) (-622.215) [-627.721] * (-622.090) (-621.076) (-626.689) [-618.272] -- 0:00:10
856000 -- (-622.483) (-624.561) (-621.459) [-623.682] * (-623.101) (-621.177) (-621.903) [-621.256] -- 0:00:10
856500 -- (-620.633) (-624.143) [-620.169] (-629.415) * (-619.874) [-621.209] (-619.952) (-620.000) -- 0:00:10
857000 -- (-620.476) (-621.210) (-626.840) [-620.838] * (-619.741) (-621.368) (-622.644) [-624.839] -- 0:00:10
857500 -- (-620.912) (-627.033) [-622.942] (-626.402) * [-621.630] (-622.708) (-621.740) (-625.708) -- 0:00:09
858000 -- (-620.907) [-625.261] (-622.042) (-621.391) * (-622.495) [-623.843] (-620.165) (-619.583) -- 0:00:09
858500 -- (-621.508) (-624.861) [-624.820] (-626.423) * (-623.528) [-622.254] (-621.566) (-620.399) -- 0:00:09
859000 -- (-621.314) (-624.367) [-621.662] (-621.071) * [-621.683] (-620.284) (-619.614) (-621.335) -- 0:00:09
859500 -- (-619.355) [-626.172] (-620.634) (-621.224) * (-622.150) (-619.620) [-619.340] (-620.348) -- 0:00:09
860000 -- [-620.237] (-621.915) (-622.385) (-623.340) * (-622.919) [-621.168] (-620.806) (-619.208) -- 0:00:09
Average standard deviation of split frequencies: 0.009238
860500 -- [-620.704] (-622.191) (-621.386) (-619.679) * (-621.222) (-621.595) (-622.135) [-620.125] -- 0:00:09
861000 -- (-619.756) [-621.217] (-622.833) (-623.029) * (-629.915) (-620.649) [-621.052] (-620.756) -- 0:00:09
861500 -- (-620.230) [-622.922] (-623.389) (-618.832) * (-621.839) (-619.743) (-620.181) [-619.505] -- 0:00:09
862000 -- [-621.388] (-621.755) (-619.757) (-625.481) * [-621.664] (-623.292) (-621.605) (-620.245) -- 0:00:09
862500 -- (-622.257) [-623.762] (-619.991) (-625.016) * (-620.893) (-622.573) [-620.299] (-619.870) -- 0:00:09
863000 -- [-621.929] (-620.481) (-624.194) (-622.150) * (-621.707) (-620.360) (-621.989) [-622.082] -- 0:00:09
863500 -- (-621.073) (-621.847) (-621.542) [-619.465] * (-621.961) (-622.917) (-625.811) [-617.951] -- 0:00:09
864000 -- [-621.272] (-624.767) (-623.375) (-620.319) * [-621.711] (-623.637) (-619.689) (-618.297) -- 0:00:09
864500 -- (-623.107) (-625.053) [-625.096] (-624.941) * [-619.958] (-623.660) (-618.035) (-623.230) -- 0:00:09
865000 -- (-621.374) (-622.029) (-623.232) [-618.937] * (-624.572) (-621.122) [-619.921] (-619.507) -- 0:00:09
Average standard deviation of split frequencies: 0.009218
865500 -- (-621.670) (-623.896) [-620.109] (-620.232) * (-627.173) [-620.964] (-619.192) (-619.435) -- 0:00:09
866000 -- (-623.833) (-622.388) [-621.990] (-623.795) * (-621.594) [-619.421] (-620.402) (-621.477) -- 0:00:09
866500 -- (-621.498) [-621.622] (-621.749) (-620.207) * [-622.139] (-621.798) (-620.476) (-620.582) -- 0:00:09
867000 -- (-620.040) (-623.403) (-623.624) [-621.169] * (-621.044) (-621.567) (-620.091) [-621.835] -- 0:00:09
867500 -- (-621.091) [-621.528] (-622.237) (-619.563) * [-624.849] (-625.055) (-620.564) (-620.583) -- 0:00:09
868000 -- (-620.466) (-624.231) (-617.928) [-620.120] * (-622.693) (-620.885) [-622.679] (-619.983) -- 0:00:09
868500 -- [-622.443] (-624.466) (-620.293) (-620.909) * (-621.206) (-618.847) [-620.484] (-621.647) -- 0:00:09
869000 -- (-620.532) (-624.764) (-620.362) [-618.295] * (-620.339) (-621.271) [-622.329] (-622.503) -- 0:00:09
869500 -- (-620.841) (-620.127) [-620.849] (-620.040) * [-619.094] (-620.666) (-621.164) (-623.543) -- 0:00:09
870000 -- (-621.774) (-622.749) (-622.513) [-619.437] * [-621.793] (-623.984) (-619.259) (-623.526) -- 0:00:09
Average standard deviation of split frequencies: 0.008591
870500 -- [-622.661] (-624.615) (-620.125) (-622.772) * (-620.674) (-623.671) [-623.139] (-619.855) -- 0:00:09
871000 -- (-620.141) [-622.852] (-624.228) (-622.323) * (-621.391) (-623.770) [-624.317] (-620.839) -- 0:00:09
871500 -- (-623.547) [-623.231] (-621.353) (-621.085) * [-621.704] (-626.146) (-620.697) (-621.914) -- 0:00:08
872000 -- (-620.709) [-619.033] (-621.498) (-622.906) * [-620.195] (-621.567) (-621.050) (-618.906) -- 0:00:08
872500 -- (-620.658) [-621.329] (-621.287) (-621.445) * [-621.453] (-618.293) (-620.350) (-622.483) -- 0:00:08
873000 -- (-618.657) [-619.603] (-620.764) (-621.019) * (-620.184) [-622.560] (-621.978) (-625.146) -- 0:00:08
873500 -- (-621.805) (-618.884) [-620.133] (-621.394) * (-620.259) (-621.565) (-620.683) [-621.461] -- 0:00:08
874000 -- [-620.622] (-622.165) (-621.811) (-619.437) * (-618.725) (-619.510) [-621.960] (-621.044) -- 0:00:08
874500 -- (-621.267) (-624.609) (-622.476) [-619.849] * (-620.507) [-619.423] (-623.394) (-619.423) -- 0:00:08
875000 -- (-623.241) [-620.095] (-622.630) (-624.114) * (-620.430) (-621.004) [-621.714] (-622.590) -- 0:00:08
Average standard deviation of split frequencies: 0.008646
875500 -- (-621.032) (-619.026) (-620.425) [-619.624] * [-619.546] (-620.368) (-630.921) (-622.273) -- 0:00:08
876000 -- (-619.164) (-623.143) [-619.903] (-623.992) * [-621.393] (-620.621) (-628.802) (-619.680) -- 0:00:08
876500 -- [-620.457] (-623.098) (-620.313) (-618.670) * (-624.095) (-621.333) (-625.168) [-620.342] -- 0:00:08
877000 -- (-622.235) [-625.246] (-620.954) (-622.695) * (-623.070) [-620.151] (-624.912) (-620.338) -- 0:00:08
877500 -- (-625.589) (-622.528) [-620.244] (-622.671) * [-621.663] (-619.507) (-621.296) (-621.383) -- 0:00:08
878000 -- [-620.087] (-622.077) (-622.490) (-624.119) * (-625.215) (-624.461) (-621.274) [-623.799] -- 0:00:08
878500 -- (-621.764) [-620.346] (-621.218) (-622.795) * (-624.238) (-622.336) [-620.146] (-621.342) -- 0:00:08
879000 -- (-620.113) (-623.674) (-622.683) [-623.667] * (-624.278) [-624.317] (-619.636) (-623.003) -- 0:00:08
879500 -- (-622.574) (-621.908) [-622.216] (-620.692) * [-620.389] (-622.228) (-619.091) (-623.212) -- 0:00:08
880000 -- (-620.530) (-622.033) (-621.709) [-622.559] * [-620.599] (-619.865) (-621.712) (-621.231) -- 0:00:08
Average standard deviation of split frequencies: 0.008386
880500 -- [-623.241] (-619.030) (-622.704) (-620.909) * (-622.061) [-621.174] (-621.289) (-625.753) -- 0:00:08
881000 -- [-620.726] (-623.009) (-628.352) (-621.843) * [-624.029] (-618.550) (-629.325) (-622.359) -- 0:00:08
881500 -- (-626.755) (-627.616) (-622.404) [-620.664] * [-622.800] (-622.243) (-622.736) (-622.752) -- 0:00:08
882000 -- (-626.261) (-625.245) [-623.483] (-622.381) * (-620.688) (-619.339) (-622.099) [-621.114] -- 0:00:08
882500 -- (-621.365) [-619.265] (-622.818) (-618.901) * (-621.048) (-620.051) (-622.192) [-621.281] -- 0:00:08
883000 -- [-623.291] (-620.092) (-619.609) (-623.863) * [-623.471] (-622.076) (-621.008) (-622.156) -- 0:00:08
883500 -- (-622.396) [-621.511] (-620.256) (-621.655) * (-623.603) (-623.022) (-618.665) [-621.212] -- 0:00:08
884000 -- (-621.214) (-624.829) (-621.590) [-619.313] * (-623.595) [-622.944] (-620.059) (-619.830) -- 0:00:08
884500 -- (-621.197) (-622.092) [-620.228] (-620.916) * (-623.338) [-620.549] (-620.865) (-620.428) -- 0:00:08
885000 -- (-624.274) [-621.774] (-624.735) (-621.594) * (-621.972) (-621.267) [-620.184] (-628.861) -- 0:00:08
Average standard deviation of split frequencies: 0.008407
885500 -- (-620.614) (-622.966) (-621.799) [-620.353] * (-620.469) (-619.480) (-622.190) [-621.926] -- 0:00:08
886000 -- (-622.347) [-619.492] (-622.677) (-619.973) * (-619.256) [-621.022] (-623.827) (-622.944) -- 0:00:07
886500 -- (-620.238) [-619.681] (-620.031) (-621.864) * (-624.552) [-619.557] (-619.672) (-621.567) -- 0:00:07
887000 -- (-620.775) (-619.476) (-623.447) [-621.645] * (-620.334) (-620.872) [-618.624] (-620.484) -- 0:00:07
887500 -- (-622.070) (-620.553) [-623.433] (-619.779) * (-621.215) (-622.199) [-620.882] (-619.547) -- 0:00:07
888000 -- (-619.910) [-621.919] (-620.633) (-624.309) * (-620.697) [-618.653] (-626.323) (-622.041) -- 0:00:07
888500 -- (-621.235) (-626.574) (-620.250) [-623.408] * [-620.688] (-621.872) (-621.600) (-623.063) -- 0:00:07
889000 -- (-621.800) (-621.229) [-622.110] (-620.786) * (-621.198) (-621.191) [-619.213] (-621.832) -- 0:00:07
889500 -- (-623.819) [-620.303] (-620.343) (-620.068) * (-622.932) (-621.831) [-620.906] (-620.319) -- 0:00:07
890000 -- (-620.319) (-621.707) [-618.524] (-620.934) * [-621.280] (-624.132) (-618.677) (-619.483) -- 0:00:07
Average standard deviation of split frequencies: 0.008504
890500 -- (-620.400) (-620.328) (-623.371) [-621.117] * [-620.473] (-621.397) (-620.479) (-621.083) -- 0:00:07
891000 -- (-621.452) (-620.905) [-622.226] (-621.118) * (-623.208) [-622.056] (-620.712) (-621.782) -- 0:00:07
891500 -- [-621.120] (-620.236) (-622.429) (-621.656) * [-620.743] (-622.915) (-622.665) (-621.380) -- 0:00:07
892000 -- (-621.059) (-619.327) [-622.065] (-618.761) * [-621.083] (-622.295) (-620.673) (-620.875) -- 0:00:07
892500 -- (-622.832) [-620.872] (-622.090) (-623.186) * [-621.124] (-624.718) (-621.436) (-624.297) -- 0:00:07
893000 -- (-621.875) (-622.008) (-620.448) [-623.125] * [-619.913] (-620.029) (-621.863) (-620.931) -- 0:00:07
893500 -- (-623.352) (-622.921) (-621.782) [-624.773] * [-620.146] (-624.579) (-621.009) (-625.085) -- 0:00:07
894000 -- [-624.601] (-621.482) (-620.547) (-623.300) * (-620.347) (-621.408) [-623.103] (-621.448) -- 0:00:07
894500 -- (-623.634) [-622.624] (-619.873) (-619.835) * (-620.620) [-619.964] (-626.626) (-621.873) -- 0:00:07
895000 -- (-621.200) (-621.384) [-623.471] (-621.528) * (-619.127) (-620.353) [-625.102] (-624.035) -- 0:00:07
Average standard deviation of split frequencies: 0.008628
895500 -- (-622.898) (-622.342) (-622.805) [-624.682] * (-625.669) [-620.874] (-624.099) (-621.820) -- 0:00:07
896000 -- (-625.450) (-622.236) (-623.551) [-621.690] * [-622.305] (-625.435) (-622.645) (-622.431) -- 0:00:07
896500 -- (-621.899) (-622.442) [-623.208] (-623.549) * (-620.140) [-621.080] (-620.769) (-619.076) -- 0:00:07
897000 -- (-623.170) [-623.337] (-625.925) (-623.984) * (-619.310) (-619.388) (-622.625) [-619.611] -- 0:00:07
897500 -- (-622.804) [-620.272] (-622.489) (-619.713) * (-622.095) (-621.170) [-622.640] (-619.373) -- 0:00:07
898000 -- (-622.224) [-620.924] (-624.157) (-623.204) * (-621.388) (-620.223) [-624.220] (-623.543) -- 0:00:07
898500 -- (-626.054) (-620.816) [-621.637] (-624.200) * [-621.058] (-618.781) (-621.017) (-618.669) -- 0:00:07
899000 -- (-619.040) (-618.354) (-621.410) [-619.527] * (-620.762) [-623.336] (-618.994) (-619.018) -- 0:00:07
899500 -- [-622.154] (-622.550) (-621.332) (-620.499) * (-620.455) (-622.884) (-619.892) [-620.965] -- 0:00:07
900000 -- (-619.843) [-620.525] (-620.689) (-619.897) * (-622.188) (-619.731) [-621.854] (-620.259) -- 0:00:06
Average standard deviation of split frequencies: 0.009002
