--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:42:20 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1796/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -575.71 -579.96
2 -575.54 -579.27
--------------------------------------
TOTAL -575.62 -579.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.872374 0.089171 0.333549 1.460786 0.837809 1384.70 1398.59 1.000
r(A<->C){all} 0.131734 0.015087 0.000129 0.396826 0.095132 180.80 258.65 1.001
r(A<->G){all} 0.171518 0.020103 0.000036 0.459507 0.134820 129.01 188.81 1.010
r(A<->T){all} 0.158093 0.019537 0.000112 0.443362 0.114838 198.22 245.63 1.001
r(C<->G){all} 0.228255 0.029763 0.000026 0.564118 0.190702 131.19 171.50 1.020
r(C<->T){all} 0.142863 0.016044 0.000010 0.401790 0.105873 189.81 244.26 1.002
r(G<->T){all} 0.167537 0.019543 0.000011 0.442787 0.133778 115.49 158.54 1.001
pi(A){all} 0.287759 0.000495 0.243239 0.328695 0.287397 1290.77 1395.89 1.000
pi(C){all} 0.298968 0.000523 0.254467 0.342288 0.298965 1184.74 1218.20 1.000
pi(G){all} 0.231859 0.000423 0.193587 0.273499 0.231004 1258.15 1341.52 1.000
pi(T){all} 0.181413 0.000365 0.143086 0.218639 0.180750 1029.24 1265.12 1.000
alpha{1,2} 0.325781 0.131832 0.000363 1.072983 0.212697 1121.87 1229.34 1.003
alpha{3} 0.405462 0.231152 0.000139 1.401608 0.233517 1237.14 1292.08 1.000
pinvar{all} 0.991464 0.000050 0.977720 0.999626 0.993428 1427.45 1434.62 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -544.427671
Model 2: PositiveSelection -544.255239
Model 0: one-ratio -544.25523
Model 7: beta -544.427672
Model 8: beta&w>1 -544.428664
Model 0 vs 1 0.34488200000009783
Model 2 vs 1 0.3448640000001433
Model 8 vs 7 0.0019839999999931024
>C1
MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
>C2
MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
>C3
MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
>C4
MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
>C5
MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
>C6
MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTENRAG
IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=137
C1 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
C2 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
C3 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
C4 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
C5 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
C6 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
**************************************************
C1 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
C2 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
C3 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
C4 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
C5 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
C6 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTENRAG
*********************************************:****
C1 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
C2 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
C3 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
C4 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
C5 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
C6 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
*************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4110]--->[4110]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.463 Mb, Max= 30.668 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
C2 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
C3 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
C4 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
C5 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
C6 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
**************************************************
C1 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
C2 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
C3 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
C4 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
C5 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
C6 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTENRAG
*********************************************:****
C1 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
C2 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
C3 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
C4 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
C5 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
C6 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
*************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.27 C1 C6 99.27
TOP 5 0 99.27 C6 C1 99.27
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.27 C2 C6 99.27
TOP 5 1 99.27 C6 C2 99.27
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.27 C3 C6 99.27
TOP 5 2 99.27 C6 C3 99.27
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.27 C4 C6 99.27
TOP 5 3 99.27 C6 C4 99.27
BOT 4 5 99.27 C5 C6 99.27
TOP 5 4 99.27 C6 C5 99.27
AVG 0 C1 * 99.85
AVG 1 C2 * 99.85
AVG 2 C3 * 99.85
AVG 3 C4 * 99.85
AVG 4 C5 * 99.85
AVG 5 C6 * 99.27
TOT TOT * 99.76
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA
C2 ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA
C3 ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA
C4 ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA
C5 ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA
C6 ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA
**************************************************
C1 CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT
C2 CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT
C3 CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT
C4 CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT
C5 CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT
C6 CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT
**************************************************
C1 TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC
C2 TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC
C3 TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC
C4 TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC
C5 TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC
C6 TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC
**************************************************
C1 GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG
C2 GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG
C3 GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG
C4 GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG
C5 GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG
C6 GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG
**************************************************
C1 AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG
C2 AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG
C3 AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG
C4 AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG
C5 AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG
C6 AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG
**************************************************
C1 AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCCAAAACCGAGCGGGA
C2 AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCCAAAACCGAGCGGGA
C3 AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCCAAAACCGAGCGGGA
C4 AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCCAAAACCGAGCGGGA
C5 AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCCAAAACCGAGCGGGA
C6 AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCGAAAACCGAGCGGGA
*********************************** **************
C1 ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA
C2 ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA
C3 ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA
C4 ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA
C5 ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA
C6 ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA
**************************************************
C1 CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG
C2 CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG
C3 CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG
C4 CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG
C5 CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG
C6 CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG
**************************************************
C1 CTGCGGCTGGC
C2 CTGCGGCTGGC
C3 CTGCGGCTGGC
C4 CTGCGGCTGGC
C5 CTGCGGCTGGC
C6 CTGCGGCTGGC
***********
>C1
ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA
CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT
TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC
GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG
AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG
AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCCAAAACCGAGCGGGA
ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA
CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG
CTGCGGCTGGC
>C2
ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA
CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT
TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC
GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG
AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG
AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCCAAAACCGAGCGGGA
ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA
CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG
CTGCGGCTGGC
>C3
ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA
CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT
TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC
GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG
AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG
AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCCAAAACCGAGCGGGA
ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA
CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG
CTGCGGCTGGC
>C4
ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA
CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT
TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC
GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG
AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG
AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCCAAAACCGAGCGGGA
ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA
CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG
CTGCGGCTGGC
>C5
ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA
CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT
TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC
GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG
AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG
AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCCAAAACCGAGCGGGA
ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA
CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG
CTGCGGCTGGC
>C6
ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA
CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT
TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC
GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG
AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG
AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCGAAAACCGAGCGGGA
ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA
CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG
CTGCGGCTGGC
>C1
MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
>C2
MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
>C3
MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
>C4
MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
>C5
MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
>C6
MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTENRAG
IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 411 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579858849
Setting output file names to "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1349246430
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5565402287
Seed = 1784078443
Swapseed = 1579858849
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 5 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -923.240571 -- -24.965149
Chain 2 -- -923.240571 -- -24.965149
Chain 3 -- -923.240571 -- -24.965149
Chain 4 -- -923.240571 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -923.239021 -- -24.965149
Chain 2 -- -923.240571 -- -24.965149
Chain 3 -- -923.239021 -- -24.965149
Chain 4 -- -923.238970 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-923.241] (-923.241) (-923.241) (-923.241) * [-923.239] (-923.241) (-923.239) (-923.239)
500 -- (-585.200) (-578.890) [-579.195] (-580.560) * (-582.521) (-579.451) (-582.610) [-581.559] -- 0:00:00
1000 -- (-588.954) [-580.747] (-583.017) (-580.703) * (-583.570) (-577.659) [-582.287] (-576.732) -- 0:00:00
1500 -- (-584.037) (-585.441) [-582.723] (-584.903) * (-580.276) [-584.503] (-581.362) (-578.076) -- 0:00:00
2000 -- (-578.323) (-580.418) [-581.266] (-575.934) * (-589.015) [-581.941] (-582.407) (-582.407) -- 0:00:00
2500 -- (-579.154) (-582.064) [-588.289] (-578.398) * (-584.298) [-576.693] (-586.807) (-583.063) -- 0:00:00
3000 -- (-584.637) [-583.714] (-577.669) (-585.994) * (-581.788) (-581.035) [-586.959] (-579.064) -- 0:00:00
3500 -- (-580.393) (-583.227) [-583.880] (-580.022) * (-592.305) (-581.535) [-580.954] (-584.679) -- 0:00:00
4000 -- (-582.886) (-583.192) [-582.233] (-579.882) * (-586.435) (-579.351) (-578.950) [-588.946] -- 0:00:00
4500 -- (-578.375) (-583.530) [-576.211] (-580.754) * [-578.634] (-584.968) (-592.065) (-583.825) -- 0:00:00
5000 -- (-583.857) [-581.201] (-587.841) (-583.577) * [-581.176] (-583.577) (-584.383) (-578.915) -- 0:00:00
Average standard deviation of split frequencies: 0.075151
5500 -- (-585.810) (-584.773) [-585.843] (-581.212) * (-585.373) [-583.418] (-584.908) (-582.805) -- 0:00:00
6000 -- (-580.136) (-584.430) [-586.200] (-586.315) * (-583.027) [-577.854] (-590.193) (-583.351) -- 0:00:00
6500 -- [-579.904] (-574.867) (-587.125) (-593.681) * (-578.998) (-588.912) (-584.955) [-582.359] -- 0:00:00
7000 -- [-575.927] (-580.926) (-576.083) (-584.442) * (-584.972) (-591.180) [-583.941] (-579.249) -- 0:00:00
7500 -- (-586.545) (-581.727) [-574.909] (-582.007) * [-579.322] (-578.190) (-576.781) (-580.018) -- 0:00:00
8000 -- (-579.431) [-582.323] (-581.768) (-575.947) * (-582.400) [-581.729] (-576.302) (-588.068) -- 0:00:00
8500 -- (-575.957) [-582.063] (-585.896) (-588.690) * (-579.037) (-575.882) (-580.195) [-576.547] -- 0:00:00
9000 -- (-578.051) (-582.826) (-581.848) [-577.930] * [-580.270] (-590.198) (-579.024) (-579.893) -- 0:00:00
9500 -- [-575.334] (-576.324) (-578.955) (-579.032) * (-581.512) (-579.344) (-579.083) [-577.421] -- 0:00:00
10000 -- (-578.649) (-589.853) [-576.749] (-580.969) * (-579.171) (-582.709) [-582.048] (-589.415) -- 0:00:00
Average standard deviation of split frequencies: 0.090844
10500 -- (-575.010) [-580.134] (-584.511) (-580.454) * [-585.526] (-579.933) (-576.345) (-584.787) -- 0:01:34
11000 -- (-574.598) (-585.729) (-591.702) [-579.703] * [-579.062] (-588.685) (-577.616) (-586.527) -- 0:01:29
11500 -- (-576.436) (-585.082) [-577.136] (-581.257) * (-582.624) (-582.289) (-579.638) [-583.568] -- 0:01:25
12000 -- (-575.593) (-580.554) [-580.442] (-577.721) * (-579.868) [-585.170] (-578.147) (-581.283) -- 0:01:22
12500 -- (-578.111) [-579.795] (-583.186) (-574.826) * (-575.709) [-577.692] (-576.579) (-585.018) -- 0:01:19
13000 -- (-580.342) (-580.666) (-578.554) [-573.773] * [-585.075] (-584.407) (-576.027) (-586.473) -- 0:01:15
13500 -- (-577.313) [-585.814] (-579.744) (-585.075) * (-580.976) (-588.866) (-576.586) [-580.557] -- 0:01:13
14000 -- (-578.287) (-583.103) (-578.230) [-580.305] * [-580.508] (-586.858) (-575.840) (-579.970) -- 0:01:10
14500 -- (-577.659) [-584.487] (-589.063) (-580.564) * [-579.889] (-595.511) (-582.611) (-585.389) -- 0:01:07
15000 -- (-580.725) (-583.876) [-580.777] (-585.378) * (-585.938) [-578.461] (-577.539) (-590.126) -- 0:01:05
Average standard deviation of split frequencies: 0.082496
15500 -- [-576.028] (-582.198) (-590.516) (-576.390) * [-580.981] (-588.770) (-576.006) (-581.969) -- 0:01:03
16000 -- (-575.266) (-586.092) (-582.556) [-581.509] * (-588.792) (-577.613) (-579.125) [-575.331] -- 0:01:01
16500 -- (-575.140) (-585.224) [-583.337] (-580.221) * [-580.571] (-578.161) (-579.048) (-578.398) -- 0:00:59
17000 -- (-577.463) (-585.310) (-582.817) [-583.868] * [-581.374] (-578.168) (-576.324) (-579.030) -- 0:00:57
17500 -- (-576.140) (-581.519) (-585.553) [-581.546] * (-575.389) (-576.686) (-582.096) [-575.720] -- 0:00:56
18000 -- (-575.626) [-580.913] (-579.013) (-578.987) * [-581.493] (-577.284) (-578.605) (-579.473) -- 0:00:54
18500 -- [-576.190] (-583.384) (-579.030) (-581.044) * (-576.788) (-577.288) (-577.563) [-583.352] -- 0:00:53
19000 -- (-578.875) [-577.265] (-589.354) (-586.273) * (-584.743) (-578.570) (-577.633) [-579.686] -- 0:00:51
19500 -- (-576.049) [-581.031] (-587.337) (-584.757) * [-578.864] (-579.749) (-576.656) (-576.035) -- 0:00:50
20000 -- [-575.177] (-579.971) (-577.850) (-581.020) * [-578.455] (-580.917) (-576.238) (-584.052) -- 0:00:49
Average standard deviation of split frequencies: 0.067289
20500 -- [-579.144] (-585.850) (-577.338) (-586.256) * (-587.134) (-577.191) [-575.439] (-579.298) -- 0:00:47
21000 -- (-575.253) (-587.252) (-578.698) [-576.749] * (-582.390) (-580.104) [-576.343] (-588.795) -- 0:00:46
21500 -- (-575.865) [-580.459] (-577.682) (-578.954) * (-581.877) (-577.931) (-577.448) [-582.391] -- 0:00:45
22000 -- (-579.687) (-583.926) (-577.233) [-576.968] * [-581.696] (-576.308) (-579.479) (-586.031) -- 0:00:44
22500 -- (-577.423) [-579.005] (-579.044) (-581.713) * (-581.051) (-575.360) (-578.827) [-580.128] -- 0:00:43
23000 -- (-581.333) (-578.507) [-576.077] (-589.463) * (-590.031) (-577.233) [-576.408] (-580.731) -- 0:00:42
23500 -- (-577.632) [-582.000] (-577.075) (-589.473) * [-589.167] (-578.937) (-577.756) (-577.603) -- 0:00:41
24000 -- (-575.806) (-578.458) [-578.629] (-590.898) * (-579.172) (-578.277) (-578.735) [-578.300] -- 0:00:40
24500 -- (-575.943) [-578.717] (-578.132) (-579.545) * (-581.732) [-576.849] (-576.519) (-575.852) -- 0:00:39
25000 -- [-575.331] (-580.825) (-576.195) (-578.320) * [-579.348] (-577.172) (-579.588) (-581.426) -- 0:00:39
Average standard deviation of split frequencies: 0.052816
25500 -- (-575.964) (-583.194) (-575.819) [-581.461] * (-582.590) [-575.668] (-575.714) (-583.351) -- 0:01:16
26000 -- (-576.325) (-596.514) (-579.050) [-580.713] * (-579.042) [-581.527] (-577.321) (-581.133) -- 0:01:14
26500 -- (-576.916) (-576.297) (-578.806) [-582.566] * (-581.617) (-578.989) [-582.077] (-578.743) -- 0:01:13
27000 -- (-577.141) [-575.519] (-574.877) (-582.194) * (-593.626) [-580.411] (-578.121) (-579.199) -- 0:01:12
27500 -- (-575.276) [-575.585] (-578.874) (-586.826) * (-594.011) [-577.528] (-579.319) (-578.517) -- 0:01:10
28000 -- (-576.831) [-577.842] (-574.527) (-577.104) * (-589.948) [-578.248] (-577.042) (-582.649) -- 0:01:09
28500 -- (-578.473) [-576.237] (-575.923) (-576.676) * (-578.148) (-582.390) (-578.807) [-582.103] -- 0:01:08
29000 -- (-579.216) [-575.330] (-575.594) (-576.971) * [-578.820] (-579.309) (-577.130) (-581.181) -- 0:01:06
29500 -- (-576.537) (-578.905) (-574.598) [-575.872] * (-574.747) [-578.134] (-576.792) (-584.760) -- 0:01:05
30000 -- (-577.500) [-577.811] (-574.174) (-575.771) * (-574.763) (-575.627) [-579.372] (-579.627) -- 0:01:04
Average standard deviation of split frequencies: 0.038430
30500 -- (-575.799) (-582.075) (-574.667) [-576.089] * (-573.423) [-575.465] (-577.931) (-591.287) -- 0:01:03
31000 -- (-575.378) [-577.000] (-575.348) (-576.858) * (-576.158) [-576.923] (-578.708) (-590.976) -- 0:01:02
31500 -- (-576.716) (-575.965) [-577.394] (-573.791) * (-575.060) (-579.735) (-580.500) [-580.063] -- 0:01:01
32000 -- (-574.922) (-573.851) [-578.459] (-576.020) * [-573.952] (-576.212) (-576.504) (-581.372) -- 0:01:00
32500 -- (-575.071) [-577.213] (-574.765) (-576.954) * (-577.229) (-579.494) [-583.684] (-578.448) -- 0:00:59