900500 -- (-621.294) (-624.363) [-620.778] (-623.239) * [-626.937] (-622.608) (-621.480) (-621.977) -- 0:00:06
901000 -- (-620.406) (-625.644) [-619.476] (-621.913) * (-624.973) (-624.731) [-619.948] (-624.083) -- 0:00:06
901500 -- (-620.064) (-622.878) [-620.778] (-622.401) * (-622.073) (-621.682) [-622.290] (-624.112) -- 0:00:06
902000 -- (-620.104) [-622.002] (-628.066) (-621.103) * (-622.974) (-623.579) [-621.750] (-623.343) -- 0:00:06
902500 -- (-622.352) [-622.194] (-623.751) (-625.932) * (-622.822) (-620.021) [-622.036] (-622.454) -- 0:00:06
903000 -- (-619.900) (-619.248) (-622.091) [-622.189] * (-621.346) (-620.347) [-621.984] (-623.442) -- 0:00:06
903500 -- [-621.096] (-621.127) (-623.850) (-620.667) * [-622.864] (-622.971) (-621.692) (-623.329) -- 0:00:06
904000 -- [-620.761] (-624.619) (-627.623) (-622.557) * (-621.012) (-620.961) [-622.607] (-622.943) -- 0:00:06
904500 -- (-619.202) [-618.490] (-629.205) (-621.257) * [-621.739] (-619.500) (-622.844) (-625.550) -- 0:00:06
905000 -- [-623.638] (-620.820) (-622.902) (-620.547) * (-618.695) (-622.043) (-622.415) [-620.160] -- 0:00:06
Average standard deviation of split frequencies: 0.008603
905500 -- [-622.768] (-621.993) (-622.023) (-621.495) * (-622.100) (-623.490) (-621.084) [-624.116] -- 0:00:06
906000 -- (-620.293) (-621.183) (-621.104) [-623.014] * (-621.852) (-626.013) [-621.055] (-620.676) -- 0:00:06
906500 -- (-621.067) (-621.452) (-623.274) [-623.302] * [-620.079] (-625.654) (-619.686) (-621.989) -- 0:00:06
907000 -- (-620.448) (-621.304) (-625.533) [-622.198] * [-620.563] (-624.643) (-620.213) (-624.786) -- 0:00:06
907500 -- (-621.247) (-620.189) [-623.495] (-622.262) * (-622.471) (-621.888) (-623.044) [-626.356] -- 0:00:06
908000 -- (-622.116) (-621.143) (-620.417) [-621.910] * (-622.520) (-622.858) (-619.891) [-624.759] -- 0:00:06
908500 -- [-621.285] (-622.001) (-621.020) (-620.624) * (-621.421) [-621.750] (-622.061) (-623.911) -- 0:00:06
909000 -- (-619.977) (-621.843) (-622.077) [-622.503] * (-622.797) (-620.335) (-621.332) [-622.555] -- 0:00:06
909500 -- (-623.665) (-620.940) [-621.212] (-620.859) * (-622.044) [-622.161] (-622.819) (-623.535) -- 0:00:06
910000 -- (-625.439) [-629.032] (-621.267) (-622.554) * (-624.293) (-620.148) (-623.776) [-620.829] -- 0:00:06
Average standard deviation of split frequencies: 0.008731
910500 -- (-619.249) (-625.236) [-620.563] (-622.134) * (-620.687) [-620.359] (-622.327) (-622.287) -- 0:00:06
911000 -- [-621.247] (-622.737) (-620.424) (-621.755) * (-624.465) [-621.323] (-620.950) (-620.192) -- 0:00:06
911500 -- (-619.841) (-622.480) [-621.847] (-623.288) * (-623.934) (-620.929) (-619.896) [-620.565] -- 0:00:06
912000 -- (-620.055) [-621.291] (-621.975) (-620.197) * (-620.047) [-623.172] (-619.662) (-622.944) -- 0:00:06
912500 -- (-621.304) (-623.821) (-620.958) [-620.193] * (-620.693) [-624.065] (-623.359) (-622.009) -- 0:00:06
913000 -- (-622.460) (-623.497) (-622.763) [-619.791] * (-621.521) [-623.781] (-623.092) (-621.080) -- 0:00:06
913500 -- (-625.256) (-625.188) [-620.695] (-618.739) * (-623.019) [-623.658] (-621.797) (-622.784) -- 0:00:06
914000 -- [-622.883] (-623.373) (-621.433) (-621.140) * [-621.150] (-622.696) (-620.846) (-622.411) -- 0:00:06
914500 -- [-621.678] (-620.593) (-622.037) (-618.228) * (-622.008) [-626.184] (-620.495) (-626.664) -- 0:00:05
915000 -- (-621.344) (-627.554) (-619.320) [-621.681] * (-626.139) [-621.850] (-622.007) (-621.421) -- 0:00:05
Average standard deviation of split frequencies: 0.008920
915500 -- (-621.632) (-621.833) (-621.557) [-622.326] * (-625.083) (-621.552) [-620.865] (-620.152) -- 0:00:05
916000 -- (-622.889) (-624.486) (-619.993) [-622.715] * (-620.062) [-618.968] (-621.006) (-621.366) -- 0:00:05
916500 -- (-624.494) (-621.243) [-620.014] (-622.064) * [-621.496] (-618.810) (-621.844) (-625.894) -- 0:00:05
917000 -- (-621.788) [-622.857] (-619.968) (-618.925) * (-625.958) (-620.971) [-623.886] (-623.256) -- 0:00:05
917500 -- (-622.261) (-622.545) (-620.039) [-618.545] * [-623.288] (-618.563) (-621.351) (-621.769) -- 0:00:05
918000 -- (-621.109) (-621.928) (-621.973) [-619.671] * [-622.323] (-621.521) (-623.571) (-618.912) -- 0:00:05
918500 -- (-621.885) (-620.514) (-621.181) [-620.874] * (-620.301) (-620.083) [-622.931] (-620.035) -- 0:00:05
919000 -- (-621.928) (-621.362) [-620.562] (-621.235) * [-620.973] (-619.295) (-626.230) (-619.250) -- 0:00:05
919500 -- (-620.896) [-624.556] (-621.836) (-623.758) * (-619.443) (-625.576) [-621.136] (-619.123) -- 0:00:05
920000 -- (-624.895) (-620.827) [-620.099] (-620.385) * [-620.193] (-627.368) (-629.102) (-623.914) -- 0:00:05
Average standard deviation of split frequencies: 0.009216
920500 -- (-621.846) (-622.624) [-624.280] (-621.933) * [-620.766] (-623.146) (-621.664) (-623.345) -- 0:00:05
921000 -- [-621.093] (-621.743) (-630.148) (-624.454) * (-623.054) (-622.029) [-621.756] (-625.122) -- 0:00:05
921500 -- [-619.801] (-621.604) (-625.771) (-620.376) * (-620.908) (-620.271) [-622.215] (-627.006) -- 0:00:05
922000 -- (-627.183) (-621.059) (-623.951) [-620.836] * [-619.553] (-619.920) (-622.723) (-627.539) -- 0:00:05
922500 -- (-623.273) (-618.833) (-623.190) [-620.469] * (-621.096) (-625.223) [-619.028] (-628.110) -- 0:00:05
923000 -- (-624.366) (-621.449) [-621.649] (-620.745) * (-619.084) (-621.673) [-620.653] (-619.735) -- 0:00:05
923500 -- (-624.524) [-621.156] (-620.078) (-620.215) * (-620.694) (-622.343) [-621.251] (-622.269) -- 0:00:05
924000 -- [-624.496] (-622.869) (-621.640) (-622.175) * (-620.723) [-622.303] (-621.876) (-624.830) -- 0:00:05
924500 -- (-620.575) (-620.807) [-620.155] (-620.792) * [-624.131] (-622.712) (-624.083) (-626.705) -- 0:00:05
925000 -- (-622.403) [-621.001] (-625.497) (-620.256) * (-622.553) (-622.767) [-622.764] (-622.918) -- 0:00:05
Average standard deviation of split frequencies: 0.009095
925500 -- (-620.674) (-622.658) [-623.257] (-619.850) * (-624.176) (-621.558) (-621.315) [-619.138] -- 0:00:05
926000 -- (-620.783) [-623.333] (-621.554) (-623.596) * (-619.899) (-622.461) [-622.406] (-620.011) -- 0:00:05
926500 -- (-620.316) (-624.571) [-621.549] (-626.095) * (-619.618) (-622.482) [-626.804] (-621.673) -- 0:00:05
927000 -- (-620.876) (-626.190) [-622.400] (-622.533) * (-618.628) (-625.153) [-621.850] (-620.144) -- 0:00:05
927500 -- (-622.635) (-621.961) (-625.580) [-622.577] * [-623.094] (-624.710) (-619.850) (-621.576) -- 0:00:05
928000 -- (-624.494) [-621.490] (-622.757) (-621.408) * (-622.415) [-623.435] (-621.516) (-620.223) -- 0:00:05
928500 -- (-622.234) [-619.491] (-623.742) (-623.636) * (-621.158) (-622.287) (-626.282) [-620.952] -- 0:00:05
929000 -- (-620.998) (-619.191) [-623.189] (-620.051) * (-621.016) (-623.998) (-620.931) [-623.072] -- 0:00:04
929500 -- (-619.398) (-620.403) (-625.943) [-619.619] * (-622.083) (-621.286) (-621.819) [-623.611] -- 0:00:04
930000 -- (-622.049) [-622.001] (-622.122) (-624.328) * (-623.268) (-620.325) [-621.901] (-620.345) -- 0:00:04
Average standard deviation of split frequencies: 0.008982
930500 -- [-621.892] (-624.200) (-623.289) (-622.881) * (-623.061) (-620.725) (-620.679) [-620.780] -- 0:00:04
931000 -- [-619.535] (-626.953) (-623.334) (-624.138) * [-623.513] (-621.389) (-618.903) (-621.326) -- 0:00:04
931500 -- (-619.149) (-627.478) (-622.402) [-620.463] * (-622.778) (-620.781) [-620.676] (-621.795) -- 0:00:04
932000 -- (-619.981) [-625.766] (-621.353) (-621.858) * (-620.651) (-621.540) (-621.546) [-623.740] -- 0:00:04
932500 -- [-623.400] (-622.593) (-621.644) (-620.111) * (-622.965) (-621.288) [-626.066] (-622.357) -- 0:00:04
933000 -- (-621.812) (-622.229) (-621.658) [-620.051] * (-620.534) [-619.812] (-622.909) (-622.804) -- 0:00:04
933500 -- (-619.400) (-620.799) [-624.694] (-618.917) * (-620.872) (-622.201) (-622.475) [-621.231] -- 0:00:04
934000 -- (-619.906) (-626.148) [-623.952] (-621.672) * (-621.835) [-622.558] (-621.895) (-624.769) -- 0:00:04
934500 -- (-624.450) (-624.401) (-624.068) [-621.749] * (-621.518) (-620.088) [-618.712] (-621.743) -- 0:00:04
935000 -- (-621.224) (-623.631) (-621.046) [-620.596] * (-622.191) (-621.657) [-620.736] (-621.509) -- 0:00:04
Average standard deviation of split frequencies: 0.008528
935500 -- (-621.293) (-622.869) (-623.094) [-618.743] * (-624.538) (-623.146) [-620.403] (-622.997) -- 0:00:04
936000 -- (-619.359) (-619.882) (-621.657) [-619.147] * (-621.725) (-625.132) [-621.616] (-621.027) -- 0:00:04
936500 -- (-620.803) (-621.312) (-621.050) [-619.713] * (-622.943) (-621.188) [-621.790] (-621.877) -- 0:00:04
937000 -- (-621.761) (-621.092) (-621.295) [-622.538] * (-620.333) (-621.633) (-622.783) [-621.074] -- 0:00:04
937500 -- (-620.833) (-622.417) (-623.447) [-620.235] * (-619.513) (-621.164) (-620.413) [-622.296] -- 0:00:04
938000 -- (-619.847) (-623.807) (-622.319) [-624.872] * (-621.262) [-620.889] (-621.270) (-620.524) -- 0:00:04
938500 -- (-621.306) (-620.274) [-620.564] (-620.735) * (-621.351) [-619.241] (-619.160) (-625.685) -- 0:00:04
939000 -- (-622.898) [-619.361] (-621.385) (-622.150) * (-621.697) (-620.611) [-619.058] (-621.540) -- 0:00:04
939500 -- (-620.465) (-619.264) (-621.898) [-618.789] * (-620.779) (-621.719) (-620.922) [-621.792] -- 0:00:04
940000 -- [-621.256] (-621.985) (-619.978) (-624.424) * (-620.048) [-622.611] (-621.053) (-620.428) -- 0:00:04
Average standard deviation of split frequencies: 0.008152
940500 -- (-619.715) (-620.949) [-625.400] (-621.068) * (-623.288) (-623.139) (-622.083) [-621.025] -- 0:00:04
941000 -- (-623.667) (-619.450) (-619.921) [-619.737] * (-620.937) [-621.852] (-620.058) (-621.703) -- 0:00:04
941500 -- [-621.695] (-619.105) (-622.736) (-624.031) * (-620.429) (-624.111) (-621.706) [-624.482] -- 0:00:04
942000 -- (-623.660) [-622.145] (-621.007) (-622.293) * (-621.591) [-622.132] (-621.602) (-618.696) -- 0:00:04
942500 -- (-624.473) (-619.901) [-622.953] (-620.015) * (-625.564) (-621.473) [-620.999] (-625.241) -- 0:00:04
943000 -- (-623.824) [-619.512] (-622.803) (-622.191) * (-624.140) (-622.204) [-619.534] (-623.855) -- 0:00:03
943500 -- (-623.861) [-622.771] (-621.259) (-622.646) * (-619.135) [-620.148] (-621.282) (-620.820) -- 0:00:03
944000 -- (-621.020) (-624.419) [-619.427] (-621.011) * (-622.777) [-622.484] (-621.046) (-620.506) -- 0:00:03
944500 -- (-622.050) (-621.025) [-622.033] (-621.214) * [-622.466] (-623.725) (-619.913) (-622.462) -- 0:00:03
945000 -- [-623.015] (-622.376) (-621.278) (-622.544) * (-620.068) (-621.744) (-619.402) [-621.365] -- 0:00:03
Average standard deviation of split frequencies: 0.008538
945500 -- (-619.555) (-621.611) [-620.322] (-621.855) * (-621.780) (-621.961) (-622.278) [-620.352] -- 0:00:03
946000 -- (-620.780) (-620.790) (-623.134) [-619.486] * (-620.471) [-622.217] (-620.726) (-620.217) -- 0:00:03
946500 -- [-620.719] (-622.123) (-621.111) (-621.066) * (-622.371) (-621.912) (-620.347) [-621.656] -- 0:00:03
947000 -- [-620.680] (-625.165) (-620.810) (-620.455) * [-623.157] (-622.123) (-621.540) (-624.764) -- 0:00:03
947500 -- (-626.377) (-626.338) (-623.091) [-620.987] * [-621.298] (-621.241) (-619.203) (-620.937) -- 0:00:03
948000 -- (-620.222) [-619.926] (-621.919) (-620.744) * (-620.826) (-621.032) (-621.266) [-620.987] -- 0:00:03
948500 -- (-625.168) [-620.497] (-620.694) (-622.350) * [-622.126] (-622.000) (-621.970) (-623.154) -- 0:00:03
949000 -- (-621.824) [-621.636] (-620.966) (-621.127) * (-619.331) (-618.173) (-621.093) [-624.005] -- 0:00:03
949500 -- (-622.508) (-619.428) (-622.043) [-621.065] * (-622.457) [-623.355] (-622.263) (-620.581) -- 0:00:03
950000 -- (-622.873) [-620.189] (-621.457) (-625.341) * (-619.919) (-621.259) [-619.498] (-620.162) -- 0:00:03
Average standard deviation of split frequencies: 0.008562
950500 -- (-622.397) (-618.544) (-622.933) [-621.193] * (-621.375) [-620.943] (-624.499) (-619.080) -- 0:00:03
951000 -- [-621.169] (-620.957) (-626.858) (-626.575) * (-621.320) [-620.463] (-622.136) (-620.311) -- 0:00:03
951500 -- (-621.585) [-625.147] (-622.335) (-622.306) * (-621.351) (-623.479) (-620.511) [-619.487] -- 0:00:03
952000 -- (-624.560) (-626.096) [-624.351] (-619.627) * [-622.682] (-620.392) (-619.606) (-621.688) -- 0:00:03
952500 -- [-622.350] (-625.353) (-624.294) (-620.477) * (-623.341) (-618.754) (-620.809) [-621.018] -- 0:00:03
953000 -- (-620.069) (-624.704) (-621.701) [-628.881] * (-622.897) [-621.482] (-620.426) (-621.539) -- 0:00:03
953500 -- [-620.278] (-622.907) (-621.074) (-621.217) * [-618.833] (-621.597) (-622.512) (-626.299) -- 0:00:03
954000 -- (-622.506) (-620.584) (-621.657) [-623.570] * (-622.239) (-619.722) (-620.516) [-623.011] -- 0:00:03
954500 -- (-620.413) [-623.060] (-623.330) (-620.215) * (-622.660) [-621.295] (-624.596) (-620.904) -- 0:00:03
955000 -- (-621.613) [-618.256] (-622.944) (-623.550) * (-622.073) (-618.928) [-625.256] (-622.069) -- 0:00:03
Average standard deviation of split frequencies: 0.008580
955500 -- (-621.620) (-619.826) (-624.391) [-620.553] * [-620.355] (-618.907) (-623.937) (-620.089) -- 0:00:03
956000 -- (-623.127) [-619.955] (-625.973) (-620.797) * [-622.921] (-621.767) (-622.014) (-620.803) -- 0:00:03
956500 -- (-621.675) (-620.548) (-620.797) [-620.123] * [-620.996] (-619.891) (-620.637) (-622.788) -- 0:00:03
957000 -- (-620.903) (-621.020) (-620.336) [-619.635] * (-622.139) (-622.296) (-621.204) [-620.933] -- 0:00:03
957500 -- [-621.019] (-623.449) (-621.754) (-620.624) * [-619.924] (-622.132) (-625.442) (-622.116) -- 0:00:02
958000 -- (-622.209) (-621.356) [-623.210] (-621.875) * [-620.930] (-627.577) (-622.395) (-623.523) -- 0:00:02
958500 -- (-620.759) (-620.274) (-621.080) [-621.793] * (-622.657) (-623.332) (-620.143) [-619.501] -- 0:00:02
959000 -- (-620.632) (-623.539) [-619.602] (-621.543) * (-619.821) (-623.959) (-621.230) [-620.038] -- 0:00:02
959500 -- [-620.784] (-621.839) (-620.637) (-620.365) * (-619.458) (-622.774) (-621.414) [-621.597] -- 0:00:02
960000 -- (-621.811) [-624.044] (-620.401) (-621.544) * (-619.795) [-620.226] (-625.268) (-623.333) -- 0:00:02
Average standard deviation of split frequencies: 0.008636
960500 -- (-622.122) (-619.705) (-621.043) [-618.998] * (-620.087) [-621.724] (-620.645) (-619.528) -- 0:00:02
961000 -- (-621.987) [-619.311] (-624.041) (-621.343) * (-622.428) (-623.544) [-621.137] (-622.802) -- 0:00:02
961500 -- [-618.734] (-620.635) (-621.974) (-621.186) * (-622.084) [-623.310] (-622.557) (-620.629) -- 0:00:02
962000 -- [-620.858] (-620.564) (-628.575) (-621.156) * (-623.819) (-624.379) [-621.878] (-621.649) -- 0:00:02
962500 -- [-620.588] (-621.046) (-624.135) (-622.514) * (-620.565) (-621.760) [-618.814] (-623.545) -- 0:00:02
963000 -- (-621.453) (-619.661) (-619.711) [-620.856] * (-622.422) (-622.207) [-620.814] (-621.745) -- 0:00:02
963500 -- [-621.035] (-621.584) (-620.818) (-621.710) * [-619.746] (-627.527) (-622.713) (-623.524) -- 0:00:02
964000 -- [-626.358] (-623.884) (-619.759) (-627.966) * (-621.268) [-624.001] (-619.468) (-621.655) -- 0:00:02
964500 -- [-621.664] (-621.788) (-619.315) (-628.575) * (-621.334) (-628.786) (-619.975) [-624.534] -- 0:00:02
965000 -- (-620.066) (-620.269) (-621.431) [-626.950] * (-622.253) (-621.568) (-619.893) [-622.449] -- 0:00:02
Average standard deviation of split frequencies: 0.008654
965500 -- (-621.804) [-621.136] (-622.448) (-621.293) * [-621.880] (-622.015) (-630.060) (-622.677) -- 0:00:02
966000 -- (-621.734) (-622.011) [-619.740] (-622.437) * (-622.330) [-622.175] (-623.115) (-625.687) -- 0:00:02
966500 -- (-621.794) [-620.898] (-620.110) (-622.057) * [-621.442] (-622.027) (-620.079) (-620.347) -- 0:00:02
967000 -- (-619.066) (-620.033) [-619.787] (-619.544) * (-621.711) (-621.801) (-621.057) [-620.568] -- 0:00:02
967500 -- [-620.521] (-621.589) (-625.736) (-623.449) * (-621.889) (-623.854) [-620.596] (-619.194) -- 0:00:02
968000 -- (-621.488) (-622.831) [-623.474] (-623.741) * (-624.985) [-625.914] (-624.330) (-624.953) -- 0:00:02
968500 -- [-622.814] (-620.693) (-620.081) (-621.846) * (-626.264) [-620.955] (-622.155) (-626.263) -- 0:00:02
969000 -- [-622.655] (-621.630) (-620.999) (-619.022) * [-622.158] (-623.954) (-623.180) (-618.765) -- 0:00:02
969500 -- (-620.464) (-627.015) (-624.010) [-622.131] * (-623.152) (-621.057) [-619.610] (-620.234) -- 0:00:02
970000 -- (-620.078) [-620.651] (-619.300) (-624.397) * (-624.643) (-621.298) [-619.581] (-619.443) -- 0:00:02
Average standard deviation of split frequencies: 0.008159
970500 -- [-619.784] (-624.947) (-620.073) (-621.577) * [-621.594] (-622.760) (-620.631) (-619.101) -- 0:00:02
971000 -- [-623.389] (-620.340) (-623.642) (-619.592) * (-621.174) (-621.564) [-620.568] (-619.976) -- 0:00:02
971500 -- (-620.484) (-620.799) (-624.314) [-620.579] * (-621.600) [-621.043] (-621.045) (-623.289) -- 0:00:01
972000 -- (-622.855) [-621.025] (-620.149) (-623.221) * (-620.417) (-620.402) (-620.666) [-617.309] -- 0:00:01
972500 -- (-622.192) (-620.544) [-617.828] (-620.928) * (-621.212) [-620.465] (-621.635) (-619.727) -- 0:00:01
973000 -- (-621.399) (-621.915) [-618.764] (-621.896) * (-626.331) (-622.622) [-623.907] (-620.965) -- 0:00:01
973500 -- (-623.067) (-622.602) (-619.652) [-620.894] * (-625.431) (-621.926) [-620.392] (-619.728) -- 0:00:01
974000 -- (-621.562) (-622.043) [-619.729] (-624.687) * (-620.589) [-621.108] (-621.689) (-619.048) -- 0:00:01
974500 -- (-621.255) [-619.712] (-621.237) (-619.717) * (-623.868) [-619.669] (-620.474) (-625.002) -- 0:00:01
975000 -- (-621.438) (-620.008) (-620.353) [-621.701] * [-625.754] (-622.090) (-623.581) (-622.317) -- 0:00:01
Average standard deviation of split frequencies: 0.007921
975500 -- (-621.672) [-621.191] (-619.434) (-620.596) * (-622.676) (-621.819) [-620.826] (-623.494) -- 0:00:01
976000 -- [-620.043] (-623.934) (-620.892) (-620.859) * (-623.274) (-622.894) [-620.343] (-622.577) -- 0:00:01
976500 -- (-622.211) [-621.158] (-622.496) (-622.171) * [-622.581] (-621.336) (-620.163) (-622.149) -- 0:00:01
977000 -- (-621.651) (-619.232) [-619.969] (-621.519) * [-623.933] (-620.082) (-627.180) (-621.189) -- 0:00:01
977500 -- (-621.979) [-621.388] (-619.507) (-622.446) * (-622.795) (-624.215) (-624.635) [-622.763] -- 0:00:01
978000 -- [-621.881] (-620.756) (-624.995) (-622.668) * (-626.843) [-623.022] (-621.043) (-622.367) -- 0:00:01
978500 -- (-621.163) (-620.415) (-622.464) [-621.640] * [-622.065] (-624.035) (-620.658) (-621.170) -- 0:00:01
979000 -- (-622.998) [-620.798] (-623.969) (-624.458) * [-625.859] (-626.406) (-619.336) (-620.548) -- 0:00:01
979500 -- [-622.724] (-620.067) (-619.776) (-621.430) * [-623.104] (-622.608) (-619.159) (-622.752) -- 0:00:01
980000 -- (-621.165) (-618.019) [-620.014] (-620.708) * (-622.549) (-621.544) [-620.697] (-619.910) -- 0:00:01
Average standard deviation of split frequencies: 0.007659
980500 -- [-628.448] (-621.355) (-620.840) (-624.546) * (-626.912) (-621.120) (-621.086) [-621.246] -- 0:00:01
981000 -- (-619.091) [-618.892] (-618.764) (-622.976) * (-630.704) (-621.397) (-620.487) [-620.904] -- 0:00:01
981500 -- (-620.520) (-621.217) [-629.306] (-623.954) * (-623.925) [-621.517] (-618.720) (-621.139) -- 0:00:01
982000 -- (-620.802) [-620.514] (-621.207) (-621.828) * (-619.942) [-621.726] (-619.262) (-620.438) -- 0:00:01
982500 -- [-618.836] (-619.890) (-619.635) (-623.691) * (-622.246) (-618.517) [-623.249] (-621.779) -- 0:00:01
983000 -- (-620.082) (-619.577) [-620.485] (-621.770) * (-625.824) [-621.770] (-621.078) (-620.738) -- 0:00:01
983500 -- [-621.575] (-623.511) (-619.058) (-623.659) * (-622.247) (-620.131) (-620.230) [-620.659] -- 0:00:01
984000 -- (-620.369) [-621.221] (-620.109) (-622.273) * (-620.984) (-623.765) (-619.236) [-622.805] -- 0:00:01
984500 -- (-622.245) (-623.758) [-623.361] (-622.269) * [-619.252] (-622.410) (-621.902) (-621.636) -- 0:00:01
985000 -- (-623.641) (-620.204) (-620.941) [-621.322] * (-621.528) (-619.578) [-619.667] (-620.068) -- 0:00:01
Average standard deviation of split frequencies: 0.007841
985500 -- (-620.842) [-623.718] (-625.493) (-629.123) * (-618.448) (-621.631) [-619.940] (-626.840) -- 0:00:01
986000 -- (-623.595) [-622.007] (-622.172) (-621.808) * [-619.353] (-623.034) (-621.792) (-623.622) -- 0:00:00
986500 -- (-621.152) (-622.440) [-620.918] (-620.786) * (-621.804) (-620.904) (-620.295) [-620.605] -- 0:00:00
987000 -- [-621.819] (-619.438) (-623.769) (-628.274) * (-622.105) [-621.470] (-622.643) (-621.390) -- 0:00:00
987500 -- [-622.682] (-621.967) (-621.606) (-623.721) * (-621.989) [-622.496] (-622.001) (-624.982) -- 0:00:00
988000 -- (-622.215) [-620.659] (-623.755) (-621.112) * (-622.020) (-621.755) (-623.762) [-621.389] -- 0:00:00
988500 -- [-621.798] (-619.447) (-619.516) (-620.897) * (-622.820) (-621.437) (-626.033) [-621.228] -- 0:00:00
989000 -- (-621.767) (-618.648) (-622.425) [-622.804] * (-617.694) (-620.654) [-619.871] (-621.171) -- 0:00:00
989500 -- (-619.411) (-622.681) [-621.105] (-622.149) * (-623.438) (-621.659) [-622.134] (-622.872) -- 0:00:00
990000 -- (-618.642) (-621.652) (-623.783) [-618.997] * (-625.434) [-620.645] (-622.856) (-628.191) -- 0:00:00