33000 -- (-575.602) [-578.270] (-577.091) (-578.354) * (-574.027) (-583.295) (-578.034) [-576.450] -- 0:00:58
33500 -- (-576.951) (-578.635) [-574.809] (-579.960) * (-573.747) (-578.776) (-579.568) [-578.778] -- 0:00:57
34000 -- (-575.049) [-578.070] (-576.034) (-575.823) * (-577.960) [-577.002] (-580.848) (-585.851) -- 0:00:56
34500 -- (-575.201) (-575.992) [-576.818] (-578.909) * (-577.053) [-578.955] (-575.310) (-590.197) -- 0:00:55
35000 -- (-575.587) (-576.466) (-576.712) [-577.584] * (-574.980) (-577.022) [-577.433] (-577.099) -- 0:00:55
Average standard deviation of split frequencies: 0.026844
35500 -- (-579.573) (-578.920) [-576.274] (-575.240) * (-575.655) (-579.553) (-576.636) [-585.070] -- 0:00:54
36000 -- (-580.949) (-576.619) [-574.917] (-575.647) * [-578.089] (-576.351) (-577.938) (-584.803) -- 0:00:53
36500 -- (-585.116) (-583.291) [-573.650] (-574.639) * (-574.990) (-579.077) [-578.725] (-578.759) -- 0:00:52
37000 -- (-578.530) [-574.738] (-577.962) (-576.088) * (-573.833) (-576.094) (-577.809) [-577.814] -- 0:00:52
37500 -- [-573.901] (-577.878) (-574.295) (-576.717) * [-575.944] (-577.418) (-578.273) (-585.131) -- 0:00:51
38000 -- (-576.270) (-576.521) (-576.631) [-578.410] * (-578.328) (-574.950) (-579.683) [-578.777] -- 0:00:50
38500 -- (-576.835) [-576.323] (-575.360) (-578.466) * [-575.739] (-579.443) (-576.103) (-574.373) -- 0:00:49
39000 -- [-574.758] (-576.542) (-576.870) (-577.910) * (-575.623) (-576.561) [-576.232] (-575.382) -- 0:00:49
39500 -- (-574.877) (-576.517) (-583.079) [-575.284] * (-574.836) (-574.317) (-578.595) [-574.528] -- 0:00:48
40000 -- (-574.857) (-581.124) [-575.138] (-578.574) * (-574.422) (-575.758) (-580.000) [-575.762] -- 0:00:48
Average standard deviation of split frequencies: 0.029624
40500 -- (-575.133) (-580.733) (-579.154) [-575.006] * (-574.841) (-577.052) [-577.634] (-576.902) -- 0:00:47
41000 -- (-576.283) (-580.337) (-574.704) [-576.055] * [-574.116] (-575.399) (-579.251) (-580.961) -- 0:00:46
41500 -- (-576.531) (-577.233) (-580.226) [-575.713] * (-578.204) (-575.207) (-577.672) [-576.538] -- 0:01:09
42000 -- (-576.189) (-577.118) [-576.001] (-578.973) * (-575.146) [-574.801] (-577.251) (-576.502) -- 0:01:08
42500 -- (-574.601) (-575.748) (-577.412) [-576.494] * (-575.660) [-574.565] (-580.987) (-586.286) -- 0:01:07
43000 -- (-574.746) (-576.035) (-576.995) [-575.251] * (-574.418) (-579.215) (-581.124) [-578.628] -- 0:01:06
43500 -- (-576.748) (-577.475) (-580.395) [-576.923] * (-574.259) (-579.333) (-581.446) [-575.897] -- 0:01:05
44000 -- (-577.545) (-576.064) (-577.262) [-577.670] * (-576.919) (-577.712) (-577.342) [-577.927] -- 0:01:05
44500 -- (-578.858) (-578.087) (-577.258) [-576.190] * (-575.463) (-575.859) [-577.784] (-577.449) -- 0:01:04
45000 -- (-577.350) (-575.092) [-577.787] (-576.168) * (-577.030) (-575.978) (-579.297) [-576.504] -- 0:01:03
Average standard deviation of split frequencies: 0.024595
45500 -- (-578.563) (-577.370) [-578.048] (-577.173) * (-575.299) (-577.183) [-577.850] (-576.023) -- 0:01:02
46000 -- (-575.359) (-578.142) (-578.709) [-576.703] * (-574.798) (-578.149) (-576.941) [-580.322] -- 0:01:02
46500 -- [-577.754] (-577.313) (-574.485) (-575.837) * [-575.732] (-578.833) (-574.584) (-575.738) -- 0:01:01
47000 -- (-577.296) (-577.774) [-575.044] (-576.559) * (-573.794) [-576.201] (-575.631) (-578.757) -- 0:01:00
47500 -- (-577.812) [-576.929] (-576.621) (-577.933) * (-574.676) (-578.089) [-579.528] (-578.643) -- 0:01:00
48000 -- (-576.411) (-575.947) [-576.227] (-582.528) * [-574.663] (-575.133) (-578.442) (-576.614) -- 0:00:59
48500 -- (-577.006) [-575.454] (-580.293) (-576.535) * (-576.100) (-575.483) [-576.063] (-576.639) -- 0:00:58
49000 -- (-577.199) (-577.267) [-574.507] (-576.013) * (-578.712) [-576.044] (-577.854) (-577.993) -- 0:00:58
49500 -- [-578.217] (-577.736) (-579.084) (-576.338) * (-576.126) (-574.124) (-579.363) [-578.483] -- 0:00:57
50000 -- (-577.698) (-577.271) [-580.392] (-578.743) * (-576.260) (-582.109) [-575.392] (-576.581) -- 0:00:57
Average standard deviation of split frequencies: 0.024656
50500 -- (-579.288) (-582.064) [-574.114] (-577.245) * (-576.752) (-574.620) [-575.775] (-577.383) -- 0:00:56
51000 -- (-575.412) [-581.014] (-574.861) (-576.902) * (-573.655) (-578.102) [-577.186] (-579.614) -- 0:00:55
51500 -- (-580.019) (-575.975) [-574.779] (-576.480) * (-576.308) (-580.387) (-575.995) [-577.504] -- 0:00:55
52000 -- (-576.033) [-578.249] (-574.856) (-577.789) * (-578.816) (-577.406) (-577.518) [-574.999] -- 0:00:54
52500 -- (-580.567) (-579.554) (-574.073) [-576.569] * (-579.275) [-577.282] (-578.428) (-574.824) -- 0:00:54
53000 -- (-581.451) (-581.164) (-575.964) [-576.872] * (-579.802) (-579.918) (-578.760) [-575.977] -- 0:00:53
53500 -- (-578.376) (-576.672) (-576.345) [-578.747] * (-580.139) (-581.063) (-576.896) [-573.893] -- 0:00:53
54000 -- (-578.643) (-577.711) (-581.730) [-574.176] * (-579.306) (-578.800) [-580.063] (-577.797) -- 0:00:52
54500 -- [-576.813] (-577.447) (-580.006) (-585.715) * (-579.818) (-577.013) [-576.867] (-574.974) -- 0:00:52
55000 -- (-578.982) (-577.495) [-576.414] (-576.026) * (-577.399) (-577.316) (-577.263) [-574.986] -- 0:00:51
Average standard deviation of split frequencies: 0.027592
55500 -- (-576.802) (-577.072) (-576.496) [-574.630] * (-576.505) (-576.678) (-577.841) [-575.726] -- 0:00:51
56000 -- (-584.673) (-578.047) (-577.199) [-573.634] * (-578.340) (-576.720) [-577.644] (-576.522) -- 0:00:50
56500 -- (-581.224) (-579.946) (-578.094) [-574.807] * (-578.008) (-576.578) (-577.027) [-577.563] -- 0:00:50
57000 -- (-577.511) (-577.324) [-577.156] (-576.983) * (-573.540) (-578.799) [-578.256] (-578.939) -- 0:00:49
57500 -- [-579.775] (-576.594) (-579.942) (-578.785) * (-576.637) (-577.360) [-576.370] (-575.583) -- 0:01:05
58000 -- (-577.845) (-576.422) (-578.572) [-573.745] * (-576.129) [-576.617] (-575.365) (-576.251) -- 0:01:04
58500 -- [-576.109] (-577.574) (-576.291) (-574.630) * (-576.856) [-574.906] (-578.444) (-575.924) -- 0:01:04
59000 -- (-580.579) (-576.713) (-575.718) [-575.805] * [-576.373] (-579.334) (-573.955) (-580.182) -- 0:01:03
59500 -- (-577.134) (-578.241) (-576.403) [-574.853] * (-576.738) [-575.385] (-577.216) (-580.025) -- 0:01:03
60000 -- (-576.370) [-578.945] (-578.512) (-573.467) * (-577.946) [-576.814] (-575.031) (-576.097) -- 0:01:02
Average standard deviation of split frequencies: 0.023743
60500 -- (-575.022) (-578.806) [-577.496] (-575.942) * (-582.108) (-581.626) [-574.932] (-577.606) -- 0:01:02
61000 -- (-578.033) (-574.118) (-575.455) [-578.055] * (-577.928) [-574.238] (-576.270) (-576.547) -- 0:01:01
61500 -- (-576.478) (-574.713) [-573.761] (-572.749) * (-574.924) [-575.352] (-581.743) (-576.038) -- 0:01:01
62000 -- (-576.135) (-574.362) [-573.680] (-576.927) * [-578.607] (-575.531) (-576.876) (-576.079) -- 0:01:00
62500 -- [-576.357] (-576.298) (-576.502) (-577.829) * (-577.419) [-575.208] (-579.702) (-575.738) -- 0:01:00
63000 -- (-577.395) (-576.036) (-578.169) [-575.264] * [-577.254] (-577.687) (-578.411) (-580.690) -- 0:00:59
63500 -- (-577.699) [-575.772] (-578.039) (-578.849) * (-575.601) [-578.848] (-577.543) (-577.498) -- 0:00:58
64000 -- (-576.056) [-576.776] (-580.474) (-577.471) * (-575.760) [-576.560] (-576.847) (-580.423) -- 0:00:58
64500 -- (-577.549) [-574.568] (-575.889) (-575.274) * [-576.488] (-576.550) (-576.869) (-583.503) -- 0:00:58
65000 -- (-579.346) (-579.434) (-576.784) [-575.340] * (-576.939) (-580.479) (-581.025) [-575.759] -- 0:00:57
Average standard deviation of split frequencies: 0.021031
65500 -- [-578.372] (-580.637) (-575.978) (-574.512) * (-578.092) (-575.606) (-580.619) [-575.955] -- 0:00:57
66000 -- (-576.351) [-575.787] (-581.712) (-577.809) * [-577.607] (-577.622) (-575.507) (-577.278) -- 0:00:56
66500 -- (-578.609) [-578.284] (-578.841) (-578.274) * (-575.622) [-576.776] (-576.126) (-575.277) -- 0:00:56
67000 -- (-577.392) (-574.126) (-579.267) [-579.323] * (-579.312) (-575.273) (-575.074) [-577.674] -- 0:00:55
67500 -- (-577.736) (-574.988) (-574.506) [-577.079] * (-579.944) [-576.333] (-576.946) (-577.848) -- 0:00:55
68000 -- (-582.421) (-577.107) [-578.642] (-576.169) * (-577.755) (-577.799) (-574.435) [-579.928] -- 0:00:54
68500 -- (-578.192) [-581.728] (-574.619) (-577.394) * [-575.148] (-574.931) (-575.769) (-577.155) -- 0:00:54
69000 -- (-577.994) (-579.543) [-575.208] (-577.746) * (-577.883) [-576.647] (-576.212) (-577.241) -- 0:00:53
69500 -- (-578.003) (-577.618) [-577.792] (-581.661) * (-577.758) (-576.729) [-575.257] (-576.569) -- 0:00:53
70000 -- [-574.846] (-577.390) (-574.788) (-580.773) * (-574.591) (-579.057) (-578.447) [-575.748] -- 0:00:53
Average standard deviation of split frequencies: 0.023681
70500 -- (-576.835) (-579.137) (-574.563) [-577.120] * (-577.322) (-577.221) (-577.788) [-575.343] -- 0:00:52
71000 -- (-576.983) (-576.029) [-576.387] (-576.666) * [-577.191] (-575.763) (-579.800) (-574.039) -- 0:00:52
71500 -- (-579.955) (-577.434) [-576.047] (-576.855) * (-575.725) (-574.506) (-577.223) [-574.978] -- 0:00:51
72000 -- (-575.638) [-574.533] (-579.511) (-581.496) * (-574.669) (-575.875) (-577.981) [-574.089] -- 0:00:51
72500 -- (-575.235) (-576.198) [-575.294] (-579.809) * (-575.409) [-576.401] (-575.841) (-579.212) -- 0:00:51
73000 -- (-583.568) [-576.645] (-575.234) (-579.373) * (-573.550) (-578.564) (-575.908) [-577.884] -- 0:00:50
73500 -- (-578.765) (-577.681) (-575.834) [-577.772] * [-574.030] (-578.676) (-577.949) (-576.405) -- 0:01:03
74000 -- (-579.838) [-579.455] (-575.694) (-578.695) * [-577.355] (-578.782) (-576.936) (-575.926) -- 0:01:02
74500 -- (-577.451) (-577.385) (-579.013) [-575.936] * (-573.819) [-577.199] (-576.705) (-577.146) -- 0:01:02
75000 -- (-575.826) (-577.166) [-574.744] (-576.714) * (-578.268) (-575.508) (-575.017) [-579.321] -- 0:01:01
Average standard deviation of split frequencies: 0.023088
75500 -- (-578.288) (-576.211) (-576.197) [-575.892] * (-576.706) (-575.527) (-574.068) [-575.619] -- 0:01:01
76000 -- (-575.269) [-576.131] (-575.685) (-576.098) * [-574.810] (-575.774) (-575.724) (-577.027) -- 0:01:00
76500 -- (-574.804) [-575.372] (-579.470) (-574.344) * (-577.606) [-576.765] (-575.515) (-576.899) -- 0:01:00
77000 -- (-576.435) (-574.261) [-574.660] (-574.169) * (-576.085) (-574.781) [-574.487] (-574.241) -- 0:00:59
77500 -- (-576.819) [-575.919] (-575.616) (-575.382) * (-575.683) (-577.134) [-575.340] (-575.140) -- 0:00:59
78000 -- (-579.139) (-578.980) [-573.836] (-575.784) * (-576.310) (-575.289) (-577.148) [-576.396] -- 0:00:59
78500 -- (-578.422) (-576.781) [-579.398] (-576.414) * [-577.046] (-577.922) (-578.720) (-577.062) -- 0:00:58
79000 -- (-577.139) [-577.418] (-577.564) (-578.714) * (-574.403) [-578.583] (-580.098) (-577.852) -- 0:00:58
79500 -- [-580.362] (-579.075) (-579.010) (-579.943) * (-576.619) [-575.354] (-576.140) (-575.757) -- 0:00:57
80000 -- [-582.217] (-579.800) (-580.749) (-576.405) * (-574.761) (-578.712) [-576.142] (-574.973) -- 0:00:57
Average standard deviation of split frequencies: 0.022726
80500 -- [-577.600] (-577.234) (-577.398) (-577.273) * (-579.870) (-576.782) (-577.673) [-573.867] -- 0:00:57
81000 -- [-576.948] (-577.582) (-577.288) (-579.207) * (-577.718) [-576.236] (-579.125) (-575.172) -- 0:00:56
81500 -- (-577.606) [-576.043] (-582.455) (-575.592) * [-580.034] (-575.580) (-574.811) (-579.363) -- 0:00:56
82000 -- (-577.018) (-578.190) (-576.102) [-577.546] * [-576.413] (-578.127) (-579.179) (-585.481) -- 0:00:55
82500 -- (-574.959) (-577.426) [-580.041] (-576.041) * (-580.600) (-576.967) (-576.335) [-575.550] -- 0:00:55
83000 -- (-575.077) (-576.548) [-575.769] (-575.521) * (-577.627) (-576.217) (-576.294) [-575.778] -- 0:00:55
83500 -- [-578.024] (-576.950) (-576.972) (-577.857) * (-577.577) [-576.728] (-575.945) (-575.010) -- 0:00:54
84000 -- [-578.411] (-576.681) (-580.098) (-580.317) * (-575.967) (-576.913) (-577.315) [-574.736] -- 0:00:54
84500 -- (-576.873) [-577.462] (-584.337) (-578.474) * (-575.942) (-576.477) [-582.541] (-575.201) -- 0:00:54
85000 -- [-578.042] (-575.556) (-579.314) (-577.787) * (-575.313) (-577.377) [-575.510] (-574.198) -- 0:00:53
Average standard deviation of split frequencies: 0.022503
85500 -- (-577.804) (-579.956) (-576.179) [-577.931] * (-579.191) (-576.304) [-577.930] (-576.473) -- 0:00:53
86000 -- (-576.793) (-575.935) (-578.943) [-576.790] * (-575.992) [-576.110] (-577.611) (-583.117) -- 0:00:53
86500 -- (-577.329) (-576.804) (-580.987) [-578.397] * (-576.099) (-576.678) (-578.971) [-576.902] -- 0:00:52
87000 -- (-579.111) (-576.318) [-575.476] (-578.327) * [-575.245] (-581.000) (-574.275) (-576.092) -- 0:00:52
87500 -- [-578.411] (-576.974) (-579.015) (-574.732) * (-575.864) (-581.705) [-575.617] (-575.268) -- 0:00:52
88000 -- (-577.100) (-578.434) (-575.746) [-580.018] * (-575.678) (-577.826) [-576.468] (-578.460) -- 0:00:51
88500 -- [-577.928] (-580.464) (-575.775) (-578.045) * [-579.097] (-579.625) (-576.186) (-577.682) -- 0:00:51
89000 -- (-578.217) (-578.930) (-578.000) [-575.294] * [-577.972] (-578.848) (-575.144) (-579.990) -- 0:00:51
89500 -- [-577.875] (-577.058) (-576.059) (-577.139) * (-577.517) [-580.451] (-577.283) (-577.235) -- 0:01:01
90000 -- (-580.014) [-575.359] (-577.140) (-575.105) * (-578.791) (-577.265) (-577.363) [-579.835] -- 0:01:00
Average standard deviation of split frequencies: 0.019064
90500 -- [-574.010] (-575.203) (-578.875) (-577.305) * (-582.003) (-579.012) [-576.570] (-574.165) -- 0:01:00
91000 -- [-574.470] (-576.611) (-582.643) (-576.421) * [-581.167] (-580.095) (-575.784) (-576.834) -- 0:00:59
91500 -- (-577.502) (-576.199) (-577.364) [-574.489] * (-576.489) (-582.160) [-576.156] (-575.624) -- 0:00:59
92000 -- [-576.519] (-576.293) (-579.242) (-575.089) * (-579.221) (-576.124) [-577.354] (-578.074) -- 0:00:59
92500 -- (-574.525) [-576.042] (-577.786) (-575.738) * (-575.363) [-577.165] (-579.785) (-580.333) -- 0:00:58
93000 -- (-579.492) [-579.915] (-580.483) (-578.095) * [-577.133] (-576.845) (-577.450) (-576.938) -- 0:00:58
93500 -- (-580.309) [-576.533] (-578.088) (-580.206) * (-577.485) (-576.815) (-575.230) [-574.934] -- 0:00:58
94000 -- (-577.526) (-577.439) (-579.599) [-578.147] * (-577.959) (-575.759) (-576.533) [-575.940] -- 0:00:57
94500 -- [-574.406] (-576.588) (-576.988) (-573.919) * [-577.648] (-578.519) (-576.426) (-574.620) -- 0:00:57
95000 -- [-575.895] (-574.804) (-580.342) (-576.629) * (-577.360) [-576.403] (-578.106) (-578.365) -- 0:00:57
Average standard deviation of split frequencies: 0.017833
95500 -- [-577.983] (-581.589) (-579.458) (-578.767) * (-575.828) (-574.374) (-578.400) [-581.999] -- 0:00:56
96000 -- [-575.045] (-575.691) (-580.453) (-579.133) * (-579.281) (-578.786) [-576.597] (-576.410) -- 0:00:56
96500 -- (-576.429) (-577.381) (-577.843) [-576.314] * [-575.527] (-575.006) (-577.894) (-587.144) -- 0:00:56
97000 -- [-581.281] (-577.803) (-577.846) (-575.260) * (-574.931) (-580.323) (-575.642) [-576.831] -- 0:00:55
97500 -- (-580.041) (-577.387) [-577.048] (-576.316) * (-576.805) (-575.744) [-578.904] (-578.811) -- 0:00:55
98000 -- [-580.794] (-577.939) (-579.352) (-574.787) * [-577.524] (-577.108) (-574.981) (-577.790) -- 0:00:55
98500 -- [-576.177] (-576.496) (-581.247) (-576.094) * (-584.859) (-577.767) [-577.925] (-579.715) -- 0:00:54
99000 -- (-576.780) [-580.023] (-576.696) (-574.816) * (-575.778) (-574.561) (-576.649) [-574.655] -- 0:00:54
99500 -- (-577.210) (-576.034) [-577.836] (-575.572) * (-578.499) (-574.243) [-577.789] (-576.773) -- 0:00:54
100000 -- (-574.699) (-580.445) (-582.182) [-578.136] * (-579.753) (-576.115) (-575.173) [-575.576] -- 0:00:54
Average standard deviation of split frequencies: 0.019224
100500 -- (-578.618) (-578.137) (-577.807) [-577.568] * (-577.119) (-579.439) [-575.656] (-574.185) -- 0:00:53
101000 -- (-577.007) (-575.610) (-577.811) [-574.424] * [-575.147] (-578.082) (-577.758) (-577.762) -- 0:00:53
101500 -- (-578.548) [-577.875] (-576.859) (-576.376) * (-575.841) (-575.166) (-574.460) [-577.453] -- 0:00:53
102000 -- (-580.395) [-576.360] (-578.632) (-579.331) * [-576.655] (-577.800) (-577.126) (-577.724) -- 0:00:52
102500 -- [-578.276] (-576.292) (-577.347) (-577.080) * (-579.482) [-579.357] (-575.380) (-581.847) -- 0:00:52
103000 -- (-580.649) (-576.391) [-576.348] (-576.340) * (-577.279) (-580.546) (-575.686) [-577.926] -- 0:00:52
103500 -- (-579.261) (-577.432) [-581.787] (-576.687) * (-578.384) [-576.034] (-582.644) (-578.435) -- 0:00:51
104000 -- (-576.358) (-576.901) [-578.080] (-578.305) * (-576.110) [-575.673] (-580.041) (-580.099) -- 0:00:51
104500 -- (-574.769) [-576.247] (-577.454) (-577.027) * (-576.845) (-576.449) [-578.146] (-575.425) -- 0:00:51
105000 -- [-576.120] (-578.958) (-576.557) (-576.782) * (-577.701) (-579.783) [-579.075] (-576.784) -- 0:00:51
Average standard deviation of split frequencies: 0.019123
105500 -- (-575.702) (-575.871) (-578.708) [-576.546] * (-576.742) (-576.625) [-581.593] (-576.309) -- 0:00:59
106000 -- [-576.334] (-577.250) (-576.652) (-577.612) * (-577.551) (-576.383) (-576.369) [-578.810] -- 0:00:59
106500 -- (-575.132) (-578.260) [-579.495] (-577.235) * (-578.571) [-576.052] (-575.498) (-578.333) -- 0:00:58
107000 -- (-574.285) (-578.742) [-580.033] (-575.993) * (-576.246) (-577.761) [-576.611] (-579.370) -- 0:00:58
107500 -- (-575.282) [-578.062] (-581.913) (-577.572) * [-577.117] (-577.458) (-576.374) (-577.870) -- 0:00:58
108000 -- (-576.191) [-574.976] (-578.206) (-576.822) * [-578.102] (-576.582) (-576.587) (-576.663) -- 0:00:57
108500 -- (-579.627) (-576.705) (-576.396) [-576.451] * (-576.068) (-579.602) [-577.826] (-576.238) -- 0:00:57
109000 -- (-577.178) (-575.687) [-581.345] (-576.893) * [-575.489] (-581.206) (-578.269) (-578.072) -- 0:00:57
109500 -- (-577.061) (-580.637) (-582.004) [-574.523] * (-575.707) [-578.481] (-579.001) (-576.361) -- 0:00:56
110000 -- (-574.202) (-581.546) [-576.109] (-577.321) * (-575.273) (-579.213) [-575.827] (-579.105) -- 0:00:56
Average standard deviation of split frequencies: 0.018104
110500 -- (-576.975) (-575.839) [-577.948] (-577.099) * (-576.442) (-575.477) [-575.498] (-577.968) -- 0:00:56
111000 -- [-577.611] (-577.562) (-578.338) (-577.806) * [-575.753] (-576.046) (-574.717) (-576.786) -- 0:00:56
111500 -- (-575.844) [-575.510] (-580.125) (-578.628) * (-574.048) (-576.359) (-579.683) [-575.783] -- 0:00:55
112000 -- (-575.155) [-577.539] (-578.925) (-577.283) * (-575.352) (-576.161) (-576.364) [-576.622] -- 0:00:55
112500 -- (-575.192) (-577.051) [-576.701] (-582.346) * (-574.914) (-576.165) [-575.459] (-576.265) -- 0:00:55
113000 -- [-576.284] (-576.550) (-576.441) (-578.710) * [-574.715] (-576.066) (-575.782) (-579.005) -- 0:00:54
113500 -- [-574.671] (-581.336) (-576.056) (-575.654) * (-576.410) (-578.962) (-576.127) [-576.415] -- 0:00:54
114000 -- [-574.967] (-578.866) (-577.241) (-579.133) * (-576.758) [-577.612] (-576.178) (-576.023) -- 0:00:54
114500 -- (-577.379) [-575.811] (-576.064) (-577.806) * (-576.263) (-577.557) (-577.188) [-576.508] -- 0:00:54
115000 -- (-576.706) [-577.039] (-577.176) (-578.277) * (-579.206) [-575.717] (-576.153) (-576.641) -- 0:00:53
Average standard deviation of split frequencies: 0.016662
115500 -- (-575.384) (-579.086) [-579.250] (-579.989) * [-579.360] (-579.113) (-576.422) (-576.930) -- 0:00:53
116000 -- (-574.990) (-577.844) [-578.547] (-581.835) * (-578.592) [-579.355] (-577.849) (-577.780) -- 0:00:53
116500 -- [-576.849] (-581.982) (-577.317) (-575.643) * (-576.157) [-577.630] (-577.570) (-579.742) -- 0:00:53
117000 -- [-577.298] (-579.694) (-578.478) (-576.894) * (-578.713) (-574.975) [-577.091] (-584.285) -- 0:00:52
117500 -- (-576.032) (-578.286) [-576.102] (-575.933) * (-578.697) [-574.700] (-575.831) (-582.957) -- 0:00:52
118000 -- (-578.013) [-576.333] (-577.012) (-577.806) * (-576.646) (-577.335) [-577.803] (-583.005) -- 0:00:52
118500 -- (-578.448) (-577.055) (-576.199) [-576.926] * [-578.763] (-579.120) (-580.937) (-577.312) -- 0:00:52
119000 -- (-577.248) (-579.095) (-576.398) [-577.576] * (-578.770) [-576.595] (-578.007) (-578.518) -- 0:00:51