Average standard deviation of split frequencies: 0.008153
990500 -- (-622.770) (-621.884) (-626.769) [-620.879] * [-621.044] (-621.965) (-621.048) (-622.414) -- 0:00:00
991000 -- (-622.524) (-621.600) [-620.171] (-619.887) * (-621.792) (-620.992) [-618.622] (-622.988) -- 0:00:00
991500 -- (-621.532) (-619.947) [-622.777] (-622.637) * (-621.070) [-620.571] (-621.652) (-626.705) -- 0:00:00
992000 -- (-622.220) [-623.090] (-622.644) (-622.912) * [-621.503] (-623.109) (-619.437) (-626.102) -- 0:00:00
992500 -- (-621.581) (-621.487) [-621.088] (-623.214) * [-621.705] (-622.274) (-622.241) (-620.506) -- 0:00:00
993000 -- (-619.680) (-622.705) (-621.589) [-624.286] * [-621.363] (-620.384) (-618.381) (-620.993) -- 0:00:00
993500 -- (-623.660) [-621.717] (-620.413) (-619.451) * [-622.005] (-620.628) (-618.332) (-624.083) -- 0:00:00
994000 -- (-623.371) (-623.378) (-619.921) [-620.800] * (-622.036) [-620.299] (-619.933) (-620.660) -- 0:00:00
994500 -- (-624.261) (-621.828) (-621.062) [-621.697] * [-621.160] (-622.723) (-621.136) (-622.297) -- 0:00:00
995000 -- (-622.806) (-620.129) (-624.097) [-621.704] * (-621.437) [-623.032] (-622.074) (-622.387) -- 0:00:00
Average standard deviation of split frequencies: 0.008015
995500 -- [-623.151] (-620.936) (-621.262) (-619.542) * [-622.621] (-622.711) (-622.042) (-622.074) -- 0:00:00
996000 -- (-624.766) (-620.804) (-620.554) [-617.683] * (-623.086) (-622.371) (-619.159) [-622.366] -- 0:00:00
996500 -- (-622.807) (-621.280) (-622.114) [-619.849] * [-621.326] (-622.520) (-620.991) (-621.037) -- 0:00:00
997000 -- (-621.392) (-620.779) [-622.527] (-625.412) * [-622.710] (-621.538) (-621.572) (-620.955) -- 0:00:00
997500 -- (-624.351) [-621.424] (-622.709) (-626.189) * [-620.900] (-621.654) (-621.541) (-618.778) -- 0:00:00
998000 -- (-623.326) (-620.703) (-621.612) [-620.703] * [-622.535] (-620.887) (-622.294) (-619.912) -- 0:00:00
998500 -- (-624.487) [-622.489] (-620.714) (-624.431) * (-622.782) [-621.526] (-621.740) (-624.924) -- 0:00:00
999000 -- [-623.939] (-622.040) (-623.829) (-620.058) * [-620.093] (-622.910) (-620.842) (-625.278) -- 0:00:00
999500 -- (-623.759) (-621.551) (-620.729) [-621.528] * (-619.009) [-620.814] (-623.732) (-623.820) -- 0:00:00
1000000 -- (-622.479) (-621.874) (-621.748) [-619.300] * [-621.533] (-621.475) (-623.062) (-620.789) -- 0:00:00
Average standard deviation of split frequencies: 0.007914
Analysis completed in 1 mins 10 seconds
Analysis used 68.14 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -616.56
Likelihood of best state for "cold" chain of run 2 was -616.54
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 62 %) Dirichlet(Revmat{all})
98.6 % ( 98 %) Slider(Revmat{all})
32.8 % ( 24 %) Dirichlet(Pi{all})
34.0 % ( 22 %) Slider(Pi{all})
69.3 % ( 35 %) Multiplier(Alpha{1,2})
79.2 % ( 57 %) Multiplier(Alpha{3})
27.1 % ( 32 %) Slider(Pinvar{all})
97.2 % ( 97 %) ExtSPR(Tau{all},V{all})
68.9 % ( 76 %) ExtTBR(Tau{all},V{all})
97.9 % ( 99 %) NNI(Tau{all},V{all})
87.6 % ( 83 %) ParsSPR(Tau{all},V{all})
28.0 % ( 24 %) Multiplier(V{all})
95.1 % ( 93 %) Nodeslider(V{all})
30.3 % ( 21 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 65 %) Dirichlet(Revmat{all})
98.4 % ( 99 %) Slider(Revmat{all})
32.9 % ( 29 %) Dirichlet(Pi{all})
33.8 % ( 32 %) Slider(Pi{all})
69.3 % ( 39 %) Multiplier(Alpha{1,2})
79.1 % ( 53 %) Multiplier(Alpha{3})
28.6 % ( 26 %) Slider(Pinvar{all})
97.2 % (100 %) ExtSPR(Tau{all},V{all})
69.2 % ( 77 %) ExtTBR(Tau{all},V{all})
98.1 % (100 %) NNI(Tau{all},V{all})
87.7 % ( 87 %) ParsSPR(Tau{all},V{all})
28.1 % ( 28 %) Multiplier(V{all})
95.0 % ( 94 %) Nodeslider(V{all})
29.9 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166421 0.82 0.66
3 | 167615 166730 0.83
4 | 166460 166069 166705
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.48
2 | 166661 0.82 0.66
3 | 166910 166781 0.83
4 | 166400 166309 166939
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -620.49
| 1 2 |
| 2 |
| 2 2 |
| 2 1 2 2 |
| 1 22 2 2 1 1 2 1 1 |
| * 1 2 211 1 1 1 2 1 12 |
| 1 2 2 1 11* 1 1 1 2 2 1 * |
|1 1 1 11 22 2 2 22 1 * 2 2|
| 22 2 2*1 2 21 1 1|
| 1 1 21 2 2 22 11 1 2 12 |
|2 1 2 1 2 * |
| 1 * 1 12 2 22 1 12 |
| 2 1 1 1 2 |
| 1 2 12 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -622.33
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -620.41 -625.77
2 -620.38 -623.73
--------------------------------------
TOTAL -620.39 -625.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.865833 0.086695 0.340758 1.451811 0.836178 1285.48 1393.24 1.000
r(A<->C){all} 0.161958 0.021130 0.000011 0.464701 0.120334 123.59 130.89 1.000
r(A<->G){all} 0.153233 0.018852 0.000036 0.442132 0.114065 154.95 191.29 1.006
r(A<->T){all} 0.159553 0.017412 0.000035 0.414172 0.127125 260.50 271.26 1.001
r(C<->G){all} 0.200925 0.023409 0.000070 0.500779 0.165720 250.38 284.18 1.003
r(C<->T){all} 0.185964 0.023766 0.000027 0.501653 0.145063 186.51 198.12 1.002
r(G<->T){all} 0.138368 0.015740 0.000022 0.401241 0.100684 212.33 215.48 1.001
pi(A){all} 0.210028 0.000370 0.174906 0.248994 0.209669 1342.02 1363.02 1.000
pi(C){all} 0.261304 0.000453 0.221161 0.302233 0.260626 1355.67 1397.75 1.000
pi(G){all} 0.303754 0.000476 0.260367 0.345155 0.303622 1248.18 1339.88 1.000
pi(T){all} 0.224915 0.000386 0.188301 0.265534 0.225321 1256.43 1318.18 1.000
alpha{1,2} 0.333310 0.150203 0.000414 1.127768 0.205734 1072.64 1273.92 1.000
alpha{3} 0.422644 0.234523 0.000177 1.394305 0.246271 1250.96 1287.12 1.001
pinvar{all} 0.991684 0.000052 0.978301 0.999931 0.993592 1155.08 1328.04 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- .*.***
9 -- ..*..*
10 -- .***.*
11 -- ..*.*.
12 -- ....**
13 -- ...*.*
14 -- .**.**
15 -- .*..*.
16 -- .*...*
17 -- ..****
18 -- ..**..
19 -- .****.
20 -- .**...
21 -- ...**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 474 0.157895 0.004711 0.154564 0.161226 2
8 462 0.153897 0.015075 0.143238 0.164557 2
9 459 0.152898 0.008009 0.147235 0.158561 2
10 449 0.149567 0.027794 0.129913 0.169221 2
11 436 0.145237 0.004711 0.141905 0.148568 2
12 434 0.144570 0.007537 0.139241 0.149900 2
13 428 0.142572 0.005653 0.138574 0.146569 2
14 427 0.142239 0.001413 0.141239 0.143238 2
15 427 0.142239 0.001413 0.141239 0.143238 2
16 418 0.139241 0.013191 0.129913 0.148568 2
17 416 0.138574 0.013191 0.129247 0.147901 2
18 412 0.137242 0.007537 0.131912 0.142572 2
19 402 0.133911 0.000942 0.133245 0.134577 2
20 396 0.131912 0.003769 0.129247 0.134577 2
21 392 0.130580 0.003769 0.127915 0.133245 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.089059 0.008572 0.000041 0.274944 0.058006 1.000 2
length{all}[2] 0.090733 0.008397 0.000007 0.272558 0.062494 1.000 2
length{all}[3] 0.090716 0.008702 0.000020 0.269815 0.062246 1.000 2
length{all}[4] 0.090238 0.009257 0.000006 0.280144 0.059469 1.000 2
length{all}[5] 0.136677 0.013789 0.000151 0.376067 0.105947 1.000 2
length{all}[6] 0.087928 0.007894 0.000021 0.262559 0.058300 1.000 2
length{all}[7] 0.086678 0.008095 0.000082 0.256444 0.058218 0.998 2
length{all}[8] 0.101442 0.012607 0.000214 0.315167 0.063017 0.999 2
length{all}[9] 0.096147 0.008714 0.000045 0.288461 0.067228 1.000 2
length{all}[10] 0.094040 0.009080 0.000149 0.302948 0.068238 1.001 2
length{all}[11] 0.094622 0.009089 0.000091 0.284714 0.059026 0.998 2
length{all}[12] 0.094312 0.009784 0.000632 0.285948 0.059898 0.999 2
length{all}[13] 0.091890 0.009251 0.000002 0.274493 0.061605 0.998 2
length{all}[14] 0.088145 0.008457 0.000018 0.257687 0.056155 0.998 2
length{all}[15] 0.094268 0.007980 0.000399 0.268194 0.068102 1.005 2
length{all}[16] 0.088239 0.007524 0.000225 0.256730 0.062500 0.998 2
length{all}[17] 0.098385 0.009761 0.000193 0.289319 0.069558 0.998 2
length{all}[18] 0.086634 0.006126 0.000036 0.249112 0.063465 1.001 2
length{all}[19] 0.095328 0.009107 0.000155 0.287124 0.063044 0.999 2
length{all}[20] 0.092982 0.010619 0.000276 0.301583 0.062119 0.998 2
length{all}[21] 0.090703 0.008951 0.000041 0.269256 0.061327 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007914
Maximum standard deviation of split frequencies = 0.027794
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------- C1 (1)
|
|------------------------------------------ C2 (2)
|
|------------------------------------------ C3 (3)
+
|---------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\---------------------------------------- C6 (6)
|------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 44 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 441
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 52 patterns at 147 / 147 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 52 patterns at 147 / 147 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
50752 bytes for conP
4576 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.064054 0.073766 0.091528 0.101889 0.021668 0.098437 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -665.681247
Iterating by ming2
Initial: fx= 665.681247
x= 0.06405 0.07377 0.09153 0.10189 0.02167 0.09844 0.30000 1.30000
1 h-m-p 0.0000 0.0002 337.1007 ++YCYYYC 644.098044 5 0.0002 22 | 0/8
2 h-m-p 0.0000 0.0000 3740.7016 ++ 619.804907 m 0.0000 33 | 1/8
3 h-m-p 0.0000 0.0002 89.8986 ++ 614.455327 m 0.0002 44 | 2/8
4 h-m-p 0.0001 0.0005 76.3604 ++ 606.627843 m 0.0005 55 | 3/8
5 h-m-p 0.0006 0.0032 48.0776 ++ 604.669053 m 0.0032 66 | 4/8
6 h-m-p 0.0000 0.0000 71.6397 ++ 604.288070 m 0.0000 77 | 5/8
7 h-m-p 0.0160 8.0000 59.6820 YCYCCC 602.260082 5 0.0334 96 | 5/8
8 h-m-p 0.1807 0.9034 0.4014 ++ 602.104460 m 0.9034 107 | 6/8
9 h-m-p 0.0450 3.1343 0.9779 --------------.. | 6/8
10 h-m-p 0.0000 0.0013 5.2660 +CC 602.103787 1 0.0000 149 | 6/8
11 h-m-p 0.0160 8.0000 0.0294 +++++ 602.097354 m 8.0000 163 | 6/8
12 h-m-p 0.1517 8.0000 1.5491 +++ 602.028572 m 8.0000 177 | 6/8
13 h-m-p 1.6000 8.0000 0.6154 ++ 602.025227 m 8.0000 188 | 6/8
14 h-m-p 1.3674 8.0000 3.6006 +YC 602.018409 1 4.4883 203 | 6/8
15 h-m-p 1.6000 8.0000 4.7154 CCC 602.015967 2 2.3912 218 | 6/8
16 h-m-p 1.6000 8.0000 6.8602 +YC 602.013400 1 5.3390 231 | 6/8
17 h-m-p 1.6000 8.0000 11.4959 CC 602.012253 1 2.2131 244 | 6/8
18 h-m-p 1.6000 8.0000 15.2008 +CC 602.011138 1 5.5685 258 | 6/8
19 h-m-p 1.6000 8.0000 26.7792 CC 602.010634 1 2.1910 271 | 6/8
20 h-m-p 1.6000 8.0000 34.7528 +CC 602.010149 1 5.6441 285 | 6/8
21 h-m-p 1.6000 8.0000 61.7826 CC 602.009929 1 2.1737 298 | 6/8
22 h-m-p 1.0384 5.1919 79.9538 ++ 602.009719 m 5.1919 309 | 7/8
23 h-m-p 1.6000 8.0000 0.0000 YC 602.009693 1 0.9985 321 | 7/8
24 h-m-p 1.6000 8.0000 0.0000 ----Y 602.009693 0 0.0016 337
Out..
lnL = -602.009693
338 lfun, 338 eigenQcodon, 2028 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.054448 0.011529 0.036736 0.057512 0.013500 0.038179 0.000100 0.540601 0.402611
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.697721
np = 9
lnL0 = -630.914542
Iterating by ming2
Initial: fx= 630.914542
x= 0.05445 0.01153 0.03674 0.05751 0.01350 0.03818 0.00011 0.54060 0.40261
1 h-m-p 0.0000 0.0000 321.2955 ++ 630.230151 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0000 22289.6052 ++ 622.682179 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0002 312.5026 ++ 608.284134 m 0.0002 38 | 3/9
4 h-m-p 0.0000 0.0000 148.4600 ++ 607.665462 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0001 781.9333 ++ 603.072108 m 0.0001 62 | 5/9
6 h-m-p 0.0000 0.0000 160.9343 ++ 602.638289 m 0.0000 74 | 6/9
7 h-m-p 0.0248 6.4822 0.0816 +++CYCCC 602.412318 4 1.7874 96 | 6/9
8 h-m-p 0.2513 1.2567 0.5177 ++ 602.274528 m 1.2567 111 | 7/9
9 h-m-p 1.6000 8.0000 0.0008 CC 602.274263 1 2.0341 128 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 C 602.274263 0 1.9878 142 | 7/9
11 h-m-p 1.6000 8.0000 0.0000 ----------N 602.274263 0 0.0000 166
Out..
lnL = -602.274263
167 lfun, 501 eigenQcodon, 2004 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.018247 0.021321 0.047407 0.088025 0.011080 0.031326 0.000100 1.716479 0.236994 0.139254 1004.320167
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.104682
np = 11
lnL0 = -617.657811
Iterating by ming2
Initial: fx= 617.657811
x= 0.01825 0.02132 0.04741 0.08802 0.01108 0.03133 0.00011 1.71648 0.23699 0.13925 951.42857
1 h-m-p 0.0000 0.0000 97.5326 ++ 617.613477 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0001 554.2178 ++ 613.347473 m 0.0001 30 | 2/11
3 h-m-p 0.0009 0.0043 11.1039 ++ 612.293621 m 0.0043 44 | 3/11
4 h-m-p 0.0000 0.0002 212.5338 ++ 610.182697 m 0.0002 58 | 4/11
5 h-m-p 0.0001 0.0006 252.3867 ++ 607.818312 m 0.0006 72 | 5/11
6 h-m-p 0.0000 0.0002 607.2008 ++ 605.310696 m 0.0002 86 | 6/11
7 h-m-p 0.0500 0.2986 2.9070 +YYCCYCCC 602.059417 7 0.2606 114 | 6/11
8 h-m-p 1.6000 8.0000 0.0216 CC 602.059057 1 0.5400 130 | 6/11
9 h-m-p 0.0768 8.0000 0.1518 ++++ 602.026792 m 8.0000 151 | 6/11
10 h-m-p 1.6000 8.0000 0.4545 +YY 602.015577 1 6.4000 172 | 6/11
11 h-m-p 1.6000 8.0000 0.1326 YC 602.014799 1 0.8838 192 | 6/11
12 h-m-p 0.9360 8.0000 0.1252 ++ 602.014354 m 8.0000 211 | 6/11
13 h-m-p 1.4136 8.0000 0.7084 ++ 602.013746 m 8.0000 230 | 6/11
14 h-m-p 0.3398 1.6992 1.6649 ++ 602.013414 m 1.6992 249 | 6/11
15 h-m-p 0.0000 0.0000 4.9569
h-m-p: 0.00000000e+00 0.00000000e+00 4.95694588e+00 602.013414
.. | 6/11
16 h-m-p 0.0160 8.0000 0.5639 ---Y 602.013407 0 0.0000 277 | 6/11
17 h-m-p 0.0055 0.0273 0.0037 ++ 602.013406 m 0.0273 296 | 7/11
18 h-m-p 0.0160 8.0000 1.0002 ++++YY 602.009830 1 4.7730 320 | 7/11
19 h-m-p 1.6000 8.0000 0.0292 YC 602.009739 1 0.9784 335 | 7/11
20 h-m-p 0.7253 8.0000 0.0394 ++ 602.009731 m 8.0000 353 | 7/11
21 h-m-p 0.3710 8.0000 0.8504 +++ 602.009709 m 8.0000 372 | 7/11
22 h-m-p 1.6000 8.0000 0.0078 Y 602.009708 0 1.1068 390 | 7/11
23 h-m-p 1.2548 8.0000 0.0069 C 602.009708 0 0.3441 408 | 7/11
24 h-m-p 0.1419 8.0000 0.0167 +Y 602.009708 0 0.4609 427 | 7/11
25 h-m-p 0.2540 8.0000 0.0304 +Y 602.009708 0 0.6838 446 | 7/11
26 h-m-p 0.3710 8.0000 0.0560 +Y 602.009708 0 1.0119 465 | 7/11
27 h-m-p 0.6157 8.0000 0.0920 +C 602.009708 0 2.2643 484 | 7/11
28 h-m-p 1.2039 8.0000 0.1730 ++ 602.009708 m 8.0000 502 | 7/11
29 h-m-p 1.6000 8.0000 0.4237 Y 602.009708 0 2.6120 520 | 7/11
30 h-m-p 1.6000 8.0000 0.1386 Y 602.009708 0 0.8590 538 | 7/11
31 h-m-p 0.2556 8.0000 0.4659 +Y 602.009708 0 0.7523 557 | 7/11
32 h-m-p 0.8174 8.0000 0.4288 +Y 602.009708 0 2.5781 576 | 7/11
33 h-m-p 1.6000 8.0000 0.5212 +Y 602.009708 0 7.1812 595 | 7/11
34 h-m-p 1.6000 8.0000 0.6583 Y 602.009708 0 0.8336 613 | 7/11
35 h-m-p 0.3932 8.0000 1.3959 ---C 602.009708 0 0.0015 634 | 7/11
36 h-m-p 0.1046 8.0000 0.0205 ++++ 602.009708 m 8.0000 650 | 7/11
37 h-m-p 0.0027 1.2880 61.0635 +++++ 602.009708 m 1.2880 671 | 7/11
38 h-m-p -0.0000 -0.0000 5761.3842
h-m-p: -0.00000000e+00 -0.00000000e+00 5.76138424e+03 602.009708
.. | 7/11
39 h-m-p 0.0024 1.2114 0.0056 ---Y 602.009708 0 0.0000 699 | 7/11
40 h-m-p 0.0794 8.0000 0.0000 ----------Y 602.009708 0 0.0000 727
Out..
lnL = -602.009708
728 lfun, 2912 eigenQcodon, 13104 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -606.951756 S = -605.512916 -2.367402
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:05
did 20 / 52 patterns 0:05
did 30 / 52 patterns 0:05
did 40 / 52 patterns 0:05
did 50 / 52 patterns 0:05
did 52 / 52 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.023234 0.084948 0.068541 0.045753 0.058059 0.012749 0.000100 0.964446 1.534257
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.892479
np = 9
lnL0 = -640.233336
Iterating by ming2
Initial: fx= 640.233336
x= 0.02323 0.08495 0.06854 0.04575 0.05806 0.01275 0.00011 0.96445 1.53426
1 h-m-p 0.0000 0.0000 324.8027 ++ 639.836894 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0002 342.9278 ++YYYYYCYCYC 629.791525 9 0.0002 40 | 1/9
3 h-m-p 0.0010 0.0051 34.4386 ++ 626.557417 m 0.0051 52 | 2/9
4 h-m-p 0.0001 0.0004 133.6918 ++ 622.952742 m 0.0004 64 | 3/9
5 h-m-p 0.0007 0.0128 65.1381 ++YYYYYYYYYY 611.944122 10 0.0117 87 | 3/9
6 h-m-p 0.0003 0.0013 14.3257 ----------.. | 3/9
7 h-m-p 0.0000 0.0001 824.0918 YYCCCC 610.236547 5 0.0000 127 | 3/9
8 h-m-p 0.0000 0.0001 257.7845 ++ 606.514572 m 0.0001 139 | 4/9
9 h-m-p 0.0019 0.0110 6.5642 ------------.. | 4/9
10 h-m-p 0.0000 0.0000 207.2465 ++ 605.271298 m 0.0000 173 | 5/9
11 h-m-p 0.0000 0.0000 830.1382 ++ 604.412055 m 0.0000 185 | 6/9
12 h-m-p 0.0042 2.1196 11.0115 +YYYCC 603.715714 4 0.0195 203 | 6/9
13 h-m-p 0.2127 1.0635 0.5848 +YYCYCCC 602.948760 6 0.6876 225 | 6/9
14 h-m-p 0.5864 2.9322 0.4174 ++ 602.285809 m 2.9322 240
QuantileBeta(0.85, 0.38975, 0.00494) = 1.000000e+00 2000 rounds
| 7/9
15 h-m-p 1.6000 8.0000 0.0074 CYC 602.274269 2 0.3575 258 | 7/9
16 h-m-p 1.6000 8.0000 0.0000 Y 602.274269 0 1.2415 272 | 7/9
17 h-m-p 1.6000 8.0000 0.0000 Y 602.274269 0 0.2206 286 | 7/9
18 h-m-p 0.1033 8.0000 0.0000 +Y 602.274269 0 0.2757 301 | 7/9
19 h-m-p 0.1646 8.0000 0.0000 Y 602.274269 0 0.3505 315 | 7/9
20 h-m-p 0.2267 8.0000 0.0000 Y 602.274269 0 0.4756 329 | 7/9
21 h-m-p 0.3135 8.0000 0.0000 Y 602.274269 0 0.7000 343 | 7/9
22 h-m-p 0.4421 8.0000 0.0000 +Y 602.274269 0 1.1892 358 | 7/9
23 h-m-p 0.6594 8.0000 0.0001 +C 602.274269 0 2.6039 373 | 7/9
24 h-m-p 1.0015 8.0000 0.0002 ++ 602.274269 m 8.0000 387 | 7/9
25 h-m-p 0.9412 8.0000 0.0014 ++ 602.274269 m 8.0000 401 | 7/9
26 h-m-p 0.4701 8.0000 0.0236 ++Y 602.274267 0 5.3060 417 | 7/9
27 h-m-p 1.6000 8.0000 0.0214 Y 602.274265 0 2.8086 431 | 7/9
28 h-m-p 1.4420 8.0000 0.0417 ++ 602.274264 m 8.0000 445 | 7/9
29 h-m-p 1.6000 8.0000 0.0646 C 602.274264 0 1.5905 459 | 7/9
30 h-m-p 1.4081 8.0000 0.0729 ++ 602.274264 m 8.0000 473 | 7/9
31 h-m-p 1.6000 8.0000 0.1615
QuantileBeta(0.85, 2.64361, 0.00500) = 1.000000e+00 2000 rounds
C 602.274263 0 1.9026 487 | 7/9
32 h-m-p 1.6000 8.0000 0.1746
QuantileBeta(0.85, 2.19648, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.03461, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.31399, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.74515, 0.00500) = 1.000000e+00 2000 rounds
Y 602.274263 0 4.7422 502
QuantileBeta(0.85, 2.74515, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.74515, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.74515, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.74515, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.74515, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.74515, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.74515, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.74515, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.74528, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.74501, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.74515, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
33 h-m-p 1.6000 8.0000 0.3720
QuantileBeta(0.85, 3.34039, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.12609, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.83111, 0.00500) = 1.000000e+00 2000 rounds
Y 602.274263 0 2.9191 516
QuantileBeta(0.85, 3.83111, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.83111, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.83111, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.83111, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.83111, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.83111, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.83111, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.83111, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.83127, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.83095, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.83111, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
34 h-m-p 1.6000 8.0000 0.4155
QuantileBeta(0.85, 4.49586, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.49012, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.94569, 0.00500) = 1.000000e+00 2000 rounds
Y 602.274263 0 2.6827 530
QuantileBeta(0.85, 4.94569, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.94569, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.94569, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.94569, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.94569, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.94569, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.94569, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.94569, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.94587, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.94550, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.94569, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
35 h-m-p 1.4761 8.0000 0.7551
QuantileBeta(0.85, 6.06026, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40400, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 10.98636, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.45685, 0.00500) = 1.000000e+00 2000 rounds
C 602.274263 0 5.9044 545
QuantileBeta(0.85, 9.40400, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40400, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40400, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40400, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40400, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40400, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40400, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40400, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40427, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40373, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40400, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
36 h-m-p 1.6000 8.0000 0.9843
QuantileBeta(0.85, 10.97892, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 15.70368, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.99011, 0.00500) = 1.000000e+00 2000 rounds
C 602.274263 0 1.6000 559
QuantileBeta(0.85, 10.97892, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.97892, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.97892, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.97892, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.97892, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.97892, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.97892, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.97892, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.97921, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.97862, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.97892, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
37 h-m-p 1.1429 8.0000 1.3780
QuantileBeta(0.85, 12.55384, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.27860, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 22.00260, 0.00500) = 1.000000e+00 2000 rounds
+ 602.274263 m 8.0000 573
QuantileBeta(0.85, 22.00260, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.00260, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.00260, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.00260, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.00260, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.00260, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.00260, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.00261, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.00260, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
38 h-m-p 1.6000 8.0000 1.0618
QuantileBeta(0.85, 23.70150, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.79822, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01132, 0.00500) = 1.000000e+00 2000 rounds