119500 -- (-576.679) (-578.633) [-576.568] (-579.926) * (-577.874) (-577.109) (-583.616) [-577.049] -- 0:00:51
120000 -- (-577.541) [-576.876] (-577.284) (-577.775) * [-576.616] (-576.516) (-576.864) (-578.700) -- 0:00:51
Average standard deviation of split frequencies: 0.015421
120500 -- [-576.083] (-577.462) (-574.080) (-577.139) * (-576.908) (-580.786) (-577.169) [-577.479] -- 0:00:58
121000 -- (-577.411) [-577.207] (-576.729) (-577.235) * (-577.126) (-578.313) [-579.175] (-576.474) -- 0:00:58
121500 -- [-578.078] (-576.633) (-579.409) (-578.548) * (-576.301) [-574.564] (-579.270) (-581.737) -- 0:00:57
122000 -- (-577.691) (-576.681) (-577.392) [-576.109] * [-577.745] (-574.768) (-576.990) (-576.652) -- 0:00:57
122500 -- [-576.805] (-577.910) (-576.157) (-575.221) * [-576.956] (-578.020) (-576.315) (-576.854) -- 0:00:57
123000 -- (-577.916) (-576.720) [-577.054] (-573.682) * (-580.472) [-574.740] (-576.428) (-575.278) -- 0:00:57
123500 -- [-580.338] (-579.191) (-578.433) (-573.885) * (-578.366) (-575.402) (-579.962) [-575.531] -- 0:00:56
124000 -- (-579.427) (-576.390) (-575.985) [-574.597] * (-576.735) (-574.583) (-579.648) [-576.125] -- 0:00:56
124500 -- (-577.445) (-579.674) (-582.099) [-576.224] * (-576.427) [-575.933] (-579.194) (-577.781) -- 0:00:56
125000 -- (-577.650) [-576.441] (-576.032) (-578.556) * (-578.188) (-576.603) (-577.075) [-579.609] -- 0:00:56
Average standard deviation of split frequencies: 0.015526
125500 -- (-577.152) (-578.167) (-576.846) [-578.482] * (-576.575) (-580.696) (-577.651) [-581.031] -- 0:00:55
126000 -- (-578.667) [-575.449] (-575.432) (-574.051) * (-575.711) [-576.575] (-578.444) (-576.765) -- 0:00:55
126500 -- (-578.357) [-575.501] (-575.165) (-573.324) * (-582.594) (-576.788) (-577.950) [-577.342] -- 0:00:55
127000 -- [-577.113] (-577.718) (-574.005) (-577.722) * [-575.980] (-580.289) (-583.803) (-575.458) -- 0:00:54
127500 -- (-573.411) (-575.866) [-576.509] (-575.825) * (-575.024) [-577.021] (-577.456) (-577.332) -- 0:00:54
128000 -- (-574.687) [-579.900] (-584.750) (-577.132) * (-575.669) (-576.761) [-576.220] (-577.827) -- 0:00:54
128500 -- (-577.119) (-577.992) [-583.155] (-578.264) * (-576.690) (-576.905) (-577.865) [-577.930] -- 0:00:54
129000 -- (-575.324) (-580.127) [-576.425] (-576.193) * (-576.412) (-580.296) (-577.088) [-575.955] -- 0:00:54
129500 -- [-575.618] (-579.324) (-579.927) (-576.634) * (-579.988) [-576.346] (-575.388) (-576.893) -- 0:00:53
130000 -- [-577.367] (-575.451) (-578.507) (-576.278) * (-576.064) (-575.788) (-575.834) [-574.191] -- 0:00:53
Average standard deviation of split frequencies: 0.016435
130500 -- [-576.737] (-577.064) (-577.438) (-575.855) * (-576.719) [-576.705] (-577.192) (-575.479) -- 0:00:53
131000 -- (-574.897) (-575.842) [-575.331] (-578.288) * [-576.820] (-575.994) (-579.146) (-574.788) -- 0:00:53
131500 -- (-576.129) (-575.596) [-575.134] (-576.210) * (-577.219) (-585.642) (-576.251) [-575.571] -- 0:00:52
132000 -- (-580.459) (-578.013) (-578.133) [-575.932] * [-576.868] (-581.338) (-576.276) (-575.706) -- 0:00:52
132500 -- (-577.990) (-576.510) [-576.482] (-576.729) * [-576.765] (-575.946) (-578.879) (-577.391) -- 0:00:52
133000 -- [-574.885] (-577.259) (-575.378) (-580.237) * [-576.361] (-577.700) (-575.265) (-576.881) -- 0:00:52
133500 -- [-575.544] (-579.030) (-576.465) (-577.015) * (-576.649) (-579.365) [-578.104] (-578.346) -- 0:00:51
134000 -- (-577.708) (-577.391) (-580.384) [-578.941] * (-576.681) [-576.065] (-578.420) (-576.148) -- 0:00:51
134500 -- [-575.366] (-578.159) (-580.232) (-577.001) * (-578.131) (-578.887) (-574.675) [-580.579] -- 0:00:57
135000 -- [-578.308] (-578.408) (-575.853) (-579.643) * [-574.443] (-580.545) (-576.986) (-577.367) -- 0:00:57
Average standard deviation of split frequencies: 0.017513
135500 -- [-575.726] (-576.024) (-575.352) (-576.067) * (-576.194) (-579.488) [-576.981] (-580.456) -- 0:00:57
136000 -- (-576.997) (-576.341) (-574.851) [-575.998] * [-577.037] (-577.617) (-574.643) (-580.669) -- 0:00:57
136500 -- (-577.736) (-576.057) (-576.773) [-575.213] * (-581.905) (-575.972) (-576.772) [-574.774] -- 0:00:56
137000 -- (-578.511) (-574.574) [-576.008] (-574.063) * (-575.531) [-573.663] (-578.273) (-578.720) -- 0:00:56
137500 -- [-578.092] (-579.179) (-576.795) (-576.803) * (-577.491) (-576.240) [-577.189] (-577.087) -- 0:00:56
138000 -- (-577.029) [-575.266] (-578.612) (-578.916) * (-577.708) [-575.111] (-579.469) (-575.482) -- 0:00:56
138500 -- (-577.742) (-575.229) (-577.218) [-578.175] * (-578.901) (-575.954) (-576.423) [-574.299] -- 0:00:55
139000 -- (-579.447) (-576.945) [-579.844] (-578.638) * (-577.118) (-573.784) (-575.204) [-573.431] -- 0:00:55
139500 -- [-578.720] (-577.628) (-574.682) (-577.739) * (-576.482) [-575.432] (-580.273) (-575.613) -- 0:00:55
140000 -- [-577.889] (-579.375) (-574.124) (-575.292) * [-576.650] (-576.095) (-579.467) (-575.328) -- 0:00:55
Average standard deviation of split frequencies: 0.017462
140500 -- [-576.999] (-582.241) (-575.978) (-574.369) * (-576.428) (-575.704) [-582.549] (-576.595) -- 0:00:55
141000 -- (-576.123) (-579.618) [-578.519] (-576.117) * (-576.651) [-575.521] (-579.314) (-580.128) -- 0:00:54
141500 -- [-576.093] (-579.063) (-578.877) (-576.710) * (-575.848) [-576.809] (-576.508) (-576.988) -- 0:00:54
142000 -- (-576.326) (-576.066) [-577.179] (-574.901) * [-579.137] (-573.191) (-576.925) (-577.464) -- 0:00:54
142500 -- (-576.492) (-574.543) [-574.855] (-581.368) * (-577.580) (-575.411) (-579.870) [-580.153] -- 0:00:54
143000 -- (-576.708) (-574.390) [-574.948] (-575.805) * (-578.951) (-575.112) (-578.078) [-576.414] -- 0:00:53
143500 -- (-576.537) (-574.678) (-573.472) [-576.644] * [-577.433] (-576.279) (-582.258) (-573.821) -- 0:00:53
144000 -- (-578.108) (-578.127) (-578.567) [-576.380] * (-577.974) [-576.356] (-580.304) (-578.446) -- 0:00:53
144500 -- (-577.436) (-577.553) (-574.181) [-575.860] * (-578.807) (-576.946) (-579.082) [-576.136] -- 0:00:53
145000 -- [-576.210] (-573.741) (-576.137) (-576.144) * (-575.993) (-576.357) [-576.940] (-575.218) -- 0:00:53
Average standard deviation of split frequencies: 0.016144
145500 -- (-579.501) (-574.261) (-577.174) [-576.211] * (-574.980) [-575.502] (-576.813) (-574.559) -- 0:00:52
146000 -- (-579.515) (-576.084) (-577.532) [-574.990] * [-580.760] (-574.635) (-576.128) (-574.398) -- 0:00:52
146500 -- (-578.562) [-574.655] (-576.767) (-577.314) * (-576.459) (-575.546) (-577.036) [-575.990] -- 0:00:52
147000 -- (-576.580) (-578.124) [-578.356] (-576.414) * (-576.348) (-575.610) (-577.985) [-580.567] -- 0:00:52
147500 -- (-578.046) (-577.908) [-575.714] (-576.040) * [-578.910] (-577.571) (-576.842) (-574.559) -- 0:00:52
148000 -- (-578.625) (-577.804) (-578.604) [-576.472] * [-576.918] (-576.681) (-577.062) (-577.350) -- 0:00:51
148500 -- (-576.847) [-575.592] (-575.316) (-577.267) * [-579.102] (-576.355) (-576.381) (-577.725) -- 0:00:51
149000 -- (-577.299) (-577.347) [-577.927] (-577.968) * (-575.742) (-576.053) [-578.365] (-574.786) -- 0:00:51
149500 -- (-577.154) (-579.737) [-574.397] (-576.025) * (-577.482) [-574.655] (-579.873) (-578.417) -- 0:00:51
150000 -- (-576.314) (-577.737) (-573.402) [-576.748] * (-578.500) (-577.671) (-579.019) [-575.987] -- 0:00:51
Average standard deviation of split frequencies: 0.016138
150500 -- [-573.760] (-576.337) (-578.622) (-578.408) * (-576.763) (-573.627) [-575.913] (-578.441) -- 0:00:56
151000 -- [-575.670] (-576.328) (-579.583) (-575.716) * (-578.445) (-576.849) [-578.722] (-576.821) -- 0:00:56
151500 -- (-576.304) (-577.778) (-581.416) [-576.046] * (-577.448) [-575.195] (-576.689) (-576.331) -- 0:00:56
152000 -- (-575.974) (-580.034) (-580.037) [-578.008] * (-578.047) (-574.455) [-575.882] (-576.385) -- 0:00:55
152500 -- (-580.338) (-575.112) [-575.452] (-579.127) * (-575.777) [-577.769] (-579.246) (-575.486) -- 0:00:55
153000 -- (-580.557) [-575.263] (-579.019) (-578.720) * (-576.248) (-577.888) [-575.881] (-579.039) -- 0:00:55
153500 -- (-585.524) [-575.337] (-583.139) (-574.635) * (-579.129) (-576.611) (-578.485) [-575.089] -- 0:00:55
154000 -- (-580.702) [-578.104] (-579.112) (-579.487) * (-576.397) [-576.240] (-579.179) (-575.652) -- 0:00:54
154500 -- (-577.695) [-578.394] (-574.991) (-577.654) * (-575.248) (-578.594) [-579.525] (-575.818) -- 0:00:54
155000 -- (-578.935) (-581.683) [-575.379] (-579.310) * (-575.077) (-577.113) [-580.129] (-578.159) -- 0:00:54
Average standard deviation of split frequencies: 0.015613
155500 -- (-578.805) (-577.795) [-580.031] (-576.839) * (-579.762) [-575.497] (-578.426) (-575.995) -- 0:00:54
156000 -- (-582.164) (-579.500) [-576.643] (-577.500) * [-578.054] (-578.104) (-581.534) (-575.664) -- 0:00:54
156500 -- (-577.913) (-575.189) (-577.647) [-575.548] * (-577.713) (-577.672) (-576.117) [-575.352] -- 0:00:53
157000 -- (-574.979) (-576.222) [-575.559] (-573.571) * (-578.562) [-575.171] (-576.285) (-575.523) -- 0:00:53
157500 -- (-574.369) (-576.878) [-578.007] (-578.870) * (-577.700) [-575.401] (-579.945) (-576.455) -- 0:00:53
158000 -- (-575.047) (-574.026) [-575.907] (-576.462) * (-576.579) [-575.427] (-582.168) (-577.040) -- 0:00:53
158500 -- (-576.449) [-577.153] (-577.500) (-577.085) * (-576.524) [-577.223] (-577.742) (-575.575) -- 0:00:53
159000 -- [-574.198] (-575.093) (-577.961) (-576.674) * (-576.854) (-580.576) [-577.802] (-575.358) -- 0:00:52
159500 -- (-581.638) [-574.565] (-576.374) (-576.956) * (-576.339) (-578.654) [-579.694] (-578.253) -- 0:00:52
160000 -- [-575.407] (-579.960) (-578.168) (-575.996) * [-574.800] (-574.324) (-582.233) (-579.021) -- 0:00:52
Average standard deviation of split frequencies: 0.014344
160500 -- (-584.622) (-577.359) [-578.029] (-575.084) * [-576.693] (-575.612) (-580.917) (-574.860) -- 0:00:52
161000 -- [-575.169] (-576.039) (-577.466) (-579.999) * [-575.095] (-580.038) (-578.056) (-575.195) -- 0:00:52
161500 -- (-576.693) [-575.534] (-581.272) (-575.594) * (-579.690) [-576.388] (-575.990) (-574.986) -- 0:00:51
162000 -- (-576.422) (-576.384) (-580.988) [-575.289] * [-577.786] (-577.704) (-577.284) (-578.710) -- 0:00:51
162500 -- (-576.392) (-577.890) [-580.008] (-576.136) * [-576.692] (-575.923) (-577.487) (-577.016) -- 0:00:51
163000 -- [-580.548] (-584.311) (-576.173) (-576.550) * (-575.969) [-575.990] (-575.745) (-577.955) -- 0:00:51
163500 -- [-575.020] (-578.502) (-575.638) (-576.463) * [-577.672] (-577.145) (-576.077) (-577.917) -- 0:00:51
164000 -- [-574.560] (-574.487) (-577.934) (-578.080) * (-576.084) [-574.708] (-576.939) (-576.638) -- 0:00:50
164500 -- (-577.244) [-576.718] (-575.714) (-573.563) * (-577.052) (-578.152) (-574.477) [-574.526] -- 0:00:50
165000 -- (-579.645) (-576.401) (-579.092) [-578.360] * (-578.059) (-577.477) [-577.948] (-576.695) -- 0:00:50
Average standard deviation of split frequencies: 0.014041
165500 -- [-576.731] (-577.990) (-577.828) (-575.179) * [-578.257] (-575.171) (-578.512) (-575.861) -- 0:00:50
166000 -- (-576.462) [-577.261] (-580.763) (-578.831) * [-576.030] (-577.682) (-576.211) (-577.815) -- 0:00:50
166500 -- (-576.732) (-574.622) [-575.611] (-578.472) * (-578.555) [-576.140] (-579.466) (-576.338) -- 0:00:55
167000 -- (-575.411) (-576.664) [-575.726] (-578.918) * (-578.308) [-575.945] (-575.625) (-575.123) -- 0:00:54
167500 -- [-578.168] (-576.392) (-576.153) (-578.370) * (-579.241) (-575.568) (-578.057) [-574.564] -- 0:00:54
168000 -- (-574.922) (-576.018) [-577.405] (-576.614) * (-579.190) (-580.282) (-577.800) [-576.976] -- 0:00:54
168500 -- (-575.422) [-574.865] (-575.331) (-576.009) * (-578.480) [-578.162] (-577.421) (-577.142) -- 0:00:54
169000 -- [-575.401] (-576.441) (-579.104) (-577.840) * (-577.644) (-576.350) (-578.703) [-575.858] -- 0:00:54
169500 -- [-576.927] (-575.897) (-578.211) (-575.639) * (-578.592) (-579.397) (-575.725) [-577.204] -- 0:00:53
170000 -- (-578.545) [-574.432] (-577.667) (-579.037) * (-579.604) (-576.399) [-574.283] (-576.438) -- 0:00:53
Average standard deviation of split frequencies: 0.013964
170500 -- [-574.228] (-576.424) (-577.320) (-575.529) * (-579.630) [-576.569] (-579.278) (-578.895) -- 0:00:53
171000 -- (-577.085) (-575.272) (-576.429) [-578.085] * (-577.555) (-578.437) [-575.174] (-574.791) -- 0:00:53
171500 -- (-575.208) (-575.966) (-574.811) [-575.117] * (-579.997) (-576.278) [-574.677] (-576.638) -- 0:00:53
172000 -- [-575.106] (-578.620) (-573.978) (-576.010) * (-578.973) (-575.366) (-575.305) [-575.184] -- 0:00:52
172500 -- (-575.657) (-576.149) (-577.231) [-576.351] * (-577.002) [-575.010] (-574.630) (-574.668) -- 0:00:52
173000 -- (-575.315) (-577.968) (-579.194) [-579.546] * (-576.781) (-577.601) [-573.419] (-576.629) -- 0:00:52
173500 -- (-576.579) (-577.579) (-577.684) [-583.434] * (-578.601) [-577.125] (-576.465) (-576.834) -- 0:00:52
174000 -- (-578.366) (-577.153) [-576.875] (-579.064) * [-577.646] (-576.921) (-575.711) (-576.376) -- 0:00:52
174500 -- (-576.880) (-575.323) (-576.002) [-572.771] * (-575.498) [-575.257] (-575.705) (-575.172) -- 0:00:52
175000 -- (-577.781) [-574.482] (-576.551) (-577.418) * (-577.585) (-574.808) [-575.130] (-577.333) -- 0:00:51
Average standard deviation of split frequencies: 0.014653
175500 -- (-577.454) (-577.569) [-576.346] (-577.270) * (-580.586) [-573.190] (-576.695) (-575.008) -- 0:00:51
176000 -- (-579.059) [-576.460] (-576.883) (-578.927) * (-577.276) (-579.627) [-578.426] (-575.615) -- 0:00:51
176500 -- (-576.724) [-576.044] (-575.754) (-579.671) * (-578.390) [-578.099] (-583.443) (-576.590) -- 0:00:51
177000 -- [-579.442] (-579.639) (-577.849) (-577.311) * (-579.151) (-579.851) [-573.699] (-579.208) -- 0:00:51
177500 -- (-577.792) [-577.306] (-578.215) (-581.896) * (-578.553) (-577.562) [-573.806] (-576.565) -- 0:00:50
178000 -- (-583.583) (-574.124) (-576.986) [-579.180] * (-576.017) (-577.605) (-575.561) [-574.798] -- 0:00:50
178500 -- (-577.061) (-575.923) [-575.657] (-575.649) * (-576.529) (-577.153) [-577.202] (-575.909) -- 0:00:50
179000 -- [-576.195] (-574.813) (-579.667) (-576.894) * (-577.474) (-574.904) (-575.463) [-577.152] -- 0:00:50
179500 -- [-578.302] (-578.107) (-576.594) (-580.197) * (-575.762) [-576.209] (-574.374) (-576.739) -- 0:00:50
180000 -- (-576.440) [-574.586] (-575.739) (-577.408) * (-579.197) (-577.218) [-574.492] (-584.465) -- 0:00:50
Average standard deviation of split frequencies: 0.013191
180500 -- (-574.016) (-578.956) (-577.280) [-577.102] * (-576.740) [-574.367] (-575.988) (-578.005) -- 0:00:49
181000 -- (-580.550) (-579.271) [-574.881] (-577.918) * (-579.903) (-577.004) (-575.068) [-576.774] -- 0:00:49
181500 -- [-579.696] (-577.634) (-576.002) (-576.835) * (-576.669) (-574.670) [-575.941] (-578.324) -- 0:00:49
182000 -- (-574.374) (-576.816) (-575.901) [-577.887] * (-576.650) (-577.100) [-575.619] (-580.595) -- 0:00:49
182500 -- [-575.913] (-574.829) (-575.954) (-578.358) * [-575.708] (-574.813) (-576.985) (-576.120) -- 0:00:49
183000 -- (-574.308) [-578.571] (-577.101) (-577.781) * (-579.009) [-577.563] (-575.544) (-575.729) -- 0:00:53
183500 -- (-574.962) (-579.657) [-576.340] (-575.113) * (-577.249) (-579.901) [-577.861] (-577.564) -- 0:00:53
184000 -- (-580.515) (-575.825) (-577.857) [-576.146] * (-575.411) [-576.316] (-574.417) (-576.947) -- 0:00:53
184500 -- (-576.141) [-576.791] (-578.420) (-577.413) * (-581.282) [-576.932] (-576.777) (-576.930) -- 0:00:53
185000 -- [-574.623] (-578.597) (-577.651) (-574.641) * (-578.286) (-575.975) [-576.046] (-576.780) -- 0:00:52
Average standard deviation of split frequencies: 0.012939
185500 -- (-577.922) [-576.752] (-575.220) (-574.666) * (-576.700) [-576.575] (-577.146) (-579.853) -- 0:00:52
186000 -- (-582.477) [-575.583] (-581.509) (-576.597) * (-578.969) [-575.582] (-574.586) (-581.936) -- 0:00:52
186500 -- (-575.744) (-576.906) (-578.639) [-574.510] * (-576.650) [-576.037] (-576.951) (-575.644) -- 0:00:52
187000 -- (-574.405) [-576.092] (-575.880) (-576.699) * (-575.768) (-577.278) (-576.096) [-577.027] -- 0:00:52
187500 -- (-574.883) [-576.808] (-578.537) (-582.294) * (-576.135) [-576.615] (-575.779) (-576.055) -- 0:00:52
188000 -- (-575.934) (-577.161) (-578.411) [-574.975] * (-575.190) (-578.076) (-575.387) [-577.054] -- 0:00:51
188500 -- [-576.070] (-577.159) (-577.217) (-574.433) * (-577.073) (-578.620) [-574.830] (-579.366) -- 0:00:51
189000 -- (-575.754) (-580.245) [-575.891] (-576.999) * (-576.871) (-577.602) [-577.490] (-577.487) -- 0:00:51
189500 -- (-578.412) [-576.748] (-575.830) (-575.337) * (-576.108) (-575.489) (-575.015) [-575.649] -- 0:00:51
190000 -- (-576.164) (-581.399) [-576.732] (-574.217) * (-580.397) (-575.277) [-577.255] (-576.743) -- 0:00:51
Average standard deviation of split frequencies: 0.012911
190500 -- (-578.892) (-576.032) (-581.486) [-580.556] * (-576.759) (-575.378) [-575.248] (-577.927) -- 0:00:50
191000 -- [-576.635] (-574.500) (-578.677) (-575.114) * (-577.913) (-574.562) [-579.588] (-575.977) -- 0:00:50
191500 -- (-577.947) (-575.562) (-579.817) [-575.388] * [-578.500] (-576.291) (-579.822) (-577.423) -- 0:00:50
192000 -- (-576.720) (-578.651) (-580.322) [-576.269] * (-578.497) (-579.131) (-578.450) [-578.956] -- 0:00:50
192500 -- (-576.217) (-576.803) (-584.352) [-574.219] * (-576.918) [-576.117] (-577.945) (-577.780) -- 0:00:50
193000 -- (-575.609) (-578.703) (-577.378) [-574.133] * (-578.125) (-575.439) (-576.756) [-576.457] -- 0:00:50
193500 -- [-574.291] (-576.277) (-575.980) (-578.222) * (-578.087) [-582.983] (-574.250) (-575.587) -- 0:00:50
194000 -- (-578.977) [-577.141] (-576.747) (-584.411) * (-578.367) (-578.768) (-573.735) [-576.670] -- 0:00:49
194500 -- (-578.312) (-577.266) [-577.143] (-577.230) * (-574.767) [-576.626] (-574.034) (-584.001) -- 0:00:49
195000 -- (-577.228) (-577.052) (-577.567) [-576.511] * (-578.114) (-576.280) (-575.390) [-579.374] -- 0:00:49
Average standard deviation of split frequencies: 0.012426
195500 -- [-576.624] (-576.664) (-576.988) (-575.182) * [-581.259] (-575.907) (-574.174) (-578.729) -- 0:00:49
196000 -- (-577.703) (-577.262) (-575.499) [-577.317] * (-577.662) [-575.884] (-578.610) (-582.513) -- 0:00:49
196500 -- (-574.492) (-576.780) [-574.447] (-576.602) * [-577.483] (-578.780) (-577.201) (-578.306) -- 0:00:49
197000 -- (-575.665) [-575.802] (-576.255) (-577.934) * [-574.311] (-576.812) (-575.914) (-581.294) -- 0:00:48
197500 -- (-578.272) (-577.133) [-577.934] (-576.421) * (-576.303) (-577.406) (-574.990) [-578.227] -- 0:00:48
198000 -- (-576.995) [-576.380] (-576.046) (-580.999) * (-576.607) [-578.251] (-575.836) (-580.594) -- 0:00:48
198500 -- (-577.347) (-576.888) (-575.555) [-574.787] * (-575.863) [-576.135] (-575.148) (-580.560) -- 0:00:48
199000 -- (-577.259) (-577.322) [-577.705] (-575.973) * [-581.948] (-579.696) (-581.463) (-577.409) -- 0:00:52
199500 -- (-574.325) (-579.849) (-579.193) [-576.657] * (-576.067) (-575.227) [-577.529] (-578.851) -- 0:00:52
200000 -- [-576.148] (-576.798) (-578.950) (-577.411) * (-574.776) [-576.458] (-577.132) (-580.350) -- 0:00:51
Average standard deviation of split frequencies: 0.012660
200500 -- (-577.436) (-578.139) (-575.101) [-576.644] * (-575.058) (-577.311) (-580.453) [-576.577] -- 0:00:51
201000 -- [-575.928] (-579.351) (-577.420) (-578.754) * (-575.784) (-577.055) [-578.371] (-577.531) -- 0:00:51
201500 -- [-576.873] (-574.311) (-577.085) (-575.091) * (-576.773) (-580.337) (-574.821) [-580.529] -- 0:00:51
202000 -- (-579.867) (-578.886) (-575.715) [-574.206] * (-574.620) (-574.617) (-577.524) [-576.360] -- 0:00:51
202500 -- (-580.337) [-575.392] (-577.112) (-580.832) * (-576.992) [-575.299] (-576.752) (-578.544) -- 0:00:51
203000 -- [-576.798] (-580.539) (-575.450) (-579.616) * [-574.951] (-577.603) (-575.382) (-579.287) -- 0:00:51
203500 -- [-577.648] (-578.849) (-576.398) (-578.864) * (-575.849) [-574.125] (-576.822) (-579.738) -- 0:00:50
204000 -- [-582.027] (-576.208) (-580.735) (-579.100) * (-578.588) (-577.252) [-578.635] (-577.588) -- 0:00:50
204500 -- (-581.903) (-576.150) (-576.977) [-575.029] * (-578.365) (-574.927) [-578.299] (-578.680) -- 0:00:50
205000 -- (-577.862) (-578.489) [-576.408] (-575.355) * [-576.066] (-579.130) (-577.371) (-577.195) -- 0:00:50
Average standard deviation of split frequencies: 0.013971