Y 602.274263 0 0.9500 585
QuantileBeta(0.85, 23.01132, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01132, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01132, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01132, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01132, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01132, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01132, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01133, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01132, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
39 h-m-p 1.6000 8.0000 0.2663
QuantileBeta(0.85, 23.43739, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.11784, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 23.03795, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 23.01798, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 23.01298, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01177, 0.00500) = 1.000000e+00 2000 rounds
Y 602.274263 0 0.0063 600
QuantileBeta(0.85, 23.01298, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01298, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01298, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01298, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01298, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01298, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01298, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01298, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01345, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01251, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.01298, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
40 h-m-p 0.0160 8.0000 2.0877
QuantileBeta(0.85, 23.04639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.14660, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 23.54744, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 25.15081, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 31.56428, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.51773, 0.00500) = 1.000000e+00 2000 rounds
Y 602.274263 0 0.7208 617
QuantileBeta(0.85, 24.51773, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.51773, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.51773, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.51773, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.51773, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.51773, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.51773, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.51774, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.51773, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
41 h-m-p 1.6000 8.0000 0.3970
QuantileBeta(0.85, 23.88248, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.35892, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.47803, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50084, 0.00500) = 1.000000e+00 2000 rounds
Y 602.274263 0 0.0425 630
QuantileBeta(0.85, 24.50084, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50084, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50084, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50084, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50084, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50084, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50084, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50084, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50133, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50035, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50084, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
42 h-m-p 0.9666 8.0000 0.0175
QuantileBeta(0.85, 24.51773, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50507, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.50190, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.50111, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.50091, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50084, 0.00500) = 1.000000e+00 2000 rounds
Y 602.274263 0 0.0038 647
QuantileBeta(0.85, 24.50091, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50091, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50091, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50091, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50091, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50091, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50091, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50091, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50140, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50042, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50091, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
43 h-m-p 0.2870 8.0000 0.0002
QuantileBeta(0.85, 24.50084, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.50065, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 24.49985, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 24.49907, 0.00500) = 1.000000e+00 2000 rounds
+ 602.274263 m 8.0000 662
QuantileBeta(0.85, 24.49907, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.49907, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.49907, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.49907, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.49907, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.49907, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.49907, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.49907, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.49956, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.49858, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.49907, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
44 h-m-p 0.0411 8.0000 0.0448
QuantileBeta(0.85, 24.49723, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.49172, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 24.46965, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 24.38139, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46668, 0.00500) = 1.000000e+00 2000 rounds
C 602.274263 0 0.7237 678
QuantileBeta(0.85, 24.46668, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46668, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46668, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46668, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46668, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46668, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46668, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46668, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46717, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46620, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46668, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
45 h-m-p 1.6000 8.0000 0.0193
QuantileBeta(0.85, 24.43574, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.45895, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.46475, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.46620, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.46656, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46668, 0.00500) = 1.000000e+00 2000 rounds
Y 602.274263 0 0.0063 695
QuantileBeta(0.85, 24.46656, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46656, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46656, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46656, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46656, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46656, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46656, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46656, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46705, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46607, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46656, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
46 h-m-p 0.0160 8.0000 0.0189
QuantileBeta(0.85, 24.46626, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46638, 0.00500) = 1.000000e+00 2000 rounds
Y 602.274263 0 0.0040 709
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46698, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
47 h-m-p 0.0160 8.0000 0.0187
QuantileBeta(0.85, 24.46619, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46641, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.46647, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.46648, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
Y 602.274263 0 0.0001 726
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46698, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
48 h-m-p 0.0222 8.0000 0.0001
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
Y 602.274263 0 0.0000 750
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -602.274263
751 lfun, 8261 eigenQcodon, 45060 P(t)
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.46649, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:18
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.071774 0.083688 0.069241 0.032888 0.072121 0.043111 0.000100 0.900000 0.329462 1.791708 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.133648
np = 11
lnL0 = -616.954699
Iterating by ming2
Initial: fx= 616.954699
x= 0.07177 0.08369 0.06924 0.03289 0.07212 0.04311 0.00011 0.90000 0.32946 1.79171 951.42857
1 h-m-p 0.0000 0.0000 106.5761 ++ 616.891246 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0025 61.7266 +++YCYYYYCYCY 607.423093 10 0.0022 46 | 1/11
3 h-m-p 0.0046 0.0231 6.6446 CYC 607.355605 2 0.0034 63 | 1/11
4 h-m-p 0.0101 0.1106 2.2196 ++ 606.853352 m 0.1106 77 | 2/11
5 h-m-p 0.0044 0.0220 2.0430 ++ 606.542670 m 0.0220 91 | 3/11
6 h-m-p 0.0014 0.0069 2.1361 ++ 606.460813 m 0.0069 105 | 4/11
7 h-m-p 0.0060 0.0763 1.9755 ++ 605.480245 m 0.0763 119 | 5/11
8 h-m-p 0.3848 8.0000 0.3036 ---------------.. | 5/11
9 h-m-p 0.0000 0.0002 93.0482 +YYCYCCCCC 605.152539 8 0.0001 180 | 5/11
10 h-m-p 0.0006 0.0067 8.8037 ++ 604.463510 m 0.0067 194 | 6/11
11 h-m-p 0.0001 0.0004 397.6861 CYCCC 604.355849 4 0.0001 215 | 6/11
12 h-m-p 0.1972 2.0565 0.2301 ---------------.. | 6/11
13 h-m-p 0.0000 0.0073 135.9636 YYCCC 604.221764 4 0.0000 267 | 6/11
14 h-m-p 0.0005 0.0404 5.2931 +++YYYYCYYYCY 602.718117 10 0.0391 296 | 6/11
15 h-m-p 0.7112 8.0000 0.2908 ----------------.. | 6/11
16 h-m-p 0.0000 0.0003 138.6932 ++YCCY 602.222173 3 0.0001 350 | 6/11
17 h-m-p 0.0002 0.0316 60.3199 CCCC 602.152297 3 0.0001 370 | 6/11
18 h-m-p 0.5835 8.0000 0.0057 ++ 602.108381 m 8.0000 384 | 6/11
19 h-m-p 1.0050 8.0000 0.0451 +YCC 602.055231 2 4.9546 407 | 6/11
20 h-m-p 1.6000 8.0000 0.0271 CCC 602.043520 2 1.4657 430 | 6/11
21 h-m-p 0.8857 4.4285 0.0407 ++ 602.032143 m 4.4285 449 | 6/11
22 h-m-p 0.0000 0.0000 0.1692
h-m-p: 5.39468811e-18 2.69734405e-17 1.69175612e-01 602.032143
.. | 6/11
23 h-m-p 0.0001 0.0346 0.3198 Y 602.032136 0 0.0001 484 | 6/11
24 h-m-p 0.0028 1.3794 0.6504 ++++CC 602.013195 1 0.7023 509 | 6/11
25 h-m-p 1.6000 8.0000 0.0133 YC 602.011582 1 0.9162 529 | 6/11
26 h-m-p 0.8307 8.0000 0.0147 ++ 602.010843 m 8.0000 548 | 6/11
27 h-m-p 0.2488 1.2438 0.2500 ++ 602.009713 m 1.2438 567 | 7/11
28 h-m-p 0.4475 8.0000 0.0000 ++Y 602.009708 0 5.7149 588
QuantileBeta(0.15, 0.00496, 1.88931) = 9.084145e-162 2000 rounds
| 7/11
29 h-m-p 1.6000 8.0000 0.0000 ------N 602.009708 0 0.0001 612
Out..
lnL = -602.009708
613 lfun, 7356 eigenQcodon, 40458 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -606.690634 S = -605.512893 -1.981216
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:29
did 20 / 52 patterns 0:29
did 30 / 52 patterns 0:29
did 40 / 52 patterns 0:29
did 50 / 52 patterns 0:30
did 52 / 52 patterns 0:30
Time used: 0:30
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=147
NC_011896_1_WP_010908536_1_1908_MLBR_RS09045 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
NC_002677_1_NP_302215_1_1087_ML1791 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
NZ_LVXE01000020_1_WP_010908536_1_860_A3216_RS07180 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
NZ_LYPH01000025_1_WP_010908536_1_1016_A8144_RS04835 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
NZ_CP029543_1_WP_111481049_1_1937_DIJ64_RS09865 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRAAMVR
NZ_AP014567_1_WP_010908536_1_1986_JK2ML_RS10110 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR
*********************************************.****
NC_011896_1_WP_010908536_1_1908_MLBR_RS09045 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
NC_002677_1_NP_302215_1_1087_ML1791 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
NZ_LVXE01000020_1_WP_010908536_1_860_A3216_RS07180 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