205500 -- [-576.377] (-575.717) (-576.494) (-576.117) * (-575.563) (-581.543) [-574.612] (-579.791) -- 0:00:50
206000 -- (-575.478) (-575.717) (-576.481) [-575.529] * [-576.178] (-584.937) (-575.748) (-578.055) -- 0:00:50
206500 -- (-575.683) (-575.416) (-575.883) [-578.262] * [-575.215] (-582.012) (-576.618) (-577.703) -- 0:00:49
207000 -- (-580.761) [-573.414] (-576.099) (-575.497) * [-576.357] (-575.929) (-579.563) (-577.953) -- 0:00:49
207500 -- [-581.456] (-576.016) (-583.874) (-573.005) * (-576.475) (-576.057) [-578.828] (-580.954) -- 0:00:49
208000 -- (-577.350) (-576.608) (-580.020) [-574.543] * (-576.859) (-579.652) [-577.484] (-577.035) -- 0:00:49
208500 -- (-577.332) [-575.422] (-577.977) (-576.849) * (-580.508) (-580.437) [-576.656] (-578.256) -- 0:00:49
209000 -- (-579.770) (-579.012) (-576.026) [-578.266] * (-575.994) (-575.878) [-576.210] (-576.790) -- 0:00:49
209500 -- (-577.374) [-574.466] (-574.192) (-576.218) * [-576.789] (-577.303) (-578.166) (-575.812) -- 0:00:49
210000 -- (-576.800) [-578.315] (-577.866) (-578.161) * [-577.173] (-577.609) (-577.252) (-576.983) -- 0:00:48
Average standard deviation of split frequencies: 0.013675
210500 -- (-581.387) (-579.124) [-578.037] (-576.377) * (-575.476) (-576.845) (-576.842) [-576.806] -- 0:00:48
211000 -- (-576.330) (-576.158) [-581.227] (-577.237) * (-576.538) (-577.645) [-579.738] (-574.580) -- 0:00:48
211500 -- [-575.503] (-574.351) (-575.972) (-574.930) * (-576.364) (-577.191) [-574.623] (-574.320) -- 0:00:48
212000 -- [-576.545] (-575.997) (-576.879) (-576.119) * [-578.280] (-578.335) (-577.048) (-576.307) -- 0:00:48
212500 -- (-578.659) (-578.435) (-578.201) [-576.048] * (-576.847) [-577.838] (-577.609) (-582.461) -- 0:00:48
213000 -- (-578.849) [-575.985] (-576.151) (-576.600) * (-577.690) (-578.391) (-577.160) [-575.142] -- 0:00:48
213500 -- [-576.308] (-576.040) (-578.165) (-579.128) * (-574.453) [-576.177] (-577.835) (-576.561) -- 0:00:47
214000 -- (-576.748) [-575.482] (-579.641) (-578.431) * (-575.421) (-579.789) (-577.496) [-576.670] -- 0:00:47
214500 -- (-576.183) (-574.031) (-578.733) [-575.695] * (-576.763) (-578.492) [-573.646] (-576.498) -- 0:00:47
215000 -- (-578.342) (-578.598) [-575.973] (-578.068) * (-579.523) [-578.033] (-578.797) (-580.757) -- 0:00:51
Average standard deviation of split frequencies: 0.011397
215500 -- (-578.194) (-578.633) [-576.878] (-575.658) * (-575.139) [-576.430] (-577.329) (-577.946) -- 0:00:50
216000 -- (-576.375) (-577.618) [-575.060] (-575.210) * [-573.879] (-575.710) (-578.797) (-576.813) -- 0:00:50
216500 -- (-578.237) (-576.649) [-575.476] (-575.320) * (-574.950) (-576.096) [-575.971] (-575.811) -- 0:00:50
217000 -- (-574.398) [-579.318] (-575.847) (-578.547) * (-576.349) (-576.476) [-578.535] (-576.244) -- 0:00:50
217500 -- (-576.396) (-578.005) (-576.311) [-579.668] * [-575.680] (-578.048) (-577.576) (-578.590) -- 0:00:50
218000 -- (-579.867) [-579.041] (-576.292) (-575.357) * [-574.448] (-580.067) (-580.196) (-578.122) -- 0:00:50
218500 -- (-578.669) (-577.258) (-581.575) [-577.038] * [-575.787] (-577.635) (-574.420) (-575.565) -- 0:00:50
219000 -- (-580.652) (-576.968) [-580.019] (-575.750) * (-577.302) [-577.733] (-576.889) (-575.305) -- 0:00:49
219500 -- (-575.687) (-575.945) [-576.901] (-576.051) * [-575.696] (-575.467) (-586.073) (-574.732) -- 0:00:49
220000 -- (-576.498) (-577.346) (-581.543) [-577.489] * (-574.071) (-579.678) (-575.306) [-575.757] -- 0:00:49
Average standard deviation of split frequencies: 0.012692
220500 -- (-574.117) (-577.875) (-577.355) [-576.987] * (-577.402) (-579.745) (-578.922) [-574.616] -- 0:00:49
221000 -- [-578.043] (-580.012) (-577.903) (-575.990) * (-575.251) (-582.198) (-578.142) [-575.507] -- 0:00:49
221500 -- (-577.743) (-579.477) (-580.208) [-575.722] * [-575.432] (-575.875) (-576.767) (-579.496) -- 0:00:49
222000 -- [-575.583] (-579.240) (-576.505) (-578.027) * [-575.384] (-578.992) (-575.353) (-577.553) -- 0:00:49
222500 -- (-578.105) (-577.469) (-577.299) [-581.347] * (-575.085) (-576.551) [-576.792] (-579.194) -- 0:00:48
223000 -- [-574.851] (-575.696) (-577.217) (-580.029) * (-576.630) (-577.862) [-577.826] (-577.765) -- 0:00:48
223500 -- (-575.660) (-576.345) (-576.167) [-576.742] * [-575.152] (-575.363) (-576.408) (-578.502) -- 0:00:48
224000 -- (-573.910) (-576.513) (-577.233) [-575.805] * [-576.120] (-576.096) (-578.788) (-576.984) -- 0:00:48
224500 -- [-574.179] (-577.226) (-577.386) (-577.566) * (-578.465) [-577.985] (-576.592) (-577.357) -- 0:00:48
225000 -- (-575.819) (-574.107) [-578.028] (-578.655) * (-576.149) (-576.023) [-577.332] (-581.565) -- 0:00:48
Average standard deviation of split frequencies: 0.012052
225500 -- (-576.214) [-575.195] (-578.005) (-579.669) * [-578.848] (-575.162) (-575.448) (-579.980) -- 0:00:48
226000 -- [-575.139] (-577.373) (-574.673) (-576.981) * (-582.235) (-576.521) [-575.260] (-576.080) -- 0:00:47
226500 -- (-576.122) (-575.215) [-573.884] (-575.076) * (-573.845) (-577.043) [-576.393] (-577.057) -- 0:00:47
227000 -- (-577.106) (-574.918) [-577.991] (-578.511) * (-580.960) (-577.886) (-580.000) [-576.578] -- 0:00:47
227500 -- (-577.263) [-577.567] (-574.859) (-578.732) * (-575.557) (-582.735) (-579.346) [-576.746] -- 0:00:47
228000 -- (-576.090) (-578.235) (-575.870) [-578.730] * [-577.026] (-575.707) (-576.419) (-575.860) -- 0:00:47
228500 -- (-577.118) (-574.598) (-582.082) [-575.253] * (-583.413) [-576.075] (-579.100) (-576.063) -- 0:00:47
229000 -- (-575.847) (-575.553) [-575.790] (-574.649) * [-579.040] (-581.589) (-578.747) (-577.131) -- 0:00:47
229500 -- (-576.138) (-575.545) (-577.424) [-575.104] * (-576.272) (-580.118) (-577.511) [-576.339] -- 0:00:47
230000 -- (-576.877) (-577.519) [-575.085] (-581.713) * (-578.307) (-580.354) (-574.924) [-576.887] -- 0:00:46
Average standard deviation of split frequencies: 0.012983
230500 -- (-575.438) [-575.662] (-575.787) (-576.117) * (-577.758) (-574.989) [-577.777] (-577.793) -- 0:00:46
231000 -- (-578.794) (-580.205) [-574.635] (-575.139) * (-576.308) (-576.067) (-575.981) [-579.825] -- 0:00:49
231500 -- (-574.434) (-577.220) [-575.736] (-574.262) * (-575.528) [-574.308] (-578.417) (-578.026) -- 0:00:49
232000 -- [-577.793] (-576.106) (-575.591) (-577.803) * (-578.506) (-577.070) [-577.510] (-586.487) -- 0:00:49
232500 -- (-574.653) (-576.851) [-578.958] (-577.560) * [-573.050] (-576.842) (-574.908) (-586.790) -- 0:00:49
233000 -- (-580.277) [-577.178] (-576.169) (-580.960) * [-578.511] (-574.528) (-579.072) (-578.889) -- 0:00:49
233500 -- [-574.562] (-579.114) (-576.404) (-579.775) * (-576.288) [-575.572] (-577.823) (-577.957) -- 0:00:49
234000 -- [-574.854] (-574.690) (-576.216) (-575.961) * (-575.514) (-575.989) (-577.824) [-579.317] -- 0:00:49
234500 -- (-575.001) [-574.568] (-580.969) (-577.727) * [-574.986] (-576.287) (-577.523) (-580.252) -- 0:00:48
235000 -- [-576.268] (-578.616) (-575.356) (-575.747) * [-575.518] (-575.689) (-576.070) (-576.776) -- 0:00:48
Average standard deviation of split frequencies: 0.013042
235500 -- (-585.725) (-575.729) (-575.666) [-576.937] * (-576.915) (-575.343) (-576.036) [-578.059] -- 0:00:48
236000 -- (-580.823) [-579.545] (-576.074) (-578.232) * (-574.588) (-576.956) [-579.127] (-578.672) -- 0:00:48
236500 -- (-580.398) [-580.114] (-577.663) (-578.391) * (-577.058) (-574.451) [-581.647] (-578.756) -- 0:00:48
237000 -- (-572.878) [-575.931] (-582.312) (-577.637) * (-575.032) (-576.485) [-576.769] (-576.896) -- 0:00:48
237500 -- (-575.779) [-576.437] (-578.948) (-577.935) * (-575.797) (-574.296) [-577.178] (-578.121) -- 0:00:48
238000 -- (-577.314) [-575.030] (-576.800) (-576.742) * (-579.095) (-576.851) (-578.611) [-581.594] -- 0:00:48
238500 -- (-581.304) (-578.893) [-577.567] (-578.360) * [-580.192] (-576.694) (-576.405) (-578.514) -- 0:00:47
239000 -- (-578.699) (-576.069) [-575.259] (-576.009) * (-578.280) (-575.035) [-575.768] (-576.970) -- 0:00:47
239500 -- [-575.260] (-574.433) (-576.677) (-578.141) * (-578.308) (-577.383) [-575.657] (-576.848) -- 0:00:47
240000 -- (-576.064) (-576.003) (-575.789) [-577.376] * (-576.047) (-576.709) [-575.610] (-576.555) -- 0:00:47
Average standard deviation of split frequencies: 0.013826
240500 -- [-574.424] (-574.759) (-577.104) (-577.657) * (-577.961) (-575.811) (-578.115) [-578.358] -- 0:00:47
241000 -- [-575.372] (-574.975) (-575.528) (-575.876) * (-575.376) [-575.410] (-580.900) (-576.836) -- 0:00:47
241500 -- [-573.495] (-575.178) (-576.985) (-575.446) * (-576.253) (-578.998) [-577.139] (-578.192) -- 0:00:47
242000 -- (-575.031) (-580.470) (-577.090) [-576.974] * (-579.223) (-582.639) [-576.401] (-578.684) -- 0:00:46
242500 -- [-577.910] (-576.135) (-583.360) (-575.364) * [-577.914] (-577.191) (-577.411) (-577.260) -- 0:00:46
243000 -- (-578.889) (-577.904) [-580.718] (-577.163) * (-577.129) [-575.415] (-577.929) (-577.196) -- 0:00:46
243500 -- (-575.565) (-578.242) [-574.912] (-575.726) * (-577.304) (-582.012) [-575.304] (-577.242) -- 0:00:46
244000 -- [-575.959] (-576.739) (-574.447) (-575.937) * (-575.322) (-577.176) [-577.128] (-576.830) -- 0:00:46
244500 -- [-575.564] (-576.375) (-576.695) (-576.441) * (-575.440) (-576.184) [-577.027] (-578.516) -- 0:00:46
245000 -- (-575.810) [-580.722] (-575.281) (-575.288) * (-582.781) (-577.537) (-576.960) [-576.096] -- 0:00:46
Average standard deviation of split frequencies: 0.015218
245500 -- [-575.633] (-574.083) (-576.369) (-579.241) * (-577.352) [-577.673] (-575.120) (-576.526) -- 0:00:46
246000 -- (-574.566) [-573.532] (-576.926) (-577.190) * (-578.197) (-575.498) (-574.655) [-578.862] -- 0:00:45
246500 -- (-577.883) (-577.715) (-573.988) [-577.527] * [-577.728] (-577.289) (-578.656) (-586.691) -- 0:00:45
247000 -- (-573.828) (-576.184) [-577.606] (-576.330) * (-576.943) (-578.824) [-576.030] (-577.205) -- 0:00:48
247500 -- [-576.942] (-575.226) (-576.392) (-576.342) * (-579.881) (-575.583) [-578.732] (-578.181) -- 0:00:48
248000 -- (-575.289) (-575.060) [-575.677] (-577.206) * (-579.597) (-576.400) (-576.126) [-577.866] -- 0:00:48
248500 -- [-575.190] (-577.147) (-574.655) (-576.385) * (-577.017) (-577.138) (-576.431) [-576.325] -- 0:00:48
249000 -- (-584.977) (-578.746) [-573.029] (-574.921) * (-575.533) (-577.968) [-577.767] (-579.442) -- 0:00:48
249500 -- [-576.167] (-576.696) (-577.089) (-576.827) * (-578.302) (-577.450) [-577.819] (-580.824) -- 0:00:48
250000 -- [-574.578] (-576.125) (-575.726) (-575.450) * (-574.692) (-578.202) (-575.671) [-576.059] -- 0:00:48
Average standard deviation of split frequencies: 0.015155
250500 -- [-574.550] (-576.170) (-575.504) (-574.918) * [-574.607] (-577.495) (-579.228) (-576.374) -- 0:00:47
251000 -- [-573.747] (-578.613) (-574.259) (-575.819) * (-577.101) [-573.608] (-577.653) (-582.112) -- 0:00:47
251500 -- (-573.824) [-576.402] (-575.255) (-578.347) * (-582.903) [-574.109] (-577.222) (-575.617) -- 0:00:47
252000 -- (-574.815) (-575.750) [-575.747] (-576.362) * (-581.395) [-573.651] (-577.003) (-579.042) -- 0:00:47
252500 -- [-575.058] (-575.322) (-575.334) (-580.312) * (-584.483) [-578.751] (-580.250) (-577.805) -- 0:00:47
253000 -- (-575.109) (-576.615) [-579.614] (-578.059) * (-576.647) (-574.438) (-576.385) [-575.357] -- 0:00:47
253500 -- [-575.937] (-580.977) (-575.933) (-575.562) * (-577.081) [-576.114] (-577.412) (-573.883) -- 0:00:47
254000 -- (-577.127) [-578.391] (-574.324) (-577.518) * [-575.754] (-577.967) (-576.047) (-575.981) -- 0:00:46
254500 -- (-576.369) [-574.010] (-574.532) (-577.973) * (-576.802) (-575.665) (-579.981) [-575.081] -- 0:00:46
255000 -- (-576.065) [-574.768] (-577.943) (-576.811) * (-578.895) [-576.995] (-575.725) (-574.765) -- 0:00:46
Average standard deviation of split frequencies: 0.015550
255500 -- (-576.595) (-580.017) [-575.612] (-577.049) * (-577.650) (-589.809) [-574.021] (-575.888) -- 0:00:46
256000 -- (-575.194) (-574.759) [-575.174] (-575.714) * (-579.075) (-581.666) (-576.121) [-575.019] -- 0:00:46
256500 -- (-579.907) [-576.326] (-575.896) (-576.824) * [-579.131] (-575.475) (-577.221) (-575.686) -- 0:00:46
257000 -- [-575.961] (-574.794) (-575.101) (-578.103) * (-578.261) [-578.363] (-576.467) (-574.939) -- 0:00:46
257500 -- (-576.006) (-574.962) (-576.554) [-584.059] * [-576.779] (-583.284) (-576.125) (-575.751) -- 0:00:46
258000 -- (-578.560) (-575.620) [-573.965] (-578.733) * (-577.262) [-575.781] (-576.798) (-576.814) -- 0:00:46
258500 -- (-579.719) (-574.681) (-574.676) [-577.746] * (-574.780) (-575.806) [-575.333] (-579.888) -- 0:00:45
259000 -- (-578.014) (-576.320) [-578.171] (-578.166) * [-576.165] (-577.248) (-575.271) (-580.345) -- 0:00:45
259500 -- (-575.963) [-577.265] (-577.678) (-577.170) * (-575.804) (-574.733) [-576.179] (-575.448) -- 0:00:45
260000 -- (-577.158) [-576.222] (-579.233) (-576.767) * (-576.799) (-575.363) [-575.577] (-576.259) -- 0:00:45
Average standard deviation of split frequencies: 0.016879
260500 -- (-575.558) (-575.899) [-577.357] (-576.238) * (-577.835) [-574.285] (-576.102) (-578.096) -- 0:00:45
261000 -- (-575.585) [-577.919] (-576.969) (-575.614) * (-579.301) [-575.558] (-577.376) (-577.975) -- 0:00:45
261500 -- (-577.004) (-577.828) (-576.395) [-576.021] * (-578.540) (-576.486) [-574.375] (-575.387) -- 0:00:45
262000 -- (-577.340) (-575.960) [-574.834] (-576.223) * (-578.269) (-576.086) [-576.263] (-574.728) -- 0:00:45
262500 -- (-578.283) (-578.540) (-575.667) [-576.769] * (-578.939) (-575.816) (-576.874) [-574.773] -- 0:00:44
263000 -- (-576.478) (-578.102) [-576.256] (-576.510) * [-577.299] (-576.375) (-578.259) (-577.020) -- 0:00:47
263500 -- (-575.077) (-580.469) [-573.342] (-576.374) * (-578.027) (-574.262) [-578.106] (-578.886) -- 0:00:47
264000 -- (-580.579) [-575.007] (-579.772) (-578.383) * (-578.620) (-574.001) (-575.762) [-578.636] -- 0:00:47
264500 -- (-577.119) (-576.560) [-577.581] (-575.964) * (-576.550) [-576.513] (-576.289) (-580.956) -- 0:00:47
265000 -- [-576.573] (-576.588) (-574.575) (-578.158) * (-575.739) [-577.060] (-576.360) (-576.252) -- 0:00:47
Average standard deviation of split frequencies: 0.016541
265500 -- (-574.167) (-575.089) (-574.677) [-576.369] * (-576.352) (-576.471) (-577.590) [-577.788] -- 0:00:47
266000 -- (-575.390) (-575.076) (-573.715) [-574.073] * [-577.831] (-576.972) (-577.695) (-578.453) -- 0:00:46
266500 -- (-577.067) (-578.119) [-574.524] (-578.458) * (-575.470) (-579.089) [-579.157] (-577.172) -- 0:00:46
267000 -- (-576.791) (-574.471) (-573.138) [-576.232] * (-577.122) [-577.191] (-577.274) (-577.860) -- 0:00:46
267500 -- (-576.776) (-576.853) (-580.101) [-576.588] * (-576.722) [-577.080] (-577.308) (-576.430) -- 0:00:46
268000 -- (-579.765) (-577.609) (-579.879) [-579.035] * (-577.782) (-581.714) (-576.970) [-579.605] -- 0:00:46
268500 -- (-577.841) [-574.913] (-577.052) (-578.756) * (-579.460) (-580.920) [-577.020] (-581.694) -- 0:00:46
269000 -- (-576.006) (-577.958) (-575.639) [-578.077] * (-577.578) (-576.694) [-576.801] (-577.824) -- 0:00:46
269500 -- (-575.188) (-577.175) [-577.885] (-582.416) * (-578.977) (-582.074) [-576.342] (-578.895) -- 0:00:46
270000 -- [-574.556] (-578.942) (-577.763) (-574.931) * (-582.744) (-579.352) [-577.433] (-576.853) -- 0:00:45
Average standard deviation of split frequencies: 0.017724
270500 -- (-574.395) [-575.805] (-575.259) (-577.390) * (-576.524) (-575.381) (-574.243) [-581.880] -- 0:00:45
271000 -- [-575.273] (-576.528) (-577.593) (-575.895) * (-576.245) [-575.120] (-577.297) (-579.497) -- 0:00:45
271500 -- (-573.353) (-575.758) (-575.490) [-578.745] * [-577.157] (-583.228) (-578.830) (-575.401) -- 0:00:45
272000 -- (-573.663) (-576.607) (-574.582) [-576.841] * (-576.792) (-578.574) [-576.632] (-577.540) -- 0:00:45
272500 -- (-573.249) (-575.319) [-575.254] (-577.068) * (-574.623) (-580.291) [-577.498] (-578.876) -- 0:00:45
273000 -- (-575.617) [-576.459] (-579.719) (-576.986) * (-576.462) (-582.560) [-576.337] (-577.468) -- 0:00:45
273500 -- (-575.863) (-577.969) (-578.013) [-577.241] * (-578.044) [-584.513] (-577.536) (-576.943) -- 0:00:45
274000 -- (-577.969) (-574.556) (-579.298) [-575.795] * (-578.655) [-575.623] (-577.523) (-578.584) -- 0:00:45
274500 -- [-573.763] (-580.315) (-576.423) (-579.940) * (-574.749) (-577.914) (-576.467) [-576.863] -- 0:00:44
275000 -- [-577.659] (-577.719) (-575.279) (-575.810) * (-578.035) [-576.650] (-578.225) (-578.317) -- 0:00:44
Average standard deviation of split frequencies: 0.016678
275500 -- (-576.569) [-577.707] (-574.904) (-576.537) * (-579.545) (-576.977) (-576.276) [-579.753] -- 0:00:44
276000 -- (-574.104) [-576.146] (-578.826) (-575.014) * (-583.302) [-577.254] (-583.541) (-579.922) -- 0:00:44
276500 -- [-577.894] (-574.871) (-574.852) (-575.706) * (-580.943) (-577.340) (-578.840) [-577.766] -- 0:00:44
277000 -- (-576.023) [-579.458] (-579.697) (-578.177) * (-577.563) (-577.029) [-576.273] (-575.753) -- 0:00:44
277500 -- [-575.878] (-574.820) (-578.373) (-577.087) * (-578.918) (-574.975) (-576.363) [-576.009] -- 0:00:44
278000 -- (-580.718) (-577.480) [-577.446] (-575.959) * (-578.555) (-576.870) [-574.409] (-576.365) -- 0:00:44
278500 -- (-574.873) (-581.342) (-578.301) [-575.718] * (-577.919) [-578.177] (-579.171) (-578.172) -- 0:00:44
279000 -- (-574.328) [-578.835] (-573.943) (-577.471) * (-578.674) [-577.627] (-579.620) (-575.611) -- 0:00:43
279500 -- [-574.131] (-576.638) (-573.699) (-576.416) * [-579.589] (-577.389) (-575.396) (-578.262) -- 0:00:46
280000 -- (-576.888) (-576.423) (-575.275) [-575.295] * (-577.407) (-576.237) (-578.497) [-576.864] -- 0:00:46
Average standard deviation of split frequencies: 0.016401
280500 -- (-575.931) [-575.670] (-576.225) (-576.932) * (-578.247) [-576.554] (-578.394) (-576.366) -- 0:00:46
281000 -- (-578.222) (-576.547) [-574.742] (-579.405) * (-577.051) [-577.344] (-575.686) (-576.974) -- 0:00:46
281500 -- (-578.331) (-576.184) (-573.507) [-576.963] * (-575.116) (-576.790) (-574.405) [-576.312] -- 0:00:45
282000 -- (-575.240) (-575.582) (-575.839) [-576.414] * (-577.209) (-578.763) [-576.242] (-575.709) -- 0:00:45
282500 -- (-574.268) (-576.430) (-575.267) [-574.761] * [-576.271] (-577.436) (-580.747) (-577.113) -- 0:00:45
283000 -- (-575.357) [-575.801] (-578.804) (-574.888) * [-579.449] (-579.810) (-576.886) (-577.713) -- 0:00:45
283500 -- (-577.096) (-578.252) (-575.686) [-576.046] * (-576.475) (-576.160) (-574.431) [-578.270] -- 0:00:45
284000 -- (-575.626) (-575.573) [-576.151] (-579.467) * (-577.530) (-574.366) [-576.758] (-578.919) -- 0:00:45
284500 -- (-574.657) (-577.403) (-580.189) [-581.340] * (-576.541) [-577.531] (-575.861) (-576.035) -- 0:00:45
285000 -- (-579.332) (-575.909) (-581.943) [-577.086] * [-574.574] (-578.394) (-577.301) (-583.169) -- 0:00:45
Average standard deviation of split frequencies: 0.016095
285500 -- (-576.128) [-575.950] (-577.652) (-577.856) * (-577.562) (-575.433) (-575.798) [-578.326] -- 0:00:45
286000 -- [-576.543] (-576.126) (-576.972) (-575.915) * (-577.712) [-576.281] (-573.736) (-577.564) -- 0:00:44
286500 -- [-577.152] (-577.128) (-574.237) (-576.740) * (-576.614) [-577.671] (-577.581) (-576.564) -- 0:00:44
287000 -- [-575.068] (-577.262) (-576.723) (-578.080) * (-576.351) (-573.397) (-576.330) [-575.555] -- 0:00:44
287500 -- (-575.291) [-574.511] (-578.972) (-574.303) * (-580.652) [-576.109] (-578.089) (-578.408) -- 0:00:44
288000 -- (-576.292) [-575.245] (-577.737) (-580.125) * (-577.789) [-575.209] (-576.781) (-577.064) -- 0:00:44
288500 -- (-577.258) (-578.087) [-580.015] (-581.462) * (-576.130) [-576.754] (-577.553) (-576.090) -- 0:00:44
289000 -- [-578.403] (-576.979) (-577.174) (-578.280) * [-577.632] (-576.132) (-575.473) (-577.414) -- 0:00:44
289500 -- (-578.396) (-578.039) [-575.327] (-578.262) * (-575.925) (-577.102) [-577.668] (-577.354) -- 0:00:44
290000 -- (-577.583) (-575.231) [-578.697] (-576.834) * (-578.651) (-578.493) [-575.680] (-579.011) -- 0:00:44
Average standard deviation of split frequencies: 0.014692
290500 -- (-579.086) [-578.541] (-576.446) (-577.740) * (-578.898) [-576.820] (-578.945) (-578.247) -- 0:00:43
291000 -- [-579.148] (-578.382) (-576.686) (-575.890) * (-577.840) (-577.379) (-578.783) [-577.709] -- 0:00:43