NZ_LYPH01000025_1_WP_010908536_1_1016_A8144_RS04835 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
NZ_CP029543_1_WP_111481049_1_1937_DIJ64_RS09865 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
NZ_AP014567_1_WP_010908536_1_1986_JK2ML_RS10110 LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI
**************************************************
NC_011896_1_WP_010908536_1_1908_MLBR_RS09045 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
NC_002677_1_NP_302215_1_1087_ML1791 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
NZ_LVXE01000020_1_WP_010908536_1_860_A3216_RS07180 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
NZ_LYPH01000025_1_WP_010908536_1_1016_A8144_RS04835 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
NZ_CP029543_1_WP_111481049_1_1937_DIJ64_RS09865 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
NZ_AP014567_1_WP_010908536_1_1986_JK2ML_RS10110 VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
***********************************************
>NC_011896_1_WP_010908536_1_1908_MLBR_RS09045 TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGGCGCAATGGTTCGT CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC >NC_002677_1_NP_302215_1_1087_ML1791 TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGGCGCAATGGTTCGT CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC >NZ_LVXE01000020_1_WP_010908536_1_860_A3216_RS07180 TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGGCGCAATGGTTCGT CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC >NZ_LYPH01000025_1_WP_010908536_1_1016_A8144_RS04835 TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGGCGCAATGGTTCGT CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC >NZ_CP029543_1_WP_111481049_1_1937_DIJ64_RS09865 TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGCCGCAATGGTTCGT CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC >NZ_AP014567_1_WP_010908536_1_1986_JK2ML_RS10110 TTGGGAAAAATTTTTATTATGTTGCCGACGGTTACGCACCAAGCCATAAC CTGTACTGTCAGACGTGTGCGCTGGATAGTCGATGCGATGAACGTGATCG GGACTCGCCCGGATTGTTGGTGGAAGGACCGCCGTGGCGCAATGGTTCGT CTGGTAGGTAAGCTCGAGCGCTGGGCGTCAACCGAAAGGAACCACGTGAC AGTGGTGTTTGAGCGGCCGCCGTCGCCCTCCATTCGTTCATCGGTGATCG TGATAGCACACGCACCCAAGGCATTCCCTGACTCAGCCGACGACGAGATC GTCCGGCTGGTGCAAGCCGATCCTGAACCTCAAGGAATTTGTGTCGTGAC ATCGGATAGCGCGTTGACCGATCGGGTTCAGGAGGTGGGTGCATTAGCCT ACCCGGCTGCACGCTTTCGTAAACATATCGACTCGATCGAC
>NC_011896_1_WP_010908536_1_1908_MLBR_RS09045 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID >NC_002677_1_NP_302215_1_1087_ML1791 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID >NZ_LVXE01000020_1_WP_010908536_1_860_A3216_RS07180 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID >NZ_LYPH01000025_1_WP_010908536_1_1016_A8144_RS04835 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID >NZ_CP029543_1_WP_111481049_1_1937_DIJ64_RS09865 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRAAMVR LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID >NZ_AP014567_1_WP_010908536_1_1986_JK2ML_RS10110 LGKIFIMLPTVTHQAITCTVRRVRWIVDAMNVIGTRPDCWWKDRRGAMVR LVGKLERWASTERNHVTVVFERPPSPSIRSSVIVIAHAPKAFPDSADDEI VRLVQADPEPQGICVVTSDSALTDRVQEVGALAYPAARFRKHIDSID
#NEXUS
[ID: 5865558515]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908536_1_1908_MLBR_RS09045
NC_002677_1_NP_302215_1_1087_ML1791
NZ_LVXE01000020_1_WP_010908536_1_860_A3216_RS07180
NZ_LYPH01000025_1_WP_010908536_1_1016_A8144_RS04835
NZ_CP029543_1_WP_111481049_1_1937_DIJ64_RS09865
NZ_AP014567_1_WP_010908536_1_1986_JK2ML_RS10110
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908536_1_1908_MLBR_RS09045,
2 NC_002677_1_NP_302215_1_1087_ML1791,
3 NZ_LVXE01000020_1_WP_010908536_1_860_A3216_RS07180,
4 NZ_LYPH01000025_1_WP_010908536_1_1016_A8144_RS04835,
5 NZ_CP029543_1_WP_111481049_1_1937_DIJ64_RS09865,
6 NZ_AP014567_1_WP_010908536_1_1986_JK2ML_RS10110
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05800644,2:0.06249446,3:0.06224638,4:0.05946922,5:0.1059466,6:0.0582999);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05800644,2:0.06249446,3:0.06224638,4:0.05946922,5:0.1059466,6:0.0582999);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -620.41 -625.77
2 -620.38 -623.73
--------------------------------------
TOTAL -620.39 -625.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1791/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.865833 0.086695 0.340758 1.451811 0.836178 1285.48 1393.24 1.000
r(A<->C){all} 0.161958 0.021130 0.000011 0.464701 0.120334 123.59 130.89 1.000
r(A<->G){all} 0.153233 0.018852 0.000036 0.442132 0.114065 154.95 191.29 1.006
r(A<->T){all} 0.159553 0.017412 0.000035 0.414172 0.127125 260.50 271.26 1.001
r(C<->G){all} 0.200925 0.023409 0.000070 0.500779 0.165720 250.38 284.18 1.003
r(C<->T){all} 0.185964 0.023766 0.000027 0.501653 0.145063 186.51 198.12 1.002
r(G<->T){all} 0.138368 0.015740 0.000022 0.401241 0.100684 212.33 215.48 1.001
pi(A){all} 0.210028 0.000370 0.174906 0.248994 0.209669 1342.02 1363.02 1.000
pi(C){all} 0.261304 0.000453 0.221161 0.302233 0.260626 1355.67 1397.75 1.000
pi(G){all} 0.303754 0.000476 0.260367 0.345155 0.303622 1248.18 1339.88 1.000
pi(T){all} 0.224915 0.000386 0.188301 0.265534 0.225321 1256.43 1318.18 1.000
alpha{1,2} 0.333310 0.150203 0.000414 1.127768 0.205734 1072.64 1273.92 1.000
alpha{3} 0.422644 0.234523 0.000177 1.394305 0.246271 1250.96 1287.12 1.001
pinvar{all} 0.991684 0.000052 0.978301 0.999931 0.993592 1155.08 1328.04 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1791/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 147
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 3 3 3 3 3 3
TTC 1 1 1 1 1 1 | TCC 1 1 1 1 1 1 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 3 3 3 3 3 3 | His CAT 1 1 1 1 1 1 | Arg CGT 5 5 5 5 5 5
CTC 1 1 1 1 1 1 | CCC 2 2 2 2 2 2 | CAC 3 3 3 3 3 3 | CGC 5 5 5 5 5 5
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 3 3 3 3 3 3 | CGA 0 0 0 0 0 0
CTG 2 2 2 2 2 2 | CCG 5 5 5 5 5 5 | CAG 1 1 1 1 1 1 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 5 5 5 5 5 5 | ACC 3 3 3 3 3 3 | AAC 2 2 2 2 2 2 | AGC 1 1 1 1 1 1
ATA 3 3 3 3 3 3 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 3 3 3 3 3 3 | ACG 2 2 2 2 2 2 | AAG 3 3 3 3 3 3 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 1 1 1 1 1 1 | Asp GAT 5 5 5 5 5 5 | Gly GGT 2 2 2 2 2 2
GTC 4 4 4 4 4 4 | GCC 4 4 4 4 5 4 | GAC 6 6 6 6 6 6 | GGC 1 1 1 1 0 1
GTA 1 1 1 1 1 1 | GCA 6 6 6 6 6 6 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2
GTG 10 10 10 10 10 10 | GCG 3 3 3 3 3 3 | GAG 4 4 4 4 4 4 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908536_1_1908_MLBR_RS09045
position 1: T:0.16327 C:0.23129 A:0.23129 G:0.37415
position 2: T:0.29932 C:0.27891 A:0.22449 G:0.19728
position 3: T:0.21769 C:0.27211 A:0.17687 G:0.33333
Average T:0.22676 C:0.26077 A:0.21088 G:0.30159
#2: NC_002677_1_NP_302215_1_1087_ML1791
position 1: T:0.16327 C:0.23129 A:0.23129 G:0.37415
position 2: T:0.29932 C:0.27891 A:0.22449 G:0.19728
position 3: T:0.21769 C:0.27211 A:0.17687 G:0.33333
Average T:0.22676 C:0.26077 A:0.21088 G:0.30159
#3: NZ_LVXE01000020_1_WP_010908536_1_860_A3216_RS07180
position 1: T:0.16327 C:0.23129 A:0.23129 G:0.37415
position 2: T:0.29932 C:0.27891 A:0.22449 G:0.19728
position 3: T:0.21769 C:0.27211 A:0.17687 G:0.33333
Average T:0.22676 C:0.26077 A:0.21088 G:0.30159
#4: NZ_LYPH01000025_1_WP_010908536_1_1016_A8144_RS04835
position 1: T:0.16327 C:0.23129 A:0.23129 G:0.37415
position 2: T:0.29932 C:0.27891 A:0.22449 G:0.19728
position 3: T:0.21769 C:0.27211 A:0.17687 G:0.33333
Average T:0.22676 C:0.26077 A:0.21088 G:0.30159
#5: NZ_CP029543_1_WP_111481049_1_1937_DIJ64_RS09865
position 1: T:0.16327 C:0.23129 A:0.23129 G:0.37415
position 2: T:0.29932 C:0.28571 A:0.22449 G:0.19048
position 3: T:0.21769 C:0.27211 A:0.17687 G:0.33333
Average T:0.22676 C:0.26304 A:0.21088 G:0.29932
#6: NZ_AP014567_1_WP_010908536_1_1986_JK2ML_RS10110
position 1: T:0.16327 C:0.23129 A:0.23129 G:0.37415
position 2: T:0.29932 C:0.27891 A:0.22449 G:0.19728
position 3: T:0.21769 C:0.27211 A:0.17687 G:0.33333
Average T:0.22676 C:0.26077 A:0.21088 G:0.30159
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 18
TTC 6 | TCC 6 | TAC 6 | TGC 0
Leu L TTA 6 | TCA 18 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 24 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 18 | His H CAT 6 | Arg R CGT 30
CTC 6 | CCC 12 | CAC 18 | CGC 30
CTA 0 | CCA 0 | Gln Q CAA 18 | CGA 0
CTG 12 | CCG 30 | CAG 6 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 0
ATC 30 | ACC 18 | AAC 12 | AGC 6
ATA 18 | ACA 12 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 18 | ACG 12 | AAG 18 | AGG 6
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 6 | Asp D GAT 30 | Gly G GGT 12
GTC 24 | GCC 25 | GAC 36 | GGC 5
GTA 6 | GCA 36 | Glu E GAA 12 | GGA 12
GTG 60 | GCG 18 | GAG 24 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16327 C:0.23129 A:0.23129 G:0.37415
position 2: T:0.29932 C:0.28005 A:0.22449 G:0.19615
position 3: T:0.21769 C:0.27211 A:0.17687 G:0.33333
Average T:0.22676 C:0.26115 A:0.21088 G:0.30121
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -602.009693 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.006742 0.000004 0.000100 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006762
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.006742, 6: 0.000004);
(NC_011896_1_WP_010908536_1_1908_MLBR_RS09045: 0.000004, NC_002677_1_NP_302215_1_1087_ML1791: 0.000004, NZ_LVXE01000020_1_WP_010908536_1_860_A3216_RS07180: 0.000004, NZ_LYPH01000025_1_WP_010908536_1_1016_A8144_RS04835: 0.000004, NZ_CP029543_1_WP_111481049_1_1937_DIJ64_RS09865: 0.006742, NZ_AP014567_1_WP_010908536_1_1986_JK2ML_RS10110: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 331.8 109.2 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 331.8 109.2 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 331.8 109.2 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 331.8 109.2 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.007 331.8 109.2 999.0000 0.0030 0.0000 1.0 0.0
7..6 0.000 331.8 109.2 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0030
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -602.274263 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.006875 0.000004 0.000100 0.368389 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006895
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.006875, 6: 0.000004);
(NC_011896_1_WP_010908536_1_1908_MLBR_RS09045: 0.000004, NC_002677_1_NP_302215_1_1087_ML1791: 0.000004, NZ_LVXE01000020_1_WP_010908536_1_860_A3216_RS07180: 0.000004, NZ_LYPH01000025_1_WP_010908536_1_1016_A8144_RS04835: 0.000004, NZ_CP029543_1_WP_111481049_1_1937_DIJ64_RS09865: 0.006875, NZ_AP014567_1_WP_010908536_1_1986_JK2ML_RS10110: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.36839 0.63161
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 331.8 109.2 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 331.8 109.2 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 331.8 109.2 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 331.8 109.2 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.007 331.8 109.2 1.0000 0.0023 0.0023 0.8 0.3
7..6 0.000 331.8 109.2 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -602.009708 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.006742 0.000004 0.000100 0.000019 0.000000 1.000000 951.460885
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006762
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.006742, 6: 0.000004);
(NC_011896_1_WP_010908536_1_1908_MLBR_RS09045: 0.000004, NC_002677_1_NP_302215_1_1087_ML1791: 0.000004, NZ_LVXE01000020_1_WP_010908536_1_860_A3216_RS07180: 0.000004, NZ_LYPH01000025_1_WP_010908536_1_1016_A8144_RS04835: 0.000004, NZ_CP029543_1_WP_111481049_1_1937_DIJ64_RS09865: 0.006742, NZ_AP014567_1_WP_010908536_1_1986_JK2ML_RS10110: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00002 0.00000 0.99998
w: 1.00000 1.00000 951.46088
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 331.8 109.2 951.4429 0.0000 0.0000 0.0 0.0
7..2 0.000 331.8 109.2 951.4429 0.0000 0.0000 0.0 0.0
7..3 0.000 331.8 109.2 951.4429 0.0000 0.0000 0.0 0.0
7..4 0.000 331.8 109.2 951.4429 0.0000 0.0000 0.0 0.0
7..5 0.007 331.8 109.2 951.4429 0.0030 0.0000 1.0 0.0
7..6 0.000 331.8 109.2 951.4429 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908536_1_1908_MLBR_RS09045)
Pr(w>1) post mean +- SE for w
1 L 1.000** 951.443
2 G 1.000** 951.443
3 K 1.000** 951.443
4 I 1.000** 951.443
5 F 1.000** 951.443
6 I 1.000** 951.443
7 M 1.000** 951.443
8 L 1.000** 951.443
9 P 1.000** 951.443
10 T 1.000** 951.443
11 V 1.000** 951.443
12 T 1.000** 951.443
13 H 1.000** 951.443
14 Q 1.000** 951.443
15 A 1.000** 951.443
16 I 1.000** 951.443
17 T 1.000** 951.443
18 C 1.000** 951.443
19 T 1.000** 951.443
20 V 1.000** 951.443
21 R 1.000** 951.443
22 R 1.000** 951.443
23 V 1.000** 951.443
24 R 1.000** 951.443
25 W 1.000** 951.443
26 I 1.000** 951.443
27 V 1.000** 951.443
28 D 1.000** 951.443
29 A 1.000** 951.443
30 M 1.000** 951.443
31 N 1.000** 951.443
32 V 1.000** 951.443
33 I 1.000** 951.443
34 G 1.000** 951.443
35 T 1.000** 951.443
36 R 1.000** 951.443
37 P 1.000** 951.443
38 D 1.000** 951.443
39 C 1.000** 951.443
40 W 1.000** 951.443
41 W 1.000** 951.443
42 K 1.000** 951.443
43 D 1.000** 951.443
44 R 1.000** 951.443
45 R 1.000** 951.443
46 G 1.000** 951.461
47 A 1.000** 951.443
48 M 1.000** 951.443
49 V 1.000** 951.443
50 R 1.000** 951.443
51 L 1.000** 951.443
52 V 1.000** 951.443
53 G 1.000** 951.443
54 K 1.000** 951.443
55 L 1.000** 951.443
56 E 1.000** 951.443
57 R 1.000** 951.443
58 W 1.000** 951.443
59 A 1.000** 951.443
60 S 1.000** 951.443
61 T 1.000** 951.443
62 E 1.000** 951.443
63 R 1.000** 951.443
64 N 1.000** 951.443
65 H 1.000** 951.443
66 V 1.000** 951.443
67 T 1.000** 951.443
68 V 1.000** 951.443
69 V 1.000** 951.443
70 F 1.000** 951.443
71 E 1.000** 951.443
72 R 1.000** 951.443
73 P 1.000** 951.443
74 P 1.000** 951.443
75 S 1.000** 951.443
76 P 1.000** 951.443
77 S 1.000** 951.443
78 I 1.000** 951.443
79 R 1.000** 951.443
80 S 1.000** 951.443
81 S 1.000** 951.443
82 V 1.000** 951.443
83 I 1.000** 951.443
84 V 1.000** 951.443
85 I 1.000** 951.443
86 A 1.000** 951.443
87 H 1.000** 951.443
88 A 1.000** 951.443
89 P 1.000** 951.443
90 K 1.000** 951.443
91 A 1.000** 951.443
92 F 1.000** 951.443
93 P 1.000** 951.443
94 D 1.000** 951.443
95 S 1.000** 951.443
96 A 1.000** 951.443
97 D 1.000** 951.443
98 D 1.000** 951.443
99 E 1.000** 951.443
100 I 1.000** 951.443
101 V 1.000** 951.443
102 R 1.000** 951.443
103 L 1.000** 951.443
104 V 1.000** 951.443
105 Q 1.000** 951.443
106 A 1.000** 951.443
107 D 1.000** 951.443
108 P 1.000** 951.443
109 E 1.000** 951.443
110 P 1.000** 951.443
111 Q 1.000** 951.443
112 G 1.000** 951.443
113 I 1.000** 951.443
114 C 1.000** 951.443
115 V 1.000** 951.443
116 V 1.000** 951.443
117 T 1.000** 951.443
118 S 1.000** 951.443
119 D 1.000** 951.443
120 S 1.000** 951.443
121 A 1.000** 951.443
122 L 1.000** 951.443
123 T 1.000** 951.443
124 D 1.000** 951.443
125 R 1.000** 951.443
126 V 1.000** 951.443
127 Q 1.000** 951.443
128 E 1.000** 951.443
129 V 1.000** 951.443
130 G 1.000** 951.443
131 A 1.000** 951.443
132 L 1.000** 951.443
133 A 1.000** 951.443
134 Y 1.000** 951.443
135 P 1.000** 951.443
136 A 1.000** 951.443
137 A 1.000** 951.443
138 R 1.000** 951.443
139 F 1.000** 951.443
140 R 1.000** 951.443
141 K 1.000** 951.443
142 H 1.000** 951.443
143 I 1.000** 951.443
144 D 1.000** 951.443
145 S 1.000** 951.443
146 I 1.000** 951.443
147 D 1.000** 951.443
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908536_1_1908_MLBR_RS09045)
Pr(w>1) post mean +- SE for w
46 G 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -602.274263 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.006875 0.000004 0.000100 24.466487 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006895
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.006875, 6: 0.000004);
(NC_011896_1_WP_010908536_1_1908_MLBR_RS09045: 0.000004, NC_002677_1_NP_302215_1_1087_ML1791: 0.000004, NZ_LVXE01000020_1_WP_010908536_1_860_A3216_RS07180: 0.000004, NZ_LYPH01000025_1_WP_010908536_1_1016_A8144_RS04835: 0.000004, NZ_CP029543_1_WP_111481049_1_1937_DIJ64_RS09865: 0.006875, NZ_AP014567_1_WP_010908536_1_1986_JK2ML_RS10110: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 24.46649 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 331.8 109.2 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 331.8 109.2 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 331.8 109.2 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 331.8 109.2 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.007 331.8 109.2 1.0000 0.0023 0.0023 0.8 0.3
7..6 0.000 331.8 109.2 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:18
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -602.009708 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.006742 0.000004 0.000100 0.000010 0.005020 1.889308 951.431017
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006762
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.006742, 6: 0.000004);
(NC_011896_1_WP_010908536_1_1908_MLBR_RS09045: 0.000004, NC_002677_1_NP_302215_1_1087_ML1791: 0.000004, NZ_LVXE01000020_1_WP_010908536_1_860_A3216_RS07180: 0.000004, NZ_LYPH01000025_1_WP_010908536_1_1016_A8144_RS04835: 0.000004, NZ_CP029543_1_WP_111481049_1_1937_DIJ64_RS09865: 0.006742, NZ_AP014567_1_WP_010908536_1_1986_JK2ML_RS10110: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00502 q = 1.88931
(p1 = 0.99999) w = 951.43102
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 951.43102
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 331.8 109.2 951.4215 0.0000 0.0000 0.0 0.0
7..2 0.000 331.8 109.2 951.4215 0.0000 0.0000 0.0 0.0
7..3 0.000 331.8 109.2 951.4215 0.0000 0.0000 0.0 0.0
7..4 0.000 331.8 109.2 951.4215 0.0000 0.0000 0.0 0.0
7..5 0.007 331.8 109.2 951.4215 0.0030 0.0000 1.0 0.0
7..6 0.000 331.8 109.2 951.4215 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908536_1_1908_MLBR_RS09045)
Pr(w>1) post mean +- SE for w
1 L 1.000** 951.421
2 G 1.000** 951.421
3 K 1.000** 951.421
4 I 1.000** 951.421
5 F 1.000** 951.421
6 I 1.000** 951.421
7 M 1.000** 951.421
8 L 1.000** 951.421
9 P 1.000** 951.421
10 T 1.000** 951.421
11 V 1.000** 951.421
12 T 1.000** 951.421
13 H 1.000** 951.421
14 Q 1.000** 951.421
15 A 1.000** 951.421
16 I 1.000** 951.421
17 T 1.000** 951.421
18 C 1.000** 951.421
19 T 1.000** 951.421
20 V 1.000** 951.421
21 R 1.000** 951.421
22 R 1.000** 951.421
23 V 1.000** 951.421
24 R 1.000** 951.421
25 W 1.000** 951.421
26 I 1.000** 951.421
27 V 1.000** 951.421
28 D 1.000** 951.421
29 A 1.000** 951.421
30 M 1.000** 951.421
31 N 1.000** 951.421
32 V 1.000** 951.421
33 I 1.000** 951.421
34 G 1.000** 951.421
35 T 1.000** 951.421
36 R 1.000** 951.421
37 P 1.000** 951.421
38 D 1.000** 951.421
39 C 1.000** 951.421
40 W 1.000** 951.421
41 W 1.000** 951.421
42 K 1.000** 951.421
43 D 1.000** 951.421
44 R 1.000** 951.421
45 R 1.000** 951.421
46 G 1.000** 951.431
47 A 1.000** 951.421
48 M 1.000** 951.421
49 V 1.000** 951.421
50 R 1.000** 951.421
51 L 1.000** 951.421
52 V 1.000** 951.421
53 G 1.000** 951.421
54 K 1.000** 951.421
55 L 1.000** 951.421
56 E 1.000** 951.421
57 R 1.000** 951.421
58 W 1.000** 951.421
59 A 1.000** 951.421
60 S 1.000** 951.421
61 T 1.000** 951.421
62 E 1.000** 951.421
63 R 1.000** 951.421
64 N 1.000** 951.421
65 H 1.000** 951.421
66 V 1.000** 951.421
67 T 1.000** 951.421
68 V 1.000** 951.421
69 V 1.000** 951.421
70 F 1.000** 951.421
71 E 1.000** 951.421
72 R 1.000** 951.421
73 P 1.000** 951.421
74 P 1.000** 951.421
75 S 1.000** 951.421
76 P 1.000** 951.421
77 S 1.000** 951.421
78 I 1.000** 951.421
79 R 1.000** 951.421
80 S 1.000** 951.421
81 S 1.000** 951.421
82 V 1.000** 951.421
83 I 1.000** 951.421
84 V 1.000** 951.421
85 I 1.000** 951.421
86 A 1.000** 951.421
87 H 1.000** 951.421
88 A 1.000** 951.421
89 P 1.000** 951.421
90 K 1.000** 951.421
91 A 1.000** 951.421
92 F 1.000** 951.421
93 P 1.000** 951.421
94 D 1.000** 951.421
95 S 1.000** 951.421
96 A 1.000** 951.421
97 D 1.000** 951.421
98 D 1.000** 951.421
99 E 1.000** 951.421
100 I 1.000** 951.421
101 V 1.000** 951.421
102 R 1.000** 951.421
103 L 1.000** 951.421
104 V 1.000** 951.421
105 Q 1.000** 951.421
106 A 1.000** 951.421
107 D 1.000** 951.421
108 P 1.000** 951.421
109 E 1.000** 951.421
110 P 1.000** 951.421
111 Q 1.000** 951.421
112 G 1.000** 951.421
113 I 1.000** 951.421
114 C 1.000** 951.421
115 V 1.000** 951.421
116 V 1.000** 951.421
117 T 1.000** 951.421
118 S 1.000** 951.421
119 D 1.000** 951.421
120 S 1.000** 951.421
121 A 1.000** 951.421
122 L 1.000** 951.421
123 T 1.000** 951.421
124 D 1.000** 951.421
125 R 1.000** 951.421
126 V 1.000** 951.421
127 Q 1.000** 951.421
128 E 1.000** 951.421
129 V 1.000** 951.421
130 G 1.000** 951.421
131 A 1.000** 951.421
132 L 1.000** 951.421
133 A 1.000** 951.421
134 Y 1.000** 951.421
135 P 1.000** 951.421
136 A 1.000** 951.421
137 A 1.000** 951.421
138 R 1.000** 951.421
139 F 1.000** 951.421
140 R 1.000** 951.421
141 K 1.000** 951.421
142 H 1.000** 951.421
143 I 1.000** 951.421
144 D 1.000** 951.421
145 S 1.000** 951.421
146 I 1.000** 951.421
147 D 1.000** 951.421
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908536_1_1908_MLBR_RS09045)
Pr(w>1) post mean +- SE for w
1 L 0.639 4.860 +- 3.856
2 G 0.639 4.860 +- 3.856
3 K 0.639 4.860 +- 3.856
4 I 0.639 4.860 +- 3.856
5 F 0.639 4.860 +- 3.856
6 I 0.639 4.860 +- 3.856
7 M 0.639 4.860 +- 3.856
8 L 0.639 4.860 +- 3.856
9 P 0.639 4.860 +- 3.856
10 T 0.639 4.860 +- 3.856
11 V 0.639 4.860 +- 3.856
12 T 0.639 4.860 +- 3.856
13 H 0.639 4.860 +- 3.856
14 Q 0.639 4.860 +- 3.856
15 A 0.639 4.860 +- 3.856
16 I 0.639 4.860 +- 3.856
17 T 0.639 4.860 +- 3.856
18 C 0.639 4.860 +- 3.856
19 T 0.639 4.860 +- 3.856
20 V 0.639 4.860 +- 3.856
21 R 0.639 4.860 +- 3.856
22 R 0.639 4.860 +- 3.856
23 V 0.639 4.860 +- 3.856
24 R 0.639 4.860 +- 3.856
25 W 0.639 4.860 +- 3.856
26 I 0.639 4.860 +- 3.856
27 V 0.639 4.860 +- 3.856
28 D 0.639 4.860 +- 3.856
29 A 0.639 4.860 +- 3.856
30 M 0.639 4.860 +- 3.856
31 N 0.639 4.860 +- 3.856
32 V 0.639 4.860 +- 3.856
33 I 0.639 4.860 +- 3.856
34 G 0.639 4.860 +- 3.856
35 T 0.639 4.860 +- 3.856
36 R 0.639 4.860 +- 3.856
37 P 0.639 4.860 +- 3.856
38 D 0.639 4.860 +- 3.856
39 C 0.639 4.860 +- 3.856
40 W 0.639 4.860 +- 3.856
41 W 0.639 4.860 +- 3.856
42 K 0.639 4.860 +- 3.856
43 D 0.639 4.860 +- 3.856
44 R 0.639 4.860 +- 3.856
45 R 0.639 4.860 +- 3.856
46 G 0.923 6.858 +- 3.003
47 A 0.639 4.860 +- 3.856
48 M 0.639 4.860 +- 3.856
49 V 0.639 4.860 +- 3.856
50 R 0.639 4.860 +- 3.856
51 L 0.639 4.860 +- 3.856
52 V 0.639 4.860 +- 3.856
53 G 0.639 4.860 +- 3.856
54 K 0.639 4.860 +- 3.856
55 L 0.639 4.860 +- 3.856
56 E 0.639 4.860 +- 3.856
57 R 0.639 4.860 +- 3.856
58 W 0.639 4.860 +- 3.856
59 A 0.639 4.860 +- 3.856
60 S 0.639 4.860 +- 3.856
61 T 0.639 4.860 +- 3.856
62 E 0.639 4.860 +- 3.856
63 R 0.639 4.860 +- 3.856
64 N 0.639 4.860 +- 3.856
65 H 0.639 4.860 +- 3.856
66 V 0.639 4.860 +- 3.856
67 T 0.639 4.860 +- 3.856
68 V 0.639 4.860 +- 3.856
69 V 0.639 4.860 +- 3.856
70 F 0.639 4.860 +- 3.856
71 E 0.639 4.860 +- 3.856
72 R 0.639 4.860 +- 3.856
73 P 0.639 4.860 +- 3.856
74 P 0.639 4.860 +- 3.856
75 S 0.639 4.860 +- 3.856
76 P 0.639 4.860 +- 3.856
77 S 0.639 4.860 +- 3.856
78 I 0.639 4.860 +- 3.856
79 R 0.639 4.860 +- 3.856
80 S 0.639 4.860 +- 3.856
81 S 0.639 4.860 +- 3.856
82 V 0.639 4.860 +- 3.856
83 I 0.639 4.860 +- 3.856
84 V 0.639 4.860 +- 3.856
85 I 0.639 4.860 +- 3.856
86 A 0.639 4.860 +- 3.856
87 H 0.639 4.860 +- 3.856
88 A 0.639 4.860 +- 3.856
89 P 0.639 4.860 +- 3.856
90 K 0.639 4.860 +- 3.856
91 A 0.639 4.860 +- 3.856
92 F 0.639 4.860 +- 3.856
93 P 0.639 4.860 +- 3.856
94 D 0.639 4.860 +- 3.856
95 S 0.639 4.860 +- 3.856
96 A 0.639 4.860 +- 3.856
97 D 0.639 4.860 +- 3.856
98 D 0.639 4.860 +- 3.856
99 E 0.639 4.860 +- 3.856
100 I 0.639 4.860 +- 3.856
101 V 0.639 4.860 +- 3.856
102 R 0.639 4.860 +- 3.856
103 L 0.639 4.860 +- 3.856
104 V 0.639 4.860 +- 3.856
105 Q 0.639 4.860 +- 3.856
106 A 0.639 4.860 +- 3.856
107 D 0.639 4.860 +- 3.856
108 P 0.639 4.860 +- 3.856
109 E 0.639 4.860 +- 3.856
110 P 0.639 4.860 +- 3.856
111 Q 0.639 4.860 +- 3.856
112 G 0.639 4.860 +- 3.856
113 I 0.639 4.860 +- 3.856
114 C 0.639 4.860 +- 3.856
115 V 0.639 4.860 +- 3.856
116 V 0.639 4.860 +- 3.856
117 T 0.639 4.860 +- 3.856
118 S 0.639 4.860 +- 3.856
119 D 0.639 4.860 +- 3.856
120 S 0.639 4.860 +- 3.856
121 A 0.639 4.860 +- 3.856
122 L 0.639 4.860 +- 3.856
123 T 0.639 4.860 +- 3.856
124 D 0.639 4.860 +- 3.856
125 R 0.639 4.860 +- 3.856
126 V 0.639 4.860 +- 3.856
127 Q 0.639 4.860 +- 3.856
128 E 0.639 4.860 +- 3.856
129 V 0.639 4.860 +- 3.856
130 G 0.639 4.860 +- 3.856
131 A 0.639 4.860 +- 3.856
132 L 0.639 4.860 +- 3.856
133 A 0.639 4.860 +- 3.856
134 Y 0.639 4.860 +- 3.856
135 P 0.639 4.860 +- 3.856
136 A 0.639 4.860 +- 3.856
137 A 0.639 4.860 +- 3.856
138 R 0.639 4.860 +- 3.856
139 F 0.639 4.860 +- 3.856
140 R 0.639 4.860 +- 3.856
141 K 0.639 4.860 +- 3.856
142 H 0.639 4.860 +- 3.856
143 I 0.639 4.860 +- 3.856
144 D 0.639 4.860 +- 3.856
145 S 0.639 4.860 +- 3.856
146 I 0.639 4.860 +- 3.856
147 D 0.639 4.860 +- 3.856
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:30
Model 1: NearlyNeutral -602.274263 Model 2: PositiveSelection -602.009708 Model 0: one-ratio -602.009693 Model 7: beta -602.274263 Model 8: beta&w>1 -602.009708 Model 0 vs 1 0.5291400000000976 Model 2 vs 1 0.529109999999946 Model 8 vs 7 0.529109999999946
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