291500 -- [-576.573] (-575.825) (-575.498) (-576.553) * (-577.580) (-576.002) [-576.705] (-578.323) -- 0:00:43
292000 -- (-578.927) (-577.361) [-573.989] (-578.018) * [-577.060] (-576.644) (-577.902) (-576.158) -- 0:00:43
292500 -- (-576.514) (-580.805) [-576.937] (-577.765) * [-575.291] (-578.597) (-576.244) (-576.262) -- 0:00:43
293000 -- (-574.792) [-576.849] (-577.128) (-574.486) * (-576.387) (-577.356) (-574.608) [-577.245] -- 0:00:43
293500 -- (-576.853) (-583.494) (-573.079) [-576.940] * (-575.625) (-576.688) [-577.128] (-577.193) -- 0:00:43
294000 -- (-575.777) [-576.830] (-576.131) (-574.274) * (-576.737) [-577.335] (-576.906) (-576.670) -- 0:00:43
294500 -- (-576.053) (-576.321) [-577.540] (-575.884) * (-576.476) (-574.662) [-577.118] (-577.475) -- 0:00:43
295000 -- [-581.270] (-576.079) (-577.865) (-575.978) * (-580.224) (-577.467) [-579.286] (-577.602) -- 0:00:43
Average standard deviation of split frequencies: 0.015270
295500 -- (-575.322) (-577.580) (-577.821) [-575.844] * [-578.409] (-577.680) (-579.255) (-577.987) -- 0:00:45
296000 -- (-575.008) (-577.108) [-578.793] (-576.464) * (-578.276) [-576.898] (-575.820) (-578.095) -- 0:00:45
296500 -- (-578.520) (-576.652) (-578.134) [-577.234] * (-578.946) [-578.132] (-578.402) (-578.369) -- 0:00:45
297000 -- (-577.929) (-576.061) [-576.384] (-578.690) * (-575.257) [-582.763] (-577.383) (-578.304) -- 0:00:44
297500 -- (-576.989) (-578.095) (-575.777) [-577.221] * (-574.722) (-579.976) (-575.899) [-576.078] -- 0:00:44
298000 -- [-575.348] (-580.858) (-578.052) (-581.518) * (-575.894) (-577.743) [-575.936] (-576.880) -- 0:00:44
298500 -- (-575.899) [-578.303] (-577.103) (-577.203) * [-574.291] (-576.096) (-578.228) (-578.925) -- 0:00:44
299000 -- (-578.373) (-579.331) (-575.445) [-577.440] * (-575.858) (-578.656) (-581.726) [-576.311] -- 0:00:44
299500 -- (-580.286) (-578.399) (-577.687) [-576.290] * (-575.317) (-578.975) (-577.942) [-576.714] -- 0:00:44
300000 -- (-580.155) (-575.919) [-580.466] (-575.261) * (-576.204) [-577.837] (-578.409) (-578.227) -- 0:00:44
Average standard deviation of split frequencies: 0.014203
300500 -- [-577.964] (-576.777) (-579.762) (-576.330) * (-575.423) (-576.289) [-576.704] (-578.980) -- 0:00:44
301000 -- (-575.624) (-576.228) (-576.868) [-577.212] * [-576.144] (-576.645) (-577.994) (-577.874) -- 0:00:44
301500 -- (-578.325) (-577.255) (-578.933) [-580.341] * (-578.249) (-576.217) [-575.456] (-577.130) -- 0:00:44
302000 -- (-575.803) (-577.818) [-579.762] (-579.868) * (-576.695) (-576.269) [-576.470] (-576.553) -- 0:00:43
302500 -- (-576.473) (-575.914) (-577.122) [-577.807] * [-577.633] (-576.959) (-575.894) (-576.216) -- 0:00:43
303000 -- (-576.600) [-574.936] (-578.409) (-576.030) * (-580.059) [-577.189] (-579.793) (-577.415) -- 0:00:43
303500 -- (-577.820) (-577.513) [-576.868] (-577.489) * [-577.555] (-575.534) (-576.413) (-576.286) -- 0:00:43
304000 -- (-576.759) (-585.994) [-577.875] (-582.387) * (-576.461) [-576.978] (-577.769) (-578.835) -- 0:00:43
304500 -- [-575.952] (-576.630) (-577.647) (-576.542) * [-574.449] (-576.523) (-575.690) (-575.885) -- 0:00:43
305000 -- (-576.841) (-577.384) (-581.248) [-576.827] * [-575.448] (-578.808) (-576.295) (-578.171) -- 0:00:43
Average standard deviation of split frequencies: 0.013522
305500 -- (-576.568) (-579.448) (-577.628) [-576.648] * [-573.698] (-577.972) (-579.317) (-578.650) -- 0:00:43
306000 -- (-577.906) [-576.238] (-578.785) (-576.954) * (-578.799) (-576.362) [-576.650] (-574.818) -- 0:00:43
306500 -- (-581.196) (-578.360) (-580.730) [-578.560] * [-576.315] (-578.671) (-577.254) (-578.665) -- 0:00:42
307000 -- (-576.620) (-577.997) [-578.155] (-575.867) * (-576.843) [-575.280] (-579.955) (-577.163) -- 0:00:42
307500 -- [-574.193] (-577.608) (-577.035) (-576.140) * (-575.846) (-576.353) (-581.563) [-575.004] -- 0:00:42
308000 -- (-574.775) [-575.454] (-576.089) (-580.218) * [-575.117] (-577.223) (-577.577) (-577.306) -- 0:00:42
308500 -- (-577.248) (-580.407) [-574.297] (-577.461) * (-576.520) (-576.543) (-576.917) [-575.269] -- 0:00:42
309000 -- (-575.886) (-576.454) [-574.920] (-579.005) * (-578.241) [-576.598] (-578.284) (-576.401) -- 0:00:42
309500 -- (-577.896) (-576.424) [-576.630] (-575.467) * (-576.810) (-579.829) [-575.098] (-576.047) -- 0:00:42
310000 -- (-576.839) [-576.758] (-577.153) (-577.746) * (-577.301) (-576.760) (-575.705) [-579.139] -- 0:00:42
Average standard deviation of split frequencies: 0.013835
310500 -- (-574.096) (-576.683) (-575.312) [-577.689] * [-573.850] (-577.042) (-579.265) (-576.861) -- 0:00:42
311000 -- (-574.147) (-578.231) [-574.459] (-581.523) * [-575.051] (-577.094) (-576.958) (-576.978) -- 0:00:42
311500 -- (-576.097) (-578.247) [-576.303] (-575.905) * (-574.570) [-577.061] (-577.181) (-578.013) -- 0:00:44
312000 -- (-576.982) (-575.978) [-575.267] (-574.608) * [-575.192] (-578.322) (-578.955) (-579.857) -- 0:00:44
312500 -- (-575.201) [-579.623] (-575.647) (-578.409) * (-575.887) (-576.619) [-575.036] (-576.411) -- 0:00:44
313000 -- (-575.801) [-575.378] (-576.898) (-578.433) * (-578.402) [-577.289] (-580.065) (-576.304) -- 0:00:43
313500 -- (-577.453) (-582.668) [-579.612] (-576.260) * (-575.097) (-575.336) (-575.816) [-576.207] -- 0:00:43
314000 -- (-581.602) (-576.764) [-578.338] (-578.335) * (-575.306) [-575.748] (-577.818) (-579.130) -- 0:00:43
314500 -- (-580.529) (-578.466) (-574.575) [-579.246] * (-578.975) (-576.337) (-577.063) [-580.219] -- 0:00:43
315000 -- (-575.695) (-579.597) (-578.088) [-578.894] * (-575.274) (-575.343) (-576.368) [-576.372] -- 0:00:43
Average standard deviation of split frequencies: 0.012929
315500 -- [-575.879] (-578.917) (-579.576) (-576.095) * [-576.996] (-578.692) (-575.579) (-579.486) -- 0:00:43
316000 -- (-575.901) (-580.250) (-577.467) [-579.871] * (-576.474) [-576.572] (-578.215) (-576.454) -- 0:00:43
316500 -- (-576.106) [-575.801] (-580.554) (-575.855) * (-581.073) (-577.461) [-576.382] (-577.594) -- 0:00:43
317000 -- (-574.778) [-575.519] (-574.275) (-576.695) * (-576.648) [-576.050] (-576.938) (-578.618) -- 0:00:43
317500 -- (-578.085) [-576.666] (-577.803) (-577.253) * [-577.910] (-581.211) (-578.409) (-576.969) -- 0:00:42
318000 -- (-578.397) [-578.463] (-574.084) (-576.143) * (-578.750) (-576.586) (-577.551) [-577.834] -- 0:00:42
318500 -- (-577.539) (-580.288) [-577.711] (-578.020) * (-575.583) (-578.232) [-577.395] (-575.829) -- 0:00:42
319000 -- (-579.452) (-578.387) [-576.230] (-576.630) * [-577.474] (-576.583) (-574.454) (-583.288) -- 0:00:42
319500 -- (-575.611) [-574.770] (-577.014) (-576.941) * [-576.140] (-577.895) (-577.620) (-578.223) -- 0:00:42
320000 -- (-577.277) (-576.487) [-576.055] (-576.405) * (-577.602) (-579.067) (-576.407) [-575.877] -- 0:00:42
Average standard deviation of split frequencies: 0.012496
320500 -- [-576.463] (-574.318) (-579.847) (-576.095) * [-578.222] (-574.924) (-578.828) (-576.990) -- 0:00:42
321000 -- (-580.431) [-577.067] (-577.336) (-576.768) * (-576.080) (-575.799) (-576.322) [-577.966] -- 0:00:42
321500 -- (-578.431) (-580.446) (-576.386) [-577.326] * (-576.612) (-576.758) (-575.488) [-576.965] -- 0:00:42
322000 -- (-578.052) (-578.118) [-576.752] (-576.079) * [-575.104] (-575.896) (-575.285) (-575.945) -- 0:00:42
322500 -- [-577.269] (-576.000) (-575.366) (-578.704) * (-577.161) (-575.546) (-575.629) [-576.524] -- 0:00:42
323000 -- (-577.375) (-574.625) [-577.146] (-574.363) * (-575.517) (-578.263) [-574.652] (-576.427) -- 0:00:41
323500 -- (-579.179) (-573.630) (-576.308) [-575.707] * (-576.174) (-579.677) [-574.756] (-578.687) -- 0:00:41
324000 -- (-578.404) (-575.651) (-575.103) [-580.517] * (-573.495) (-574.646) [-575.542] (-576.451) -- 0:00:41
324500 -- [-578.164] (-577.699) (-576.562) (-579.124) * (-579.788) (-577.941) [-578.873] (-578.522) -- 0:00:41
325000 -- (-575.908) (-576.855) [-577.286] (-576.767) * (-578.881) (-576.600) (-579.666) [-575.156] -- 0:00:41
Average standard deviation of split frequencies: 0.012291
325500 -- (-574.529) (-577.610) [-577.552] (-574.647) * [-574.115] (-578.155) (-574.238) (-576.263) -- 0:00:41
326000 -- (-576.653) (-574.486) (-582.003) [-574.952] * [-576.513] (-577.239) (-574.723) (-576.299) -- 0:00:41
326500 -- [-574.794] (-575.532) (-575.295) (-580.555) * (-575.792) (-575.611) (-573.578) [-575.193] -- 0:00:41
327000 -- [-576.952] (-576.325) (-576.366) (-578.645) * [-578.322] (-577.268) (-575.810) (-576.642) -- 0:00:41
327500 -- (-579.017) (-576.220) (-575.860) [-577.458] * (-573.283) (-580.898) (-575.170) [-577.619] -- 0:00:43
328000 -- [-576.682] (-577.321) (-580.671) (-578.664) * [-574.383] (-576.070) (-573.792) (-576.771) -- 0:00:43
328500 -- (-575.477) (-579.288) [-576.382] (-576.516) * (-575.877) (-579.094) [-576.334] (-576.196) -- 0:00:42
329000 -- [-577.196] (-573.650) (-579.463) (-577.780) * (-578.235) [-575.627] (-574.902) (-574.580) -- 0:00:42
329500 -- (-577.073) [-576.024] (-576.736) (-577.488) * [-577.966] (-581.136) (-575.691) (-577.647) -- 0:00:42
330000 -- [-578.859] (-576.306) (-577.092) (-579.073) * (-579.043) (-577.131) (-577.682) [-575.863] -- 0:00:42
Average standard deviation of split frequencies: 0.013147
330500 -- (-578.154) [-573.663] (-575.953) (-574.876) * (-575.513) [-576.482] (-582.664) (-577.492) -- 0:00:42
331000 -- (-577.823) (-578.641) [-575.157] (-576.877) * (-574.572) (-577.453) (-576.516) [-580.441] -- 0:00:42
331500 -- (-578.429) [-577.652] (-580.856) (-576.041) * (-574.528) (-576.547) [-576.485] (-575.143) -- 0:00:42
332000 -- (-577.721) [-576.618] (-576.566) (-576.981) * (-578.331) [-577.846] (-576.384) (-578.255) -- 0:00:42
332500 -- (-578.062) [-575.286] (-577.281) (-577.027) * (-577.161) (-576.499) [-576.412] (-577.487) -- 0:00:42
333000 -- (-576.766) [-575.029] (-576.286) (-578.622) * (-586.511) [-576.187] (-573.559) (-576.243) -- 0:00:42
333500 -- (-576.272) (-575.153) [-575.884] (-579.303) * (-580.595) (-576.793) [-574.700] (-580.476) -- 0:00:41
334000 -- (-577.911) [-576.857] (-577.629) (-581.300) * [-580.501] (-578.561) (-574.867) (-576.798) -- 0:00:41
334500 -- [-576.939] (-578.515) (-575.876) (-575.142) * (-581.634) [-575.185] (-580.262) (-576.647) -- 0:00:41
335000 -- (-577.700) (-578.165) (-577.361) [-576.244] * (-574.579) [-575.360] (-575.253) (-575.835) -- 0:00:41
Average standard deviation of split frequencies: 0.011692
335500 -- (-576.867) [-579.899] (-578.917) (-577.462) * (-576.842) (-580.198) [-574.980] (-574.956) -- 0:00:41
336000 -- (-578.466) (-576.285) [-575.478] (-577.789) * (-574.999) (-578.643) [-577.224] (-578.816) -- 0:00:41
336500 -- (-580.107) (-575.413) [-576.025] (-577.680) * [-574.272] (-576.318) (-575.900) (-578.131) -- 0:00:41
337000 -- (-576.852) (-576.607) [-574.764] (-576.076) * [-578.851] (-575.961) (-574.938) (-576.895) -- 0:00:41
337500 -- [-575.517] (-578.955) (-577.148) (-576.657) * (-578.964) (-575.980) (-577.543) [-576.582] -- 0:00:41
338000 -- (-573.644) (-574.545) (-577.302) [-577.373] * (-581.550) (-577.546) [-577.415] (-575.583) -- 0:00:41
338500 -- (-577.963) [-575.399] (-576.807) (-578.457) * [-576.425] (-578.634) (-577.571) (-576.027) -- 0:00:41
339000 -- (-576.265) (-582.179) (-576.021) [-578.306] * (-575.762) (-576.618) [-575.831] (-579.441) -- 0:00:40
339500 -- [-574.904] (-575.416) (-575.287) (-578.919) * [-575.201] (-579.193) (-581.188) (-576.760) -- 0:00:40
340000 -- (-575.015) [-575.865] (-576.746) (-574.661) * [-577.444] (-578.445) (-577.002) (-578.681) -- 0:00:40
Average standard deviation of split frequencies: 0.011531
340500 -- (-577.012) (-580.630) [-575.125] (-578.080) * (-577.565) [-575.070] (-574.598) (-577.012) -- 0:00:42
341000 -- [-583.010] (-577.443) (-576.260) (-575.768) * (-578.781) (-577.145) [-576.272] (-576.231) -- 0:00:42
341500 -- [-576.190] (-574.815) (-574.923) (-577.491) * (-574.542) (-578.439) (-574.295) [-574.568] -- 0:00:42
342000 -- (-576.526) (-577.353) (-576.113) [-576.657] * [-574.103] (-575.973) (-581.747) (-577.984) -- 0:00:42
342500 -- (-575.505) [-581.500] (-574.823) (-575.258) * [-574.338] (-577.651) (-577.799) (-578.989) -- 0:00:42
343000 -- (-574.260) (-578.340) (-578.373) [-577.113] * (-575.800) (-576.858) (-575.127) [-575.617] -- 0:00:42
343500 -- [-575.559] (-578.640) (-577.020) (-577.319) * (-576.176) (-579.581) [-577.048] (-576.910) -- 0:00:42
344000 -- (-577.712) [-576.594] (-576.006) (-576.493) * (-579.848) [-577.678] (-574.574) (-575.536) -- 0:00:41
344500 -- (-576.646) (-576.175) (-576.531) [-576.641] * (-580.584) (-576.670) [-576.780] (-582.465) -- 0:00:41
345000 -- (-576.967) [-575.739] (-575.246) (-575.038) * (-581.096) (-578.751) [-576.865] (-577.902) -- 0:00:41
Average standard deviation of split frequencies: 0.011808
345500 -- (-578.647) (-577.009) [-577.067] (-577.435) * [-576.193] (-579.857) (-573.396) (-575.539) -- 0:00:41
346000 -- (-576.871) (-579.846) [-575.695] (-578.376) * (-576.877) (-576.438) [-575.225] (-575.479) -- 0:00:41
346500 -- (-578.625) [-577.289] (-576.431) (-575.918) * (-574.943) (-575.642) (-577.636) [-574.353] -- 0:00:41
347000 -- (-574.685) [-574.729] (-578.900) (-575.708) * (-575.133) (-577.315) (-575.367) [-575.811] -- 0:00:41
347500 -- (-577.121) (-576.910) (-578.912) [-575.714] * (-577.745) (-579.122) [-574.004] (-578.032) -- 0:00:41
348000 -- (-577.895) [-579.914] (-576.196) (-574.563) * (-577.347) [-578.507] (-581.160) (-575.509) -- 0:00:41
348500 -- (-576.504) (-577.178) [-575.058] (-574.470) * [-574.844] (-577.181) (-574.980) (-576.890) -- 0:00:41
349000 -- (-576.001) (-577.663) (-580.231) [-578.757] * (-582.254) [-576.732] (-575.093) (-577.985) -- 0:00:41
349500 -- [-578.775] (-576.661) (-580.352) (-576.545) * (-578.156) (-575.219) [-578.572] (-576.829) -- 0:00:40
350000 -- (-576.471) (-576.434) [-575.862] (-575.047) * (-578.227) (-577.155) (-578.171) [-575.875] -- 0:00:40
Average standard deviation of split frequencies: 0.012173
350500 -- (-575.048) (-576.875) (-577.446) [-575.118] * [-577.217] (-577.333) (-576.104) (-576.698) -- 0:00:40
351000 -- [-573.142] (-578.118) (-577.896) (-576.558) * (-578.078) (-575.806) [-575.342] (-577.987) -- 0:00:40
351500 -- (-576.884) [-580.162] (-579.146) (-576.639) * (-576.595) [-577.534] (-576.733) (-574.600) -- 0:00:40
352000 -- [-579.277] (-581.415) (-577.759) (-576.725) * (-576.206) (-580.431) (-576.979) [-579.564] -- 0:00:42
352500 -- (-577.653) (-580.409) (-578.429) [-578.542] * (-576.978) [-576.656] (-586.302) (-579.659) -- 0:00:42
353000 -- (-575.458) (-577.857) (-578.456) [-576.914] * (-577.367) (-578.989) (-577.520) [-576.385] -- 0:00:42
353500 -- [-579.390] (-578.407) (-576.421) (-576.780) * [-577.681] (-577.009) (-577.561) (-574.746) -- 0:00:42
354000 -- (-576.509) [-577.591] (-573.734) (-576.940) * [-579.190] (-577.132) (-576.809) (-577.082) -- 0:00:41
354500 -- (-575.271) (-579.680) (-575.429) [-578.822] * [-579.856] (-577.245) (-578.203) (-577.804) -- 0:00:41
355000 -- [-577.283] (-579.175) (-578.050) (-576.519) * (-577.500) [-578.511] (-578.392) (-575.206) -- 0:00:41
Average standard deviation of split frequencies: 0.011918
355500 -- (-581.970) (-579.270) (-578.532) [-576.258] * [-579.689] (-577.613) (-576.668) (-581.315) -- 0:00:41
356000 -- (-577.255) (-576.502) (-575.982) [-577.387] * (-578.600) [-578.362] (-575.167) (-577.883) -- 0:00:41
356500 -- (-580.812) [-575.901] (-576.820) (-577.566) * [-576.346] (-576.335) (-577.112) (-576.470) -- 0:00:41
357000 -- [-578.268] (-577.989) (-580.299) (-581.579) * [-577.102] (-576.286) (-575.517) (-577.755) -- 0:00:41
357500 -- (-575.677) (-578.375) [-578.752] (-577.186) * (-577.093) (-578.772) (-576.385) [-577.003] -- 0:00:41
358000 -- (-578.320) [-577.698] (-578.649) (-577.678) * [-575.354] (-577.626) (-575.732) (-578.126) -- 0:00:41
358500 -- (-578.832) [-576.578] (-579.354) (-582.880) * (-576.128) (-578.102) [-574.504] (-582.268) -- 0:00:41
359000 -- [-577.017] (-577.086) (-576.673) (-583.666) * (-576.006) (-579.506) [-573.722] (-576.956) -- 0:00:41
359500 -- [-577.358] (-579.359) (-576.874) (-580.001) * (-581.128) [-577.329] (-576.803) (-578.417) -- 0:00:40
360000 -- (-578.796) (-577.114) [-576.000] (-574.698) * (-579.582) [-577.984] (-576.373) (-575.594) -- 0:00:40
Average standard deviation of split frequencies: 0.011473
360500 -- [-576.491] (-578.267) (-575.694) (-577.579) * (-577.733) (-577.327) [-576.818] (-576.834) -- 0:00:40
361000 -- (-577.252) [-578.391] (-576.200) (-576.315) * (-576.382) (-579.480) [-577.139] (-577.370) -- 0:00:40
361500 -- (-576.068) (-578.499) (-574.063) [-576.865] * (-575.889) [-577.965] (-580.271) (-578.582) -- 0:00:40
362000 -- (-574.392) (-575.714) [-575.808] (-576.769) * (-578.420) (-579.290) (-574.718) [-576.344] -- 0:00:40
362500 -- (-578.932) (-576.754) (-576.799) [-576.289] * (-575.135) (-576.611) [-574.000] (-577.176) -- 0:00:40
363000 -- [-579.209] (-575.514) (-574.960) (-577.721) * (-577.189) (-577.779) [-574.988] (-574.864) -- 0:00:40
363500 -- (-583.036) [-575.863] (-576.181) (-579.284) * (-578.609) (-581.359) (-575.185) [-575.731] -- 0:00:40
364000 -- (-582.655) (-577.689) [-575.232] (-578.476) * [-574.736] (-580.602) (-579.443) (-577.322) -- 0:00:41
364500 -- (-578.368) (-577.392) (-575.467) [-576.175] * [-574.860] (-578.511) (-576.825) (-576.101) -- 0:00:41
365000 -- [-579.206] (-576.065) (-575.814) (-577.205) * (-577.423) (-578.148) [-574.263] (-576.633) -- 0:00:41
Average standard deviation of split frequencies: 0.010519
365500 -- [-575.294] (-575.453) (-579.119) (-576.688) * (-577.356) (-577.961) (-573.269) [-576.342] -- 0:00:41
366000 -- (-575.122) [-576.504] (-577.825) (-577.478) * [-576.742] (-578.021) (-574.818) (-577.912) -- 0:00:41
366500 -- (-575.923) (-577.561) (-582.964) [-576.987] * (-576.847) (-582.015) [-575.068] (-577.725) -- 0:00:41
367000 -- [-576.767] (-579.190) (-576.651) (-578.165) * [-576.297] (-576.856) (-577.662) (-576.959) -- 0:00:41
367500 -- [-574.716] (-577.197) (-575.647) (-579.218) * (-575.424) [-577.998] (-574.719) (-576.322) -- 0:00:41
368000 -- (-575.689) [-575.153] (-577.855) (-578.795) * [-574.722] (-579.738) (-576.606) (-581.840) -- 0:00:41
368500 -- [-575.165] (-577.985) (-577.145) (-577.056) * (-573.751) [-575.588] (-578.876) (-582.773) -- 0:00:41
369000 -- (-580.137) [-575.223] (-576.302) (-574.242) * (-576.951) (-577.752) [-575.693] (-574.673) -- 0:00:41
369500 -- (-577.009) (-575.506) [-575.073] (-578.145) * (-577.262) [-576.000] (-577.203) (-583.535) -- 0:00:40
370000 -- (-575.788) [-576.854] (-576.505) (-578.285) * [-574.672] (-578.767) (-580.701) (-574.810) -- 0:00:40
Average standard deviation of split frequencies: 0.010527
370500 -- [-577.325] (-577.826) (-574.959) (-578.847) * (-577.131) (-579.845) (-576.040) [-577.970] -- 0:00:40
371000 -- [-578.217] (-575.792) (-577.339) (-575.598) * (-577.362) (-576.106) [-577.166] (-578.022) -- 0:00:40
371500 -- (-575.144) (-576.002) (-577.469) [-574.744] * (-577.346) (-576.711) (-575.525) [-575.492] -- 0:00:40
372000 -- (-576.894) (-576.142) [-577.121] (-574.686) * (-575.673) [-576.367] (-576.056) (-574.770) -- 0:00:40
372500 -- [-573.413] (-577.075) (-578.015) (-581.260) * (-574.088) [-575.127] (-577.291) (-576.991) -- 0:00:40
373000 -- (-578.912) (-578.530) [-576.451] (-576.653) * (-576.589) [-576.610] (-579.392) (-578.022) -- 0:00:40
373500 -- (-576.174) (-580.676) (-576.493) [-577.229] * (-576.057) (-577.721) [-578.347] (-575.360) -- 0:00:40
374000 -- [-575.987] (-578.497) (-581.087) (-576.190) * [-576.377] (-577.391) (-578.932) (-577.572) -- 0:00:40
374500 -- [-576.910] (-577.870) (-575.451) (-575.463) * (-573.312) [-578.182] (-577.760) (-579.806) -- 0:00:40
375000 -- [-574.955] (-574.907) (-576.068) (-577.868) * (-575.976) (-579.812) [-576.279] (-577.154) -- 0:00:40
Average standard deviation of split frequencies: 0.010935
375500 -- [-574.423] (-577.748) (-575.368) (-581.917) * (-577.672) (-576.634) (-578.162) [-576.485] -- 0:00:41
376000 -- (-576.197) [-574.441] (-576.428) (-577.153) * (-575.671) (-576.407) [-578.040] (-577.177) -- 0:00:41
376500 -- (-573.609) (-575.785) (-575.260) [-578.705] * [-579.730] (-579.360) (-576.883) (-578.298) -- 0:00:41
377000 -- [-578.122] (-577.075) (-574.343) (-578.601) * (-575.513) (-580.719) (-576.026) [-576.632] -- 0:00:41
377500 -- [-577.070] (-578.177) (-577.938) (-576.728) * (-576.748) (-577.700) [-575.364] (-576.761) -- 0:00:41
378000 -- [-573.651] (-581.198) (-575.035) (-574.519) * (-575.523) (-577.766) [-578.184] (-575.930) -- 0:00:41
378500 -- (-578.073) [-582.766] (-577.128) (-573.736) * [-574.231] (-577.123) (-575.560) (-578.086) -- 0:00:41
379000 -- [-578.072] (-577.352) (-578.638) (-579.017) * (-574.781) (-575.500) (-577.982) [-576.670] -- 0:00:40
379500 -- (-576.246) (-574.371) (-578.123) [-577.923] * (-575.500) (-574.798) (-577.440) [-577.434] -- 0:00:40
380000 -- (-580.114) (-576.105) [-574.504] (-577.005) * (-575.969) [-575.715] (-579.230) (-579.646) -- 0:00:40
Average standard deviation of split frequencies: 0.011145
380500 -- (-577.131) (-578.668) [-576.221] (-577.913) * [-575.245] (-575.281) (-580.081) (-574.812) -- 0:00:40
381000 -- [-576.410] (-575.944) (-582.423) (-578.222) * [-575.322] (-576.456) (-579.432) (-576.154) -- 0:00:40
381500 -- (-578.400) [-575.393] (-578.657) (-577.461) * (-576.197) (-577.945) (-577.212) [-577.491] -- 0:00:40
382000 -- [-577.399] (-579.257) (-577.153) (-576.657) * (-580.999) (-579.045) [-577.286] (-578.789) -- 0:00:40
382500 -- [-575.523] (-575.724) (-576.248) (-577.092) * [-578.503] (-577.727) (-578.794) (-575.852) -- 0:00:40
383000 -- (-576.790) (-575.369) [-575.200] (-575.215) * (-579.937) (-576.497) [-574.912] (-577.839) -- 0:00:40
383500 -- [-579.744] (-575.032) (-578.266) (-575.550) * (-581.088) (-576.508) [-576.078] (-578.154) -- 0:00:40
384000 -- (-578.551) [-577.961] (-579.039) (-579.047) * [-576.486] (-580.666) (-575.299) (-577.465) -- 0:00:40
384500 -- [-574.492] (-575.338) (-577.692) (-579.875) * (-578.030) (-579.020) [-575.132] (-576.897) -- 0:00:40
385000 -- (-575.666) (-576.915) [-581.512] (-577.949) * (-576.472) [-576.686] (-576.530) (-577.428) -- 0:00:39
Average standard deviation of split frequencies: 0.011398
385500 -- (-580.196) (-576.739) [-578.062] (-577.467) * (-579.937) (-579.542) (-578.860) [-576.752] -- 0:00:39
386000 -- (-581.887) [-577.796] (-574.606) (-577.056) * (-577.484) [-577.636] (-578.712) (-577.342) -- 0:00:39
386500 -- (-577.443) [-575.393] (-576.827) (-578.044) * (-578.288) (-575.585) [-576.555] (-576.808) -- 0:00:39
387000 -- [-576.870] (-577.706) (-579.490) (-576.138) * [-575.007] (-576.026) (-574.612) (-582.842) -- 0:00:39
387500 -- (-582.260) (-574.762) (-575.988) [-577.527] * (-577.010) (-583.228) [-575.025] (-581.621) -- 0:00:39
388000 -- [-579.057] (-576.498) (-577.613) (-578.380) * (-578.357) [-577.409] (-575.270) (-581.360) -- 0:00:39
388500 -- [-578.927] (-576.165) (-576.276) (-578.008) * (-578.442) [-576.195] (-574.446) (-580.142) -- 0:00:39
389000 -- (-579.312) [-576.146] (-579.260) (-574.190) * [-576.933] (-576.512) (-576.920) (-584.679) -- 0:00:39
389500 -- [-578.773] (-575.379) (-577.802) (-577.659) * (-578.190) (-576.622) (-576.032) [-579.314] -- 0:00:39
390000 -- (-575.885) (-576.976) (-575.942) [-576.485] * (-577.959) (-575.712) (-576.408) [-579.997] -- 0:00:39
Average standard deviation of split frequencies: 0.012422
390500 -- (-577.359) [-576.595] (-576.096) (-578.594) * (-575.410) (-576.541) (-578.076) [-576.647] -- 0:00:40
391000 -- (-577.902) (-573.694) (-575.790) [-575.662] * (-575.304) (-580.112) (-576.592) [-577.269] -- 0:00:40
391500 -- (-578.546) [-574.811] (-578.275) (-576.966) * (-576.268) (-580.467) (-578.607) [-577.862] -- 0:00:40
392000 -- (-576.548) (-574.672) [-577.269] (-578.196) * (-577.538) (-578.066) (-576.728) [-576.193] -- 0:00:40
392500 -- (-575.569) [-577.524] (-579.018) (-579.945) * (-578.656) (-578.480) [-582.254] (-577.492) -- 0:00:40
393000 -- (-577.673) [-576.637] (-577.598) (-578.190) * [-577.664] (-576.150) (-577.184) (-576.659) -- 0:00:40
393500 -- (-577.393) [-574.178] (-579.381) (-577.071) * [-577.153] (-576.170) (-580.698) (-576.372) -- 0:00:40
394000 -- [-576.904] (-574.447) (-577.688) (-574.285) * (-578.776) [-578.048] (-584.118) (-578.397) -- 0:00:39
394500 -- [-575.940] (-577.310) (-576.956) (-576.274) * (-578.921) (-578.855) (-577.459) [-577.125] -- 0:00:39
395000 -- (-574.553) [-577.866] (-577.175) (-577.311) * (-579.890) [-577.436] (-574.818) (-578.416) -- 0:00:39
Average standard deviation of split frequencies: 0.012425
395500 -- (-575.341) [-575.902] (-578.731) (-576.808) * (-576.690) (-576.834) [-577.824] (-575.305) -- 0:00:39
396000 -- [-577.497] (-576.959) (-575.045) (-576.880) * [-576.608] (-579.681) (-578.907) (-577.643) -- 0:00:39
396500 -- [-577.209] (-575.863) (-579.652) (-575.970) * (-579.100) (-579.554) (-577.465) [-575.755] -- 0:00:39
397000 -- (-575.820) (-577.134) [-576.664] (-579.382) * (-582.667) (-578.389) (-582.195) [-576.307] -- 0:00:39
397500 -- (-579.218) [-576.225] (-576.943) (-579.160) * [-576.903] (-575.075) (-576.489) (-574.345) -- 0:00:39
398000 -- [-578.583] (-582.103) (-576.035) (-575.972) * [-576.406] (-576.809) (-576.493) (-578.975) -- 0:00:39
398500 -- [-575.127] (-577.501) (-577.245) (-577.368) * (-578.967) [-576.128] (-577.149) (-575.979) -- 0:00:39
399000 -- (-576.605) (-580.158) [-576.335] (-577.670) * (-575.555) [-575.680] (-577.178) (-579.389) -- 0:00:39
399500 -- (-576.556) (-577.244) [-576.965] (-576.204) * [-575.844] (-578.535) (-575.145) (-577.399) -- 0:00:39
400000 -- (-579.364) (-576.243) [-575.061] (-578.594) * (-577.121) (-583.428) (-576.513) [-579.039] -- 0:00:39
Average standard deviation of split frequencies: 0.011839
400500 -- (-580.071) [-573.675] (-576.294) (-580.726) * (-575.254) (-578.143) [-576.835] (-578.395) -- 0:00:38
401000 -- (-581.130) (-575.413) [-576.349] (-576.764) * (-581.961) [-576.895] (-575.876) (-578.012) -- 0:00:38
401500 -- (-575.667) (-575.389) [-574.419] (-578.305) * (-576.338) [-576.975] (-576.448) (-575.840) -- 0:00:38
402000 -- (-576.944) (-575.652) [-577.377] (-578.935) * [-575.980] (-578.122) (-579.572) (-575.617) -- 0:00:38
402500 -- [-574.722] (-574.430) (-579.900) (-576.077) * [-577.701] (-576.505) (-579.360) (-575.597) -- 0:00:38
403000 -- (-575.888) (-573.795) (-576.729) [-575.224] * [-575.994] (-577.192) (-577.631) (-575.933) -- 0:00:38
403500 -- (-576.123) [-577.872] (-575.628) (-575.616) * (-574.997) (-575.511) [-576.080] (-575.525) -- 0:00:38
404000 -- (-575.595) (-580.696) [-577.526] (-577.045) * [-576.216] (-579.229) (-576.444) (-579.250) -- 0:00:38
404500 -- (-575.843) (-580.710) (-577.282) [-578.382] * (-577.000) [-577.539] (-573.926) (-579.534) -- 0:00:38
405000 -- (-576.148) (-573.718) [-579.329] (-577.915) * (-576.840) (-578.635) (-587.919) [-573.834] -- 0:00:39
Average standard deviation of split frequencies: 0.011321
405500 -- (-576.943) [-574.784] (-575.821) (-578.056) * (-575.689) (-577.620) (-580.883) [-577.893] -- 0:00:39
406000 -- (-577.804) (-578.539) [-577.248] (-580.219) * (-577.372) (-580.867) (-579.624) [-578.473] -- 0:00:39
406500 -- (-578.044) (-575.825) [-575.718] (-580.462) * [-575.741] (-580.643) (-587.624) (-578.564) -- 0:00:39
407000 -- (-578.333) [-574.584] (-574.154) (-581.738) * (-575.274) (-577.420) (-580.017) [-576.568] -- 0:00:39
407500 -- (-577.220) [-576.870] (-582.858) (-578.001) * (-575.620) [-576.481] (-580.226) (-580.050) -- 0:00:39
408000 -- [-579.786] (-574.463) (-584.834) (-576.578) * (-577.452) [-576.649] (-577.391) (-576.132) -- 0:00:39
408500 -- [-578.297] (-576.131) (-579.484) (-576.622) * (-576.854) (-577.442) (-576.644) [-577.927] -- 0:00:39
409000 -- (-576.127) [-575.148] (-577.027) (-579.949) * (-577.138) [-574.725] (-576.492) (-575.245) -- 0:00:39
409500 -- (-576.314) (-577.061) (-576.353) [-574.334] * (-577.422) (-576.232) (-575.279) [-576.153] -- 0:00:38
410000 -- (-579.201) (-576.393) (-575.369) [-575.991] * [-575.544] (-574.941) (-580.291) (-575.474) -- 0:00:38
Average standard deviation of split frequencies: 0.010762
410500 -- [-576.347] (-577.103) (-576.329) (-577.209) * (-575.603) (-575.616) [-577.414] (-578.595) -- 0:00:38
411000 -- (-577.196) [-577.333] (-575.985) (-578.745) * (-578.241) (-575.385) (-578.038) [-578.142] -- 0:00:38
411500 -- [-578.252] (-577.210) (-577.764) (-579.252) * (-576.944) (-574.790) (-576.016) [-578.476] -- 0:00:38
412000 -- (-576.365) (-576.701) (-573.946) [-576.378] * [-575.184] (-577.515) (-575.079) (-583.936) -- 0:00:38
412500 -- (-582.413) [-577.196] (-573.408) (-579.612) * [-575.818] (-580.177) (-575.182) (-578.005) -- 0:00:38
413000 -- (-575.417) (-574.835) [-574.324] (-579.677) * (-576.246) (-576.272) (-576.157) [-577.928] -- 0:00:38
413500 -- (-583.602) (-576.252) [-575.922] (-581.263) * (-576.369) (-579.227) (-577.550) [-577.770] -- 0:00:38
414000 -- (-576.053) (-575.551) [-574.207] (-580.228) * (-575.470) (-576.196) [-575.506] (-575.177) -- 0:00:38
414500 -- (-575.077) (-576.752) [-573.830] (-579.637) * (-575.406) [-575.956] (-576.648) (-575.901) -- 0:00:38
415000 -- (-578.421) (-577.711) [-576.773] (-576.856) * (-577.165) (-575.155) (-576.806) [-576.890] -- 0:00:38
Average standard deviation of split frequencies: 0.010482
415500 -- [-574.258] (-579.355) (-573.329) (-577.966) * [-576.650] (-575.780) (-575.491) (-575.958) -- 0:00:37
416000 -- [-577.340] (-579.381) (-574.890) (-575.748) * (-577.106) (-575.545) [-576.147] (-577.263) -- 0:00:37
416500 -- (-577.755) (-576.594) (-574.745) [-574.178] * (-577.135) (-577.011) (-576.101) [-578.361] -- 0:00:37
417000 -- (-580.945) [-573.539] (-575.437) (-578.250) * (-576.214) (-580.060) (-576.402) [-577.480] -- 0:00:37
417500 -- (-574.899) [-575.680] (-577.305) (-574.879) * [-575.862] (-576.450) (-576.241) (-575.117) -- 0:00:37
418000 -- [-575.055] (-578.912) (-579.002) (-575.984) * (-576.100) [-573.883] (-575.955) (-579.933) -- 0:00:37
418500 -- (-577.250) (-577.236) [-576.807] (-575.420) * (-574.768) [-575.459] (-577.096) (-574.182) -- 0:00:37
419000 -- (-576.196) (-575.921) (-576.320) [-574.335] * (-574.337) (-576.869) (-577.137) [-574.210] -- 0:00:37
419500 -- (-574.894) (-578.101) [-576.502] (-576.943) * (-578.387) [-575.962] (-576.537) (-574.774) -- 0:00:37
420000 -- (-575.832) [-577.109] (-576.649) (-574.767) * (-579.041) (-576.460) [-577.234] (-575.471) -- 0:00:38
Average standard deviation of split frequencies: 0.011136
420500 -- (-575.563) (-576.842) [-577.559] (-576.269) * (-580.026) (-578.323) (-577.541) [-578.124] -- 0:00:38
421000 -- [-577.566] (-578.654) (-577.974) (-577.080) * (-575.991) (-576.812) [-575.943] (-578.429) -- 0:00:38
421500 -- [-576.017] (-576.068) (-576.127) (-576.167) * (-577.596) (-576.998) (-576.963) [-577.423] -- 0:00:38
422000 -- [-576.825] (-575.273) (-577.729) (-576.622) * (-575.919) [-573.722] (-574.813) (-576.017) -- 0:00:38
422500 -- [-577.871] (-575.373) (-576.963) (-575.513) * (-583.134) (-575.927) [-574.839] (-576.334) -- 0:00:38
423000 -- [-576.478] (-576.974) (-577.686) (-575.982) * (-576.527) (-576.874) (-579.082) [-576.851] -- 0:00:38
423500 -- (-575.414) (-576.218) [-586.646] (-575.159) * (-577.811) (-575.490) [-577.403] (-577.789) -- 0:00:38
424000 -- (-576.366) (-580.383) [-577.000] (-581.156) * (-578.128) (-574.050) (-576.582) [-578.996] -- 0:00:38
424500 -- [-574.864] (-581.964) (-583.398) (-577.917) * (-576.645) (-574.544) (-578.059) [-576.506] -- 0:00:37
425000 -- (-576.650) [-578.499] (-577.074) (-578.920) * (-574.265) [-576.151] (-578.167) (-576.995) -- 0:00:37
Average standard deviation of split frequencies: 0.011481
425500 -- [-578.021] (-577.089) (-579.005) (-577.491) * [-579.480] (-577.421) (-579.613) (-574.510) -- 0:00:37
426000 -- [-575.218] (-577.224) (-582.590) (-574.242) * (-575.517) [-576.042] (-576.326) (-574.157) -- 0:00:37
426500 -- (-575.714) (-576.787) (-575.704) [-575.610] * (-577.153) (-576.774) [-574.475] (-574.959) -- 0:00:37
427000 -- [-576.571] (-580.362) (-575.463) (-577.917) * (-575.337) (-580.198) (-581.332) [-577.535] -- 0:00:37
427500 -- (-576.351) (-576.100) (-579.411) [-575.472] * (-577.948) [-573.826] (-576.025) (-577.381) -- 0:00:37
428000 -- (-577.227) [-575.404] (-578.054) (-576.489) * (-575.010) (-574.156) (-577.455) [-574.736] -- 0:00:37
428500 -- (-577.297) (-576.040) (-576.911) [-576.967] * (-574.740) (-577.076) [-575.680] (-578.689) -- 0:00:37
429000 -- (-576.499) (-576.485) [-577.956] (-578.063) * (-575.102) (-578.012) (-576.885) [-579.616] -- 0:00:37
429500 -- (-576.777) (-578.294) [-578.145] (-574.105) * (-575.701) [-573.950] (-577.243) (-577.057) -- 0:00:37
430000 -- [-578.047] (-575.351) (-580.266) (-579.874) * (-576.175) (-575.432) (-579.719) [-576.002] -- 0:00:37
Average standard deviation of split frequencies: 0.010399
430500 -- [-577.658] (-577.704) (-579.307) (-577.513) * (-577.878) (-580.017) [-576.434] (-574.062) -- 0:00:37
431000 -- (-576.214) (-576.928) (-576.239) [-577.225] * (-578.356) [-576.474] (-576.179) (-576.587) -- 0:00:36
431500 -- (-576.055) [-574.242] (-577.450) (-580.110) * (-578.298) (-575.894) [-576.249] (-574.813) -- 0:00:36
432000 -- (-577.111) (-575.904) (-577.246) [-579.094] * (-575.722) (-579.435) [-575.415] (-578.335) -- 0:00:36
432500 -- [-579.760] (-577.558) (-575.548) (-579.772) * (-576.660) (-576.745) (-576.949) [-576.901] -- 0:00:36
433000 -- (-579.984) (-576.159) [-576.490] (-576.701) * (-577.048) [-578.685] (-574.536) (-575.941) -- 0:00:36
433500 -- (-576.855) (-577.631) (-584.031) [-576.666] * (-576.952) (-575.392) [-576.808] (-576.586) -- 0:00:36
434000 -- (-576.896) (-577.267) (-578.044) [-576.473] * (-575.478) (-581.531) [-577.160] (-579.169) -- 0:00:36
434500 -- (-578.719) (-576.518) (-578.947) [-574.954] * (-576.623) (-579.624) [-577.423] (-577.546) -- 0:00:36
435000 -- (-577.437) (-580.706) [-574.547] (-576.153) * (-575.602) (-576.339) (-576.357) [-574.910] -- 0:00:36
Average standard deviation of split frequencies: 0.010609
435500 -- (-576.729) (-580.235) [-577.586] (-575.587) * (-578.961) (-577.160) [-575.367] (-577.340) -- 0:00:37
436000 -- (-576.187) (-579.563) [-577.665] (-575.516) * (-576.695) [-575.037] (-576.122) (-577.333) -- 0:00:37
436500 -- [-576.194] (-577.623) (-576.611) (-579.144) * (-578.692) [-573.706] (-576.655) (-577.486) -- 0:00:37
437000 -- (-577.991) (-577.948) (-576.572) [-576.546] * (-576.091) (-579.123) [-577.322] (-579.240) -- 0:00:37
437500 -- (-575.539) (-580.181) (-578.309) [-576.046] * [-580.219] (-580.728) (-576.495) (-575.394) -- 0:00:37
438000 -- (-579.060) [-581.388] (-580.725) (-578.364) * [-576.203] (-575.677) (-576.167) (-577.356) -- 0:00:37
438500 -- (-577.037) (-582.701) [-579.454] (-583.644) * [-574.014] (-575.696) (-574.537) (-576.218) -- 0:00:37
439000 -- (-577.255) (-577.643) [-574.407] (-577.163) * [-577.033] (-573.915) (-577.012) (-574.271) -- 0:00:37
439500 -- (-576.824) (-576.262) (-578.889) [-576.288] * [-577.622] (-577.204) (-576.672) (-579.499) -- 0:00:36
440000 -- (-576.737) [-575.913] (-578.215) (-574.737) * (-575.218) (-583.676) (-578.241) [-576.073] -- 0:00:36
Average standard deviation of split frequencies: 0.010564
440500 -- (-578.410) (-576.325) (-576.036) [-577.919] * (-578.840) (-582.272) (-576.949) [-579.260] -- 0:00:36
441000 -- (-576.145) [-576.698] (-576.946) (-582.780) * (-576.422) (-576.749) (-580.533) [-576.771] -- 0:00:36
441500 -- (-576.597) (-574.383) (-580.593) [-577.708] * (-574.603) [-576.796] (-575.685) (-578.005) -- 0:00:36
442000 -- [-577.327] (-580.017) (-578.607) (-578.854) * (-577.714) (-577.255) (-577.364) [-575.570] -- 0:00:36
442500 -- [-576.051] (-578.300) (-580.611) (-576.446) * (-580.461) (-576.157) (-577.071) [-575.543] -- 0:00:36
443000 -- (-577.462) [-574.868] (-574.297) (-577.521) * (-577.630) (-574.772) (-577.606) [-576.216] -- 0:00:36
443500 -- (-577.123) (-577.719) [-574.406] (-582.263) * (-577.237) [-576.402] (-574.946) (-575.715) -- 0:00:36
444000 -- [-577.429] (-575.971) (-586.792) (-576.368) * (-576.573) (-575.821) [-578.160] (-577.563) -- 0:00:36
444500 -- [-578.352] (-576.091) (-582.312) (-575.112) * [-576.522] (-578.166) (-578.097) (-575.829) -- 0:00:36
445000 -- (-576.381) [-577.135] (-577.786) (-576.980) * [-577.899] (-581.242) (-576.440) (-581.898) -- 0:00:36
Average standard deviation of split frequencies: 0.010041
445500 -- (-577.966) (-576.263) [-576.319] (-577.880) * (-578.756) (-576.112) [-576.134] (-578.542) -- 0:00:36
446000 -- (-576.838) (-577.663) [-577.650] (-578.608) * (-575.897) [-574.761] (-575.133) (-576.888) -- 0:00:36
446500 -- [-574.417] (-576.056) (-575.794) (-578.044) * [-574.999] (-578.646) (-576.065) (-576.428) -- 0:00:35
447000 -- (-579.173) [-579.629] (-573.171) (-577.502) * (-574.921) (-574.824) [-577.627] (-576.009) -- 0:00:35
447500 -- (-576.304) [-578.408] (-578.344) (-578.822) * (-578.550) [-575.006] (-577.891) (-575.700) -- 0:00:35
448000 -- (-578.338) (-576.213) [-576.013] (-576.195) * (-576.245) (-575.424) (-580.404) [-575.911] -- 0:00:35
448500 -- [-574.725] (-576.967) (-575.208) (-575.956) * (-574.784) [-580.105] (-578.664) (-576.368) -- 0:00:35
449000 -- (-577.362) (-578.425) [-574.889] (-576.465) * [-575.788] (-577.584) (-575.970) (-578.188) -- 0:00:35
449500 -- [-574.162] (-576.932) (-583.076) (-577.322) * (-577.650) [-573.869] (-576.566) (-577.172) -- 0:00:35
450000 -- (-577.763) (-581.785) (-582.522) [-575.636] * (-578.679) (-579.162) (-575.953) [-578.456] -- 0:00:35
Average standard deviation of split frequencies: 0.010199
450500 -- (-576.178) (-582.824) (-582.130) [-576.521] * (-576.680) (-575.171) [-577.119] (-576.766) -- 0:00:36
451000 -- (-574.613) [-576.922] (-579.330) (-575.879) * (-575.199) [-574.508] (-576.905) (-575.706) -- 0:00:36
451500 -- [-575.826] (-575.370) (-578.776) (-576.078) * (-576.021) (-578.608) (-577.079) [-574.471] -- 0:00:36
452000 -- (-577.240) (-578.836) (-578.507) [-576.763] * [-577.096] (-581.154) (-575.875) (-579.091) -- 0:00:36
452500 -- (-578.132) [-576.169] (-576.239) (-575.825) * [-577.159] (-577.453) (-579.352) (-579.083) -- 0:00:36
453000 -- (-576.142) [-574.544] (-577.291) (-575.454) * (-574.170) [-576.342] (-579.508) (-576.249) -- 0:00:36
453500 -- (-576.536) (-584.991) [-576.567] (-578.192) * [-575.924] (-577.092) (-579.094) (-575.008) -- 0:00:36
454000 -- (-579.743) [-574.444] (-576.948) (-577.204) * (-573.411) (-579.509) [-579.898] (-578.270) -- 0:00:36
454500 -- (-577.123) [-579.292] (-577.101) (-576.513) * (-573.406) [-575.906] (-581.046) (-577.933) -- 0:00:36
455000 -- (-576.148) [-576.010] (-574.909) (-576.394) * [-574.963] (-576.702) (-579.403) (-578.485) -- 0:00:35
Average standard deviation of split frequencies: 0.010273
455500 -- (-580.522) (-579.655) [-574.817] (-576.147) * [-577.217] (-575.056) (-576.298) (-574.857) -- 0:00:35
456000 -- (-576.789) (-575.834) (-577.973) [-578.594] * [-576.547] (-577.683) (-583.346) (-575.704) -- 0:00:35
456500 -- [-574.434] (-577.162) (-576.312) (-578.273) * [-575.634] (-574.472) (-575.553) (-579.880) -- 0:00:35
457000 -- [-576.231] (-577.164) (-575.179) (-580.278) * (-575.249) [-572.668] (-577.124) (-573.452) -- 0:00:35
457500 -- (-576.390) (-575.056) (-575.772) [-574.637] * [-576.423] (-576.230) (-576.990) (-577.500) -- 0:00:35
458000 -- [-577.321] (-576.567) (-574.984) (-574.352) * (-576.613) (-577.923) [-576.175] (-577.907) -- 0:00:35
458500 -- [-576.592] (-576.900) (-577.532) (-576.256) * (-576.494) [-575.245] (-578.184) (-576.587) -- 0:00:35
459000 -- (-576.974) [-575.662] (-577.772) (-577.642) * (-574.407) (-575.977) (-578.983) [-579.070] -- 0:00:35
459500 -- (-574.077) [-576.671] (-576.684) (-576.110) * (-582.651) (-573.454) [-578.071] (-578.624) -- 0:00:35
460000 -- [-577.197] (-576.593) (-575.312) (-575.734) * (-574.741) (-574.625) [-577.071] (-576.033) -- 0:00:35
Average standard deviation of split frequencies: 0.009849
460500 -- (-577.941) (-577.355) [-576.543] (-575.792) * (-578.755) (-576.702) [-578.503] (-575.221) -- 0:00:35
461000 -- [-577.858] (-576.334) (-576.693) (-575.757) * (-576.730) [-575.693] (-578.225) (-573.442) -- 0:00:35
461500 -- (-575.044) (-575.757) [-575.543] (-576.622) * (-576.192) (-575.500) (-577.557) [-574.846] -- 0:00:35
462000 -- (-575.028) (-577.075) (-581.696) [-576.558] * (-576.833) (-574.706) (-575.985) [-574.933] -- 0:00:34
462500 -- (-576.050) (-580.190) [-575.567] (-577.458) * (-577.232) [-577.178] (-574.240) (-574.468) -- 0:00:34
463000 -- [-574.039] (-582.867) (-576.789) (-575.612) * [-575.645] (-573.347) (-576.833) (-577.774) -- 0:00:34
463500 -- (-575.545) (-579.640) [-576.058] (-577.402) * (-579.149) [-573.389] (-576.079) (-576.577) -- 0:00:34
464000 -- [-576.037] (-579.420) (-578.862) (-579.202) * (-580.376) (-579.330) (-576.493) [-578.846] -- 0:00:34
464500 -- (-577.154) (-581.213) [-578.962] (-573.893) * (-579.911) (-577.319) (-578.815) [-575.984] -- 0:00:34
465000 -- (-576.797) (-576.754) (-578.703) [-575.605] * (-580.680) (-577.762) (-580.720) [-578.030] -- 0:00:34
Average standard deviation of split frequencies: 0.009699
465500 -- (-577.861) [-576.851] (-575.264) (-575.534) * (-573.934) [-575.762] (-577.761) (-578.881) -- 0:00:34
466000 -- (-576.480) [-578.588] (-579.184) (-575.231) * (-575.311) [-575.877] (-576.311) (-576.480) -- 0:00:35
466500 -- [-576.366] (-574.777) (-576.287) (-582.580) * [-577.111] (-576.665) (-577.696) (-576.625) -- 0:00:35
467000 -- (-576.568) (-576.262) (-578.016) [-576.110] * [-578.542] (-575.563) (-577.859) (-577.151) -- 0:00:35
467500 -- [-575.771] (-574.606) (-575.849) (-577.764) * [-576.826] (-573.737) (-576.843) (-575.131) -- 0:00:35
468000 -- (-576.249) [-576.889] (-578.615) (-574.455) * (-577.499) (-577.996) (-576.834) [-574.267] -- 0:00:35
468500 -- (-577.707) (-577.372) (-576.288) [-578.425] * [-576.557] (-578.651) (-577.189) (-577.230) -- 0:00:35
469000 -- [-578.430] (-577.190) (-575.203) (-576.318) * (-581.799) [-575.872] (-577.693) (-575.801) -- 0:00:35
469500 -- (-577.537) (-577.917) (-575.848) [-577.136] * (-578.255) [-576.035] (-578.425) (-579.724) -- 0:00:35
470000 -- [-578.538] (-578.138) (-574.456) (-574.976) * (-575.722) (-580.909) (-577.774) [-573.199] -- 0:00:34
Average standard deviation of split frequencies: 0.010642
470500 -- [-575.150] (-578.563) (-579.257) (-573.970) * (-575.810) (-575.858) [-577.371] (-577.712) -- 0:00:34
471000 -- (-576.128) (-579.161) (-577.349) [-573.706] * (-574.901) (-575.855) [-578.699] (-573.967) -- 0:00:34
471500 -- (-577.380) (-581.359) (-575.622) [-579.975] * (-575.764) (-575.712) (-576.989) [-574.013] -- 0:00:34
472000 -- (-577.128) [-576.730] (-576.654) (-577.324) * (-573.277) [-581.361] (-579.368) (-578.428) -- 0:00:34
472500 -- (-578.874) (-576.406) [-576.422] (-577.948) * (-577.875) (-575.377) [-576.317] (-576.511) -- 0:00:34
473000 -- (-578.427) (-577.911) (-575.554) [-576.339] * (-577.318) (-578.307) (-578.569) [-575.843] -- 0:00:34
473500 -- (-575.720) (-575.323) [-577.267] (-578.615) * [-576.501] (-575.737) (-575.959) (-578.025) -- 0:00:34
474000 -- (-577.164) [-576.913] (-577.245) (-578.407) * (-575.092) [-576.388] (-574.973) (-574.815) -- 0:00:34
474500 -- (-578.663) [-574.634] (-575.908) (-578.256) * (-575.838) (-573.915) [-574.713] (-578.854) -- 0:00:34
475000 -- [-576.702] (-577.654) (-576.233) (-576.016) * [-577.263] (-574.373) (-576.504) (-577.034) -- 0:00:34
Average standard deviation of split frequencies: 0.011069
475500 -- (-577.041) [-576.402] (-577.960) (-580.388) * (-575.515) (-572.895) (-577.188) [-576.351] -- 0:00:34
476000 -- (-576.834) (-579.005) [-577.503] (-580.774) * (-576.860) [-578.312] (-577.701) (-574.112) -- 0:00:34
476500 -- (-576.451) (-576.806) (-576.838) [-577.998] * [-576.043] (-574.184) (-578.217) (-574.571) -- 0:00:34
477000 -- (-580.525) (-577.349) (-574.050) [-579.457] * (-577.484) (-579.361) (-576.108) [-579.691] -- 0:00:33
477500 -- (-579.496) (-576.057) [-575.537] (-577.014) * [-576.672] (-575.942) (-576.739) (-580.090) -- 0:00:33
478000 -- (-577.287) [-575.876] (-573.443) (-577.937) * [-577.370] (-575.384) (-578.568) (-581.369) -- 0:00:33
478500 -- (-577.304) (-576.101) [-576.777] (-576.555) * [-577.105] (-577.724) (-575.045) (-576.844) -- 0:00:33
479000 -- (-577.977) (-576.316) [-578.083] (-577.058) * (-580.270) [-574.770] (-575.792) (-577.296) -- 0:00:33
479500 -- (-576.191) (-575.785) (-583.242) [-578.254] * [-574.188] (-575.182) (-574.952) (-575.003) -- 0:00:33
480000 -- [-576.930] (-576.014) (-575.052) (-579.269) * [-578.727] (-578.037) (-576.986) (-575.554) -- 0:00:33
Average standard deviation of split frequencies: 0.012000
480500 -- [-578.883] (-574.561) (-578.374) (-577.666) * [-580.463] (-575.412) (-578.268) (-578.929) -- 0:00:33
481000 -- (-577.842) (-575.412) (-576.657) [-573.440] * (-577.868) (-575.086) (-582.383) [-578.110] -- 0:00:33
481500 -- (-575.414) (-575.556) (-577.875) [-574.064] * (-577.638) (-579.898) (-581.399) [-578.711] -- 0:00:33
482000 -- (-575.882) (-578.213) [-581.337] (-575.061) * (-577.043) (-579.487) (-575.910) [-578.208] -- 0:00:34
482500 -- (-580.541) (-575.067) [-576.162] (-578.039) * (-577.218) (-578.841) (-575.413) [-575.639] -- 0:00:34
483000 -- (-582.567) (-576.134) (-576.641) [-575.754] * [-582.611] (-579.122) (-578.058) (-578.045) -- 0:00:34
483500 -- (-573.707) (-576.721) [-576.433] (-575.208) * (-577.976) (-579.074) [-577.289] (-575.552) -- 0:00:34
484000 -- (-576.284) (-577.948) (-576.642) [-576.742] * [-575.545] (-579.752) (-576.768) (-576.896) -- 0:00:34
484500 -- (-576.518) (-579.394) [-575.874] (-576.672) * [-576.521] (-578.039) (-575.081) (-574.277) -- 0:00:34
485000 -- (-577.195) (-577.485) (-577.946) [-576.419] * (-580.134) (-574.733) [-577.346] (-580.310) -- 0:00:33
Average standard deviation of split frequencies: 0.011925
485500 -- [-578.206] (-579.746) (-573.660) (-578.337) * (-576.632) [-579.684] (-580.814) (-576.856) -- 0:00:33
486000 -- (-576.321) [-576.906] (-576.618) (-578.591) * (-581.340) (-580.489) (-574.072) [-576.095] -- 0:00:33
486500 -- (-579.580) (-577.911) (-578.086) [-575.583] * (-576.545) (-576.961) (-576.622) [-579.470] -- 0:00:33
487000 -- [-579.029] (-578.869) (-574.278) (-577.110) * (-577.045) (-577.581) (-580.229) [-574.202] -- 0:00:33
487500 -- (-578.207) (-576.706) [-574.437] (-579.384) * (-578.586) (-579.718) (-579.611) [-574.006] -- 0:00:33
488000 -- (-574.836) [-577.301] (-578.654) (-578.659) * (-577.959) (-577.626) [-576.601] (-572.901) -- 0:00:33
488500 -- (-578.307) [-575.429] (-578.051) (-580.271) * (-577.514) (-576.660) (-579.650) [-577.573] -- 0:00:33
489000 -- (-576.024) (-579.913) (-576.215) [-576.134] * (-576.297) (-579.119) (-584.412) [-575.046] -- 0:00:33
489500 -- (-578.888) (-578.196) [-575.454] (-577.465) * (-578.894) [-576.735] (-577.796) (-576.235) -- 0:00:33
490000 -- (-576.599) (-576.447) (-578.965) [-575.213] * (-576.979) (-576.917) (-577.402) [-574.583] -- 0:00:33
Average standard deviation of split frequencies: 0.011981
490500 -- [-576.040] (-577.970) (-578.848) (-581.302) * (-581.514) (-576.526) [-577.948] (-574.902) -- 0:00:33
491000 -- (-579.012) (-574.819) [-576.642] (-578.146) * (-580.240) [-575.875] (-575.272) (-578.989) -- 0:00:33
491500 -- (-575.755) (-576.457) (-576.103) [-575.730] * (-575.536) [-574.235] (-577.889) (-574.447) -- 0:00:33
492000 -- (-575.505) [-575.695] (-577.066) (-576.225) * (-574.938) [-578.005] (-575.144) (-577.562) -- 0:00:33
492500 -- (-573.908) (-575.967) [-577.172] (-579.445) * [-576.839] (-576.605) (-591.108) (-575.884) -- 0:00:32
493000 -- [-577.216] (-576.532) (-577.145) (-581.387) * (-573.947) [-580.132] (-574.460) (-575.829) -- 0:00:32
493500 -- [-578.635] (-579.313) (-576.616) (-579.319) * (-577.846) [-574.959] (-577.690) (-576.260) -- 0:00:32
494000 -- [-576.196] (-579.104) (-576.250) (-584.609) * (-575.736) (-574.887) (-580.642) [-575.132] -- 0:00:32
494500 -- [-574.980] (-575.913) (-580.670) (-579.967) * (-577.189) [-574.606] (-576.703) (-574.349) -- 0:00:32
495000 -- (-578.935) (-577.229) (-578.993) [-576.278] * [-577.777] (-575.692) (-576.570) (-577.669) -- 0:00:32
Average standard deviation of split frequencies: 0.012058
495500 -- (-576.283) [-575.378] (-578.771) (-575.778) * [-576.980] (-575.708) (-578.571) (-574.325) -- 0:00:32
496000 -- (-575.484) (-576.560) (-574.753) [-574.733] * (-577.190) (-575.738) [-574.746] (-577.445) -- 0:00:32
496500 -- (-579.907) (-575.764) [-577.642] (-583.434) * [-577.899] (-578.180) (-581.547) (-575.525) -- 0:00:33
497000 -- (-575.800) [-574.978] (-576.000) (-581.034) * (-579.150) (-575.261) (-574.874) [-576.611] -- 0:00:33
497500 -- (-575.530) (-576.070) [-580.535] (-575.361) * (-580.043) (-578.287) [-574.586] (-577.032) -- 0:00:33
498000 -- (-578.217) [-575.861] (-579.947) (-576.777) * (-578.124) (-578.324) (-575.391) [-579.033] -- 0:00:33
498500 -- [-580.661] (-579.182) (-577.404) (-576.184) * (-577.188) (-577.216) [-575.164] (-575.107) -- 0:00:33
499000 -- (-578.500) (-577.341) [-575.509] (-576.966) * (-578.812) (-574.450) (-574.718) [-575.544] -- 0:00:33
499500 -- [-574.548] (-576.628) (-574.938) (-575.975) * (-583.465) (-577.202) (-575.671) [-577.183] -- 0:00:33
500000 -- (-578.248) [-575.061] (-575.657) (-578.765) * (-578.019) [-575.384] (-575.868) (-574.228) -- 0:00:33
Average standard deviation of split frequencies: 0.011926
500500 -- [-574.139] (-575.983) (-575.426) (-578.785) * [-575.960] (-577.776) (-575.325) (-577.257) -- 0:00:32
501000 -- (-575.072) (-575.944) (-576.527) [-575.727] * [-578.006] (-575.669) (-579.420) (-578.323) -- 0:00:32
501500 -- (-576.746) [-574.524] (-577.118) (-577.443) * (-575.122) (-574.965) (-577.936) [-576.164] -- 0:00:32
502000 -- (-576.326) (-579.932) (-577.555) [-575.432] * (-576.642) (-575.990) (-577.842) [-577.654] -- 0:00:32
502500 -- [-575.291] (-574.622) (-575.321) (-575.786) * (-575.850) [-579.705] (-579.090) (-578.620) -- 0:00:32
503000 -- [-575.239] (-574.954) (-578.899) (-576.206) * [-575.008] (-574.907) (-576.049) (-575.057) -- 0:00:32
503500 -- (-576.308) (-577.298) [-577.263] (-579.481) * [-578.555] (-575.474) (-576.225) (-581.012) -- 0:00:32
504000 -- (-577.132) (-575.912) [-574.495] (-574.578) * (-575.957) (-578.453) (-574.294) [-575.638] -- 0:00:32
504500 -- (-575.216) (-576.564) (-575.320) [-575.576] * (-577.808) (-578.084) [-575.783] (-574.546) -- 0:00:32
505000 -- [-575.773] (-577.420) (-574.873) (-573.964) * [-576.558] (-573.721) (-577.538) (-574.273) -- 0:00:32
Average standard deviation of split frequencies: 0.011471
505500 -- [-575.528] (-575.645) (-575.823) (-576.272) * (-576.611) (-576.113) (-573.449) [-576.134] -- 0:00:32
506000 -- [-578.665] (-575.837) (-576.758) (-577.372) * [-577.233] (-575.417) (-576.690) (-578.953) -- 0:00:32
506500 -- (-575.270) [-576.520] (-575.950) (-577.111) * (-578.128) (-578.635) (-574.749) [-577.953] -- 0:00:32
507000 -- (-576.062) [-576.938] (-575.106) (-577.511) * [-576.078] (-576.889) (-576.569) (-578.196) -- 0:00:32
507500 -- (-574.861) (-576.824) (-575.136) [-578.664] * (-575.236) (-575.779) [-575.555] (-580.164) -- 0:00:32
508000 -- (-576.002) (-576.628) [-575.334] (-576.560) * [-576.296] (-576.847) (-576.864) (-576.938) -- 0:00:31
508500 -- (-576.294) (-576.831) [-578.545] (-578.688) * (-580.207) (-574.621) [-575.701] (-577.705) -- 0:00:31
509000 -- [-575.940] (-576.721) (-577.842) (-575.172) * (-577.333) [-574.894] (-576.792) (-576.176) -- 0:00:31
509500 -- (-577.023) (-577.020) (-580.200) [-579.756] * (-582.441) (-575.148) (-573.928) [-576.044] -- 0:00:31
510000 -- [-576.222] (-576.336) (-575.443) (-578.398) * (-576.760) (-577.468) (-573.357) [-576.181] -- 0:00:31
Average standard deviation of split frequencies: 0.011250
510500 -- (-575.199) (-576.654) [-577.064] (-574.409) * (-579.824) (-579.437) [-574.419] (-578.967) -- 0:00:31
511000 -- (-573.220) (-578.171) [-576.103] (-574.392) * (-577.074) (-578.886) [-573.717] (-579.154) -- 0:00:31
511500 -- (-573.782) (-580.761) (-575.662) [-574.966] * (-578.596) [-578.376] (-574.840) (-576.346) -- 0:00:32
512000 -- (-575.453) (-579.515) [-575.748] (-576.138) * (-577.236) (-578.993) [-575.490] (-579.986) -- 0:00:32
512500 -- [-576.225] (-580.535) (-576.368) (-578.042) * (-578.080) (-576.499) (-580.180) [-577.096] -- 0:00:32
513000 -- (-575.677) [-574.623] (-578.381) (-580.351) * (-575.161) [-577.402] (-573.810) (-576.168) -- 0:00:32
513500 -- (-576.787) (-576.252) (-575.882) [-578.610] * (-574.983) [-576.431] (-574.888) (-576.800) -- 0:00:32
514000 -- [-576.189] (-576.526) (-576.087) (-579.061) * [-576.729] (-575.759) (-573.963) (-580.295) -- 0:00:32
514500 -- [-576.655] (-580.623) (-577.885) (-576.312) * (-575.232) [-575.346] (-574.675) (-576.663) -- 0:00:32
515000 -- (-576.765) (-577.514) (-576.343) [-575.211] * [-575.852] (-575.577) (-574.897) (-578.684) -- 0:00:32
Average standard deviation of split frequencies: 0.011511
515500 -- [-576.919] (-576.650) (-576.841) (-574.328) * (-577.790) [-576.894] (-577.217) (-579.226) -- 0:00:31
516000 -- (-574.672) [-579.728] (-576.656) (-574.991) * (-576.210) (-576.528) [-576.834] (-578.918) -- 0:00:31
516500 -- (-579.231) [-574.620] (-577.102) (-578.645) * (-576.988) [-573.272] (-576.093) (-579.849) -- 0:00:31
517000 -- (-581.736) [-577.896] (-575.784) (-579.648) * (-576.933) (-576.881) (-574.062) [-576.178] -- 0:00:31
517500 -- [-576.121] (-576.578) (-576.008) (-580.217) * (-576.878) (-574.636) [-573.916] (-575.986) -- 0:00:31
518000 -- (-577.761) [-575.521] (-574.754) (-581.731) * (-576.552) [-575.483] (-575.713) (-576.223) -- 0:00:31
518500 -- (-576.843) [-577.652] (-576.098) (-576.415) * (-575.245) [-577.330] (-576.815) (-580.059) -- 0:00:31
519000 -- (-579.264) (-577.211) [-575.589] (-577.947) * (-576.134) (-581.265) [-576.051] (-578.085) -- 0:00:31
519500 -- [-578.661] (-576.450) (-577.110) (-577.084) * (-575.796) [-576.601] (-576.147) (-577.814) -- 0:00:31
520000 -- [-577.114] (-577.659) (-575.468) (-576.066) * (-575.915) (-581.389) (-576.380) [-577.741] -- 0:00:31
Average standard deviation of split frequencies: 0.011589
520500 -- (-579.736) (-578.209) (-577.489) [-580.450] * (-574.107) [-575.691] (-576.114) (-580.628) -- 0:00:31
521000 -- [-575.294] (-574.824) (-576.504) (-577.680) * (-574.303) (-577.593) [-575.150] (-577.470) -- 0:00:31
521500 -- (-575.537) [-577.019] (-576.983) (-578.495) * [-577.508] (-577.965) (-577.853) (-577.138) -- 0:00:31
522000 -- (-574.058) (-576.902) [-579.604] (-580.020) * (-577.802) (-577.263) [-574.457] (-580.965) -- 0:00:31
522500 -- (-577.163) (-582.482) [-575.144] (-578.012) * (-579.406) (-576.907) (-575.547) [-574.178] -- 0:00:31
523000 -- (-575.648) [-577.409] (-576.863) (-578.101) * (-578.286) [-576.409] (-576.849) (-579.677) -- 0:00:31
523500 -- (-577.548) (-577.636) [-577.790] (-576.655) * (-578.294) [-576.602] (-579.501) (-575.345) -- 0:00:30
524000 -- [-576.999] (-578.186) (-575.167) (-578.761) * [-575.821] (-577.034) (-575.268) (-576.639) -- 0:00:30
524500 -- [-575.677] (-576.758) (-577.427) (-576.598) * (-580.108) [-575.681] (-573.742) (-578.044) -- 0:00:30
525000 -- [-578.199] (-575.813) (-575.479) (-578.277) * [-575.599] (-576.542) (-575.647) (-577.749) -- 0:00:30
Average standard deviation of split frequencies: 0.011292
525500 -- (-575.513) (-577.011) (-584.320) [-576.548] * [-575.010] (-578.894) (-575.179) (-577.046) -- 0:00:30
526000 -- (-577.807) (-578.624) (-576.830) [-576.951] * [-575.370] (-578.895) (-578.772) (-576.316) -- 0:00:30
526500 -- (-576.561) (-577.846) [-579.033] (-577.353) * (-577.390) [-578.716] (-578.658) (-578.346) -- 0:00:30
527000 -- (-577.770) (-580.048) [-576.988] (-580.407) * [-575.455] (-574.375) (-578.670) (-575.456) -- 0:00:30
527500 -- (-577.453) (-578.294) [-574.996] (-578.802) * [-574.051] (-573.911) (-577.430) (-580.472) -- 0:00:31
528000 -- (-576.845) [-576.959] (-575.196) (-579.259) * (-579.032) (-576.598) (-577.749) [-577.064] -- 0:00:31
528500 -- [-576.366] (-577.150) (-576.826) (-581.414) * [-577.035] (-575.486) (-582.247) (-575.733) -- 0:00:31
529000 -- [-579.633] (-576.916) (-575.681) (-582.805) * (-577.757) (-577.092) [-575.235] (-578.956) -- 0:00:31
529500 -- [-578.837] (-576.728) (-576.853) (-579.078) * [-579.779] (-578.565) (-574.770) (-580.835) -- 0:00:31
530000 -- (-575.497) [-574.615] (-577.485) (-581.009) * [-576.533] (-579.178) (-580.109) (-580.721) -- 0:00:31
Average standard deviation of split frequencies: 0.010838
530500 -- (-576.737) [-576.291] (-573.842) (-582.410) * (-580.035) (-578.831) (-577.694) [-577.835] -- 0:00:30
531000 -- [-577.538] (-576.391) (-575.031) (-582.170) * (-576.577) [-577.208] (-578.241) (-575.316) -- 0:00:30
531500 -- (-576.962) (-576.996) [-579.048] (-580.041) * (-577.756) [-574.860] (-577.683) (-576.374) -- 0:00:30
532000 -- (-578.858) [-574.640] (-577.297) (-577.641) * (-576.004) (-575.761) (-578.903) [-577.109] -- 0:00:30
532500 -- (-576.474) [-576.196] (-580.987) (-577.674) * (-575.275) (-575.176) [-574.000] (-576.182) -- 0:00:30
533000 -- (-574.576) (-576.662) [-575.018] (-581.900) * (-577.218) (-575.775) [-575.139] (-580.527) -- 0:00:30
533500 -- (-576.605) (-577.574) [-577.255] (-576.111) * [-576.553] (-575.648) (-581.265) (-576.244) -- 0:00:30
534000 -- (-574.630) (-577.015) [-579.174] (-579.502) * (-576.266) (-575.629) [-578.376] (-577.275) -- 0:00:30
534500 -- (-576.857) (-579.683) (-574.514) [-574.988] * [-578.087] (-577.986) (-581.623) (-576.796) -- 0:00:30
535000 -- (-576.676) (-577.048) [-576.907] (-574.150) * (-576.832) (-576.409) [-576.525] (-574.682) -- 0:00:30
Average standard deviation of split frequencies: 0.010261
535500 -- (-577.264) (-578.984) (-576.100) [-575.479] * (-575.557) (-581.710) (-577.617) [-576.766] -- 0:00:30
536000 -- (-579.850) (-579.021) [-573.140] (-576.033) * (-574.868) (-580.799) (-581.549) [-578.213] -- 0:00:30
536500 -- (-577.859) (-576.282) [-575.688] (-574.311) * [-574.949] (-583.739) (-579.210) (-577.075) -- 0:00:30
537000 -- (-578.846) [-577.593] (-580.043) (-576.756) * (-577.518) [-577.155] (-580.455) (-576.239) -- 0:00:30
537500 -- (-578.586) [-580.776] (-575.892) (-578.092) * (-577.181) [-578.374] (-575.836) (-577.733) -- 0:00:30
538000 -- [-574.203] (-576.671) (-577.053) (-577.705) * (-577.030) (-578.985) (-576.545) [-574.750] -- 0:00:30
538500 -- (-575.955) [-574.995] (-577.587) (-575.070) * [-575.546] (-578.585) (-578.398) (-576.381) -- 0:00:29
539000 -- (-574.507) (-577.597) (-576.961) [-578.179] * (-574.531) [-575.679] (-577.227) (-577.532) -- 0:00:29
539500 -- (-575.630) (-578.582) [-575.443] (-578.729) * (-576.815) (-580.778) [-576.948] (-575.668) -- 0:00:29
540000 -- (-577.376) [-574.838] (-575.025) (-580.772) * (-576.411) [-577.220] (-575.594) (-575.837) -- 0:00:29
Average standard deviation of split frequencies: 0.009765
540500 -- (-575.991) (-575.464) (-578.342) [-576.134] * (-577.008) [-579.177] (-577.340) (-577.019) -- 0:00:29
541000 -- (-575.877) [-575.033] (-576.539) (-578.900) * (-576.736) [-574.539] (-576.489) (-576.251) -- 0:00:29
541500 -- [-575.649] (-577.200) (-585.625) (-575.813) * [-574.317] (-577.991) (-574.615) (-577.893) -- 0:00:29
542000 -- (-576.223) (-577.284) (-574.394) [-575.104] * (-576.005) [-575.519] (-582.425) (-578.507) -- 0:00:29
542500 -- (-575.208) (-577.956) (-575.041) [-574.497] * (-578.560) [-577.475] (-577.943) (-574.794) -- 0:00:29
543000 -- (-576.760) (-575.535) [-577.756] (-576.567) * (-574.499) (-575.624) (-577.760) [-576.114] -- 0:00:30
543500 -- (-581.058) (-576.926) [-577.125] (-574.656) * (-580.545) (-577.132) [-576.719] (-581.311) -- 0:00:30
544000 -- [-577.706] (-577.717) (-574.722) (-574.969) * (-576.625) (-576.402) (-576.851) [-578.557] -- 0:00:30
544500 -- (-575.726) (-576.508) [-576.848] (-576.802) * (-575.406) (-577.561) (-577.695) [-574.987] -- 0:00:30
545000 -- (-577.567) (-575.670) (-575.069) [-579.829] * [-574.461] (-575.080) (-575.664) (-578.316) -- 0:00:30
Average standard deviation of split frequencies: 0.009670
545500 -- (-576.968) [-575.383] (-577.806) (-579.708) * [-575.784] (-574.261) (-577.179) (-574.654) -- 0:00:29
546000 -- (-574.584) (-574.175) [-575.701] (-574.501) * [-578.540] (-578.138) (-578.387) (-576.896) -- 0:00:29
546500 -- (-578.281) (-575.583) [-574.987] (-577.160) * (-583.058) [-576.733] (-576.527) (-576.404) -- 0:00:29
547000 -- (-579.762) (-576.832) (-576.568) [-578.048] * (-577.908) (-575.415) [-576.641] (-575.340) -- 0:00:29
547500 -- (-577.744) (-577.492) [-576.360] (-577.911) * (-575.514) (-575.617) [-576.295] (-576.567) -- 0:00:29
548000 -- (-579.579) [-575.389] (-579.234) (-576.411) * [-574.744] (-574.956) (-576.725) (-576.659) -- 0:00:29
548500 -- [-575.215] (-575.988) (-577.967) (-578.637) * (-577.101) [-577.125] (-576.392) (-578.255) -- 0:00:29
549000 -- (-575.851) (-575.171) (-576.745) [-576.774] * [-579.451] (-574.611) (-577.489) (-575.401) -- 0:00:29
549500 -- (-577.874) (-582.529) (-576.363) [-577.781] * (-580.716) (-576.784) (-577.369) [-575.802] -- 0:00:29
550000 -- [-580.223] (-575.139) (-576.526) (-578.482) * (-577.776) (-577.790) (-577.444) [-576.407] -- 0:00:29
Average standard deviation of split frequencies: 0.009588
550500 -- (-578.143) (-581.259) (-580.434) [-577.042] * [-575.437] (-574.400) (-576.716) (-575.528) -- 0:00:29
551000 -- (-577.338) (-574.854) (-579.590) [-576.937] * (-579.471) [-577.313] (-581.262) (-576.580) -- 0:00:29
551500 -- [-577.485] (-578.904) (-577.321) (-577.765) * (-573.657) [-574.921] (-578.416) (-575.561) -- 0:00:29
552000 -- (-576.433) (-575.007) [-580.230] (-578.461) * (-573.994) (-577.568) (-583.955) [-577.055] -- 0:00:29
552500 -- (-576.676) [-576.602] (-575.140) (-581.505) * (-578.083) [-577.126] (-579.905) (-583.211) -- 0:00:29
553000 -- (-578.921) [-579.298] (-583.417) (-576.031) * [-576.486] (-575.438) (-578.224) (-577.997) -- 0:00:29
553500 -- (-577.449) (-577.373) (-575.184) [-578.554] * (-576.423) [-575.075] (-576.884) (-578.556) -- 0:00:29
554000 -- [-575.218] (-578.951) (-574.526) (-577.248) * (-578.158) [-573.674] (-579.911) (-578.929) -- 0:00:28
554500 -- (-574.528) [-574.782] (-576.629) (-576.848) * (-577.937) [-574.873] (-584.750) (-576.598) -- 0:00:28
555000 -- (-575.280) (-580.427) (-575.191) [-577.409] * (-575.573) (-575.813) [-577.706] (-575.831) -- 0:00:28
Average standard deviation of split frequencies: 0.009270
555500 -- [-578.910] (-578.740) (-579.239) (-575.031) * (-576.567) (-578.190) [-578.706] (-576.172) -- 0:00:28
556000 -- (-579.471) [-576.059] (-574.570) (-577.847) * [-576.483] (-579.489) (-579.913) (-580.721) -- 0:00:28
556500 -- (-577.667) (-575.805) (-579.660) [-576.782] * (-578.213) (-580.034) [-578.447] (-577.833) -- 0:00:28
557000 -- (-577.320) [-575.541] (-576.894) (-577.345) * [-576.087] (-573.705) (-580.284) (-576.917) -- 0:00:28
557500 -- (-576.275) (-576.071) [-577.391] (-577.036) * [-577.762] (-574.646) (-583.506) (-578.048) -- 0:00:28
558000 -- [-576.318] (-585.842) (-574.785) (-576.275) * [-578.451] (-574.577) (-580.005) (-579.704) -- 0:00:28
558500 -- (-577.432) [-579.664] (-578.400) (-578.215) * [-579.322] (-576.026) (-577.793) (-579.732) -- 0:00:28
559000 -- (-576.725) (-582.549) (-576.177) [-580.377] * (-576.280) (-579.071) (-577.309) [-576.980] -- 0:00:28
559500 -- (-576.425) (-576.604) [-575.814] (-578.351) * (-576.322) [-577.476] (-577.514) (-576.389) -- 0:00:29
560000 -- (-577.183) (-576.381) [-577.294] (-578.536) * [-574.027] (-574.803) (-576.870) (-576.044) -- 0:00:29
Average standard deviation of split frequencies: 0.009753
560500 -- (-576.856) (-580.220) [-577.027] (-576.893) * (-576.510) [-575.197] (-576.889) (-578.223) -- 0:00:29
561000 -- [-577.759] (-576.159) (-575.061) (-577.904) * (-574.313) (-575.136) [-575.496] (-575.717) -- 0:00:28
561500 -- [-575.874] (-578.414) (-575.037) (-576.577) * (-574.931) (-575.176) (-577.978) [-577.410] -- 0:00:28
562000 -- (-576.208) (-575.463) (-576.125) [-578.134] * (-577.204) [-578.157] (-582.565) (-578.263) -- 0:00:28
562500 -- (-579.577) (-576.674) (-576.783) [-577.237] * (-575.409) (-579.871) (-580.114) [-577.701] -- 0:00:28
563000 -- (-576.403) (-576.764) (-578.486) [-576.781] * [-578.885] (-579.290) (-575.976) (-582.197) -- 0:00:28
563500 -- (-575.998) (-580.178) [-576.002] (-576.697) * (-575.558) [-576.846] (-576.826) (-581.621) -- 0:00:28
564000 -- (-575.818) (-575.211) (-573.738) [-577.498] * (-586.736) [-575.795] (-577.223) (-578.669) -- 0:00:28
564500 -- (-577.747) [-576.608] (-575.228) (-577.186) * (-581.346) (-575.580) (-577.042) [-576.474] -- 0:00:28
565000 -- (-574.868) [-574.228] (-575.124) (-577.066) * [-575.761] (-576.963) (-579.351) (-578.181) -- 0:00:28
Average standard deviation of split frequencies: 0.009273
565500 -- [-577.665] (-578.522) (-578.077) (-579.384) * (-578.180) [-574.821] (-578.747) (-576.798) -- 0:00:28
566000 -- (-579.373) (-580.358) (-577.783) [-579.173] * [-579.766] (-573.969) (-576.294) (-579.833) -- 0:00:28
566500 -- [-574.842] (-575.763) (-574.343) (-575.558) * (-576.019) [-575.232] (-577.667) (-582.341) -- 0:00:28
567000 -- (-576.411) (-576.715) [-576.374] (-580.530) * [-575.986] (-579.273) (-575.999) (-576.328) -- 0:00:28
567500 -- [-576.657] (-576.202) (-575.249) (-578.245) * (-574.478) [-576.882] (-577.236) (-575.818) -- 0:00:28
568000 -- (-575.898) [-576.631] (-577.104) (-579.631) * (-577.378) [-576.245] (-580.019) (-577.647) -- 0:00:28
568500 -- (-580.514) [-576.542] (-576.938) (-578.156) * (-576.149) [-578.103] (-576.208) (-577.129) -- 0:00:28
569000 -- (-576.566) (-576.028) [-576.105] (-580.350) * (-577.690) (-577.870) (-575.722) [-576.862] -- 0:00:28
569500 -- (-579.424) [-576.640] (-579.847) (-577.481) * (-574.570) [-577.762] (-575.948) (-577.099) -- 0:00:27
570000 -- [-575.838] (-575.956) (-582.071) (-575.796) * (-575.595) [-575.611] (-576.223) (-580.331) -- 0:00:27
Average standard deviation of split frequencies: 0.008811
570500 -- (-576.664) (-575.277) (-577.231) [-573.913] * (-578.104) [-575.797] (-576.644) (-575.507) -- 0:00:27
571000 -- (-574.341) (-576.520) [-575.810] (-577.526) * (-576.481) (-577.414) [-575.081] (-576.608) -- 0:00:27
571500 -- (-577.474) [-576.030] (-574.165) (-578.934) * (-575.242) [-575.570] (-578.662) (-579.594) -- 0:00:27
572000 -- (-578.116) [-576.040] (-577.184) (-579.224) * (-578.568) (-578.624) (-575.765) [-575.038] -- 0:00:27
572500 -- (-579.823) (-576.685) [-577.719] (-580.652) * (-574.400) (-574.860) [-574.680] (-576.936) -- 0:00:27
573000 -- (-576.962) (-577.066) [-575.436] (-578.203) * (-573.408) (-575.309) (-578.016) [-578.894] -- 0:00:27
573500 -- (-583.301) (-575.665) (-577.312) [-575.126] * [-575.069] (-577.928) (-576.473) (-576.236) -- 0:00:27
574000 -- (-576.042) (-578.247) (-577.447) [-575.914] * (-576.508) (-579.946) [-575.176] (-575.821) -- 0:00:27
574500 -- (-575.961) (-576.700) [-578.773] (-577.893) * (-575.682) (-582.975) (-574.884) [-575.860] -- 0:00:27
575000 -- (-578.065) (-577.562) [-581.007] (-576.392) * (-576.399) (-583.966) [-575.878] (-575.617) -- 0:00:28
Average standard deviation of split frequencies: 0.008798
575500 -- (-582.536) (-576.522) (-577.054) [-579.246] * (-574.917) (-581.286) [-576.192] (-578.288) -- 0:00:28
576000 -- (-581.806) (-575.574) [-575.633] (-576.527) * (-576.169) [-576.984] (-576.621) (-577.577) -- 0:00:27
576500 -- [-576.757] (-577.079) (-579.638) (-576.339) * (-577.748) (-575.209) [-575.671] (-576.184) -- 0:00:27
577000 -- (-576.789) [-578.080] (-576.124) (-580.813) * [-576.208] (-580.527) (-578.251) (-575.828) -- 0:00:27
577500 -- (-576.628) [-575.834] (-578.337) (-576.655) * [-576.031] (-579.813) (-574.882) (-576.910) -- 0:00:27
578000 -- (-577.471) (-578.494) [-575.482] (-574.114) * [-577.291] (-577.031) (-578.600) (-576.833) -- 0:00:27
578500 -- (-579.180) (-576.784) (-575.017) [-578.532] * (-579.008) [-577.902] (-577.485) (-576.569) -- 0:00:27
579000 -- (-577.692) (-582.451) [-575.626] (-578.244) * (-573.455) [-575.828] (-579.407) (-576.593) -- 0:00:27
579500 -- [-577.577] (-578.329) (-581.715) (-575.687) * (-575.692) (-575.053) [-575.807] (-575.617) -- 0:00:27
580000 -- (-576.440) (-583.362) (-576.576) [-576.650] * [-577.979] (-576.222) (-576.981) (-576.790) -- 0:00:27
Average standard deviation of split frequencies: 0.008727
580500 -- (-576.256) [-581.374] (-577.006) (-578.598) * [-575.906] (-576.768) (-574.367) (-577.566) -- 0:00:27
581000 -- [-577.038] (-577.286) (-575.777) (-578.466) * (-577.305) [-574.845] (-574.947) (-577.022) -- 0:00:27
581500 -- (-578.540) (-575.816) [-578.660] (-577.346) * [-573.887] (-577.220) (-575.768) (-579.507) -- 0:00:27
582000 -- (-579.208) (-577.513) (-576.990) [-574.071] * [-577.791] (-574.814) (-576.255) (-577.467) -- 0:00:27
582500 -- (-578.027) (-579.838) (-575.952) [-576.823] * (-576.510) [-575.325] (-574.540) (-579.953) -- 0:00:27
583000 -- (-577.059) [-577.314] (-574.550) (-576.652) * [-574.448] (-574.087) (-575.768) (-580.599) -- 0:00:27
583500 -- (-577.131) (-581.221) (-575.788) [-574.701] * (-576.584) (-574.318) (-576.937) [-575.970] -- 0:00:27
584000 -- (-581.831) (-580.764) (-577.972) [-576.185] * (-575.667) (-574.748) (-576.221) [-575.959] -- 0:00:27
584500 -- (-581.743) (-580.669) [-575.915] (-576.904) * [-575.395] (-574.979) (-575.414) (-577.552) -- 0:00:27
585000 -- (-579.692) [-578.792] (-577.044) (-576.470) * (-584.102) [-576.128] (-574.725) (-577.652) -- 0:00:26
Average standard deviation of split frequencies: 0.008447
585500 -- (-578.206) [-577.339] (-579.317) (-574.041) * (-576.461) (-574.084) (-576.256) [-577.322] -- 0:00:26
586000 -- (-578.958) (-576.785) (-575.734) [-577.531] * (-575.436) [-575.198] (-577.264) (-575.314) -- 0:00:26
586500 -- (-579.306) (-575.530) [-578.058] (-577.418) * (-578.054) (-576.861) [-576.389] (-575.373) -- 0:00:26
587000 -- (-578.842) (-577.825) (-581.024) [-577.019] * (-576.925) (-576.459) (-576.395) [-575.693] -- 0:00:26
587500 -- (-577.529) (-578.327) (-580.734) [-577.874] * (-574.682) (-577.597) (-574.284) [-576.183] -- 0:00:26
588000 -- (-577.258) [-578.319] (-578.112) (-581.886) * (-582.497) (-576.054) [-573.296] (-577.361) -- 0:00:26
588500 -- (-576.141) (-576.661) [-574.950] (-578.811) * [-582.575] (-575.619) (-577.128) (-575.305) -- 0:00:26
589000 -- (-576.219) [-577.796] (-575.749) (-578.691) * [-576.092] (-575.995) (-576.864) (-575.233) -- 0:00:26
589500 -- [-576.504] (-580.674) (-576.532) (-575.308) * (-574.621) [-576.445] (-575.956) (-577.817) -- 0:00:26
590000 -- (-578.194) (-576.338) [-576.858] (-575.543) * (-577.254) [-576.590] (-575.961) (-576.828) -- 0:00:26
Average standard deviation of split frequencies: 0.008885
590500 -- [-575.431] (-578.980) (-577.616) (-576.721) * (-576.524) [-574.697] (-577.556) (-577.506) -- 0:00:27
591000 -- [-578.392] (-581.156) (-576.204) (-579.901) * (-575.807) [-577.295] (-574.202) (-578.564) -- 0:00:26
591500 -- (-580.024) [-577.315] (-580.343) (-577.793) * (-576.257) (-578.618) (-576.079) [-576.471] -- 0:00:26
592000 -- (-580.823) (-584.953) [-578.718] (-575.031) * [-576.993] (-575.371) (-575.158) (-574.760) -- 0:00:26
592500 -- [-580.912] (-581.663) (-583.806) (-577.833) * (-576.627) [-577.167] (-575.573) (-575.173) -- 0:00:26
593000 -- (-576.963) (-576.372) (-579.564) [-575.456] * (-576.166) [-575.944] (-576.108) (-577.180) -- 0:00:26
593500 -- (-575.501) (-576.681) (-574.700) [-576.187] * (-577.003) (-575.695) [-576.385] (-582.284) -- 0:00:26
594000 -- (-574.861) [-575.552] (-577.605) (-576.164) * (-575.530) [-577.263] (-576.987) (-576.322) -- 0:00:26
594500 -- (-581.403) (-578.091) (-576.627) [-577.041] * (-578.089) (-576.357) (-575.364) [-576.178] -- 0:00:26
595000 -- [-578.064] (-577.206) (-577.083) (-583.292) * (-577.419) (-576.028) [-575.578] (-575.121) -- 0:00:26
Average standard deviation of split frequencies: 0.008595
595500 -- [-575.750] (-575.838) (-577.325) (-577.807) * (-576.475) (-576.060) [-573.873] (-575.883) -- 0:00:26
596000 -- (-576.419) [-576.123] (-576.176) (-577.892) * [-576.557] (-577.417) (-578.758) (-574.947) -- 0:00:26
596500 -- (-577.482) (-576.029) (-576.235) [-576.430] * (-577.486) (-574.803) [-576.835] (-574.210) -- 0:00:26
597000 -- [-575.321] (-577.223) (-576.955) (-576.686) * (-575.843) (-578.300) [-574.691] (-576.853) -- 0:00:26
597500 -- (-579.139) (-575.934) (-577.483) [-578.333] * (-574.777) [-576.342] (-574.875) (-575.434) -- 0:00:26
598000 -- (-575.112) (-581.189) (-578.461) [-578.743] * (-578.426) (-576.903) [-575.810] (-576.951) -- 0:00:26
598500 -- (-576.279) (-578.050) (-578.469) [-578.644] * (-576.477) (-580.835) (-576.478) [-576.256] -- 0:00:26
599000 -- (-577.820) (-576.759) [-576.108] (-574.804) * (-575.282) [-575.993] (-575.014) (-578.249) -- 0:00:26
599500 -- (-575.055) (-577.352) [-575.797] (-579.190) * (-575.434) (-575.315) [-574.063] (-586.188) -- 0:00:26
600000 -- (-575.339) (-575.683) (-575.550) [-577.370] * (-576.238) (-578.779) [-575.241] (-579.422) -- 0:00:25
Average standard deviation of split frequencies: 0.008371
600500 -- (-574.830) (-575.411) (-575.942) [-575.989] * (-575.449) (-577.825) [-575.169] (-577.412) -- 0:00:25
601000 -- (-576.403) (-576.507) (-578.608) [-574.998] * (-576.786) (-577.217) [-573.749] (-576.399) -- 0:00:25
601500 -- [-576.403] (-576.132) (-577.955) (-576.860) * (-577.105) [-576.648] (-577.825) (-577.178) -- 0:00:25
602000 -- (-575.907) [-577.948] (-578.553) (-574.426) * (-576.561) (-575.154) (-576.403) [-576.779] -- 0:00:25
602500 -- (-575.101) [-581.772] (-576.479) (-578.966) * (-578.459) [-575.784] (-577.181) (-575.627) -- 0:00:25
603000 -- (-578.807) (-579.174) [-576.385] (-575.228) * (-576.554) (-574.634) (-578.206) [-575.009] -- 0:00:25
603500 -- (-576.413) [-578.073] (-579.119) (-577.880) * (-575.117) [-579.147] (-579.605) (-575.198) -- 0:00:26
604000 -- (-576.903) (-577.212) [-575.204] (-574.933) * [-576.383] (-577.481) (-578.686) (-580.414) -- 0:00:26
604500 -- (-578.581) (-576.755) [-576.806] (-575.669) * (-577.673) (-582.790) (-577.854) [-575.869] -- 0:00:26
605000 -- (-577.980) (-574.306) (-576.436) [-575.648] * (-577.424) (-576.552) [-574.645] (-576.789) -- 0:00:26
Average standard deviation of split frequencies: 0.008661
605500 -- (-578.896) (-578.136) [-575.399] (-575.239) * (-575.127) [-578.693] (-577.686) (-575.716) -- 0:00:26
606000 -- (-577.244) (-576.407) [-578.771] (-576.280) * [-577.953] (-576.806) (-577.459) (-580.980) -- 0:00:26
606500 -- (-575.361) (-577.751) (-576.875) [-574.793] * (-574.394) [-575.210] (-576.144) (-580.607) -- 0:00:25
607000 -- (-575.793) [-575.966] (-579.873) (-582.653) * (-577.317) (-574.907) [-575.828] (-577.234) -- 0:00:25
607500 -- (-579.049) [-578.026] (-576.410) (-584.430) * (-581.117) (-576.441) [-575.738] (-575.807) -- 0:00:25
608000 -- (-578.804) (-577.200) (-575.348) [-577.685] * (-582.473) [-577.964] (-576.340) (-578.281) -- 0:00:25
608500 -- (-577.798) (-576.179) [-576.447] (-577.349) * [-574.430] (-578.114) (-573.873) (-574.992) -- 0:00:25
609000 -- [-576.439] (-576.420) (-575.914) (-575.250) * (-576.085) [-574.932] (-579.033) (-580.459) -- 0:00:25
609500 -- (-579.933) [-578.180] (-576.066) (-577.982) * (-574.848) [-577.372] (-574.776) (-578.630) -- 0:00:25
610000 -- (-578.208) [-579.946] (-577.999) (-575.678) * (-576.546) [-576.392] (-575.691) (-581.108) -- 0:00:25
Average standard deviation of split frequencies: 0.008389
610500 -- (-578.327) [-576.566] (-577.833) (-579.691) * [-573.251] (-576.245) (-576.273) (-577.551) -- 0:00:25
611000 -- (-576.504) (-576.546) [-574.527] (-576.518) * [-573.882] (-577.795) (-580.758) (-578.508) -- 0:00:25
611500 -- (-578.837) (-574.422) (-574.544) [-576.037] * (-575.130) (-577.093) [-576.405] (-579.526) -- 0:00:25
612000 -- (-583.002) (-577.634) [-576.370] (-574.891) * [-574.533] (-575.095) (-577.873) (-576.262) -- 0:00:25
612500 -- [-577.440] (-577.912) (-574.991) (-575.301) * [-573.655] (-575.409) (-581.061) (-576.957) -- 0:00:25
613000 -- (-576.713) (-581.129) [-577.270] (-577.882) * (-577.204) [-578.172] (-579.675) (-576.748) -- 0:00:25
613500 -- [-575.949] (-580.212) (-577.031) (-578.639) * (-574.901) (-574.628) (-579.412) [-576.447] -- 0:00:25
614000 -- (-579.984) (-576.833) [-576.109] (-577.594) * (-576.520) [-576.676] (-579.271) (-577.291) -- 0:00:25
614500 -- (-575.505) (-576.748) (-574.715) [-574.690] * (-578.172) (-581.469) (-576.357) [-580.497] -- 0:00:25
615000 -- (-579.201) (-576.545) (-578.719) [-577.545] * [-573.980] (-579.289) (-575.481) (-576.163) -- 0:00:25
Average standard deviation of split frequencies: 0.008163
615500 -- (-582.739) (-576.705) (-578.276) [-580.698] * (-576.176) (-577.376) (-578.029) [-577.340] -- 0:00:24
616000 -- (-579.983) [-574.485] (-575.312) (-575.604) * (-577.784) (-582.922) (-576.268) [-578.937] -- 0:00:24
616500 -- (-576.300) [-576.104] (-576.331) (-576.921) * [-575.275] (-580.545) (-575.272) (-577.615) -- 0:00:24
617000 -- (-575.619) [-575.419] (-575.434) (-578.077) * [-575.487] (-582.082) (-576.880) (-576.783) -- 0:00:24
617500 -- (-576.743) [-577.612] (-577.777) (-573.964) * (-575.411) (-576.840) (-575.878) [-577.943] -- 0:00:24
618000 -- (-577.396) (-574.638) [-580.511] (-576.540) * [-575.733] (-576.874) (-578.278) (-575.703) -- 0:00:24
618500 -- (-576.422) (-575.067) [-574.016] (-574.865) * [-576.292] (-576.001) (-578.717) (-574.285) -- 0:00:25
619000 -- [-578.610] (-574.259) (-577.741) (-575.126) * [-575.632] (-576.321) (-577.926) (-576.550) -- 0:00:25
619500 -- (-578.683) (-576.548) [-577.609] (-578.339) * [-575.811] (-575.951) (-579.816) (-575.322) -- 0:00:25
620000 -- [-576.367] (-577.539) (-577.270) (-576.701) * [-575.565] (-574.937) (-576.556) (-575.830) -- 0:00:25
Average standard deviation of split frequencies: 0.008760
620500 -- [-575.375] (-577.593) (-575.426) (-578.214) * (-577.869) (-575.576) (-577.288) [-576.533] -- 0:00:25
621000 -- (-575.939) [-575.064] (-576.366) (-579.578) * (-577.743) [-575.096] (-576.570) (-577.148) -- 0:00:25
621500 -- [-575.625] (-577.045) (-575.358) (-576.153) * [-579.089] (-579.300) (-573.699) (-578.293) -- 0:00:24
622000 -- [-577.123] (-578.695) (-576.119) (-576.308) * (-574.556) (-575.924) [-573.897] (-576.935) -- 0:00:24
622500 -- (-574.990) (-577.648) [-578.020] (-578.752) * (-574.122) (-576.526) [-575.947] (-576.720) -- 0:00:24
623000 -- (-576.457) (-578.593) [-578.044] (-577.709) * [-575.593] (-574.896) (-579.703) (-579.119) -- 0:00:24
623500 -- [-579.474] (-579.500) (-579.986) (-576.529) * (-573.136) [-578.688] (-579.445) (-579.205) -- 0:00:24
624000 -- [-576.531] (-577.353) (-577.977) (-577.047) * (-575.257) [-577.276] (-577.546) (-575.542) -- 0:00:24
624500 -- (-575.940) (-576.295) (-576.964) [-576.376] * (-576.666) (-575.996) [-576.818] (-575.975) -- 0:00:24
625000 -- [-576.136] (-575.366) (-577.968) (-578.331) * (-574.527) (-576.117) [-576.619] (-575.915) -- 0:00:24
Average standard deviation of split frequencies: 0.008434
625500 -- (-575.630) (-576.160) (-576.227) [-578.975] * (-573.940) [-576.184] (-575.933) (-575.875) -- 0:00:24
626000 -- [-579.951] (-575.769) (-574.366) (-574.889) * (-576.171) [-576.070] (-575.781) (-574.198) -- 0:00:24
626500 -- (-576.981) (-575.195) [-577.050] (-580.328) * (-575.976) (-578.458) (-576.415) [-575.656] -- 0:00:24
627000 -- (-577.917) (-576.772) [-575.546] (-576.545) * (-578.462) [-578.248] (-578.265) (-578.885) -- 0:00:24
627500 -- (-575.973) (-580.098) [-577.075] (-578.319) * (-579.768) (-577.930) [-576.612] (-574.799) -- 0:00:24
628000 -- (-584.337) [-575.325] (-577.200) (-577.412) * (-579.059) (-577.231) (-577.282) [-575.575] -- 0:00:24
628500 -- [-575.848] (-576.703) (-576.305) (-589.619) * [-577.358] (-578.670) (-577.503) (-574.630) -- 0:00:24
629000 -- (-577.303) (-575.149) [-579.161] (-582.492) * (-577.084) [-576.034] (-577.762) (-575.479) -- 0:00:24
629500 -- (-577.538) (-576.384) (-581.576) [-577.442] * (-577.475) (-579.306) [-574.972] (-576.476) -- 0:00:24
630000 -- [-577.147] (-576.549) (-575.630) (-575.758) * (-578.749) [-577.723] (-576.511) (-582.506) -- 0:00:24
Average standard deviation of split frequencies: 0.008471
630500 -- [-574.470] (-576.364) (-577.258) (-577.154) * [-574.712] (-574.398) (-573.781) (-578.150) -- 0:00:24
631000 -- (-576.344) (-577.058) [-575.113] (-577.515) * (-574.379) [-575.837] (-576.115) (-577.923) -- 0:00:23
631500 -- (-579.541) [-578.886] (-575.441) (-575.917) * [-576.155] (-575.106) (-574.598) (-574.224) -- 0:00:23
632000 -- (-578.515) (-575.406) [-576.212] (-576.040) * (-577.525) (-577.808) [-577.065] (-575.673) -- 0:00:23
632500 -- (-576.510) (-574.228) (-580.039) [-577.313] * [-575.789] (-576.128) (-583.759) (-573.759) -- 0:00:23
633000 -- (-575.111) [-574.921] (-574.974) (-576.625) * (-578.145) [-575.566] (-581.884) (-579.583) -- 0:00:23
633500 -- (-581.463) (-577.200) (-576.360) [-576.328] * (-577.698) [-575.447] (-576.906) (-576.958) -- 0:00:23
634000 -- (-578.676) (-575.475) (-579.882) [-575.755] * (-576.770) (-575.063) (-577.033) [-575.502] -- 0:00:23
634500 -- [-577.887] (-575.968) (-576.887) (-577.096) * [-575.957] (-574.292) (-577.597) (-577.140) -- 0:00:24
635000 -- (-575.816) (-574.933) [-578.257] (-576.874) * (-579.083) [-576.831] (-577.399) (-576.031) -- 0:00:24
Average standard deviation of split frequencies: 0.008450
635500 -- [-576.298] (-575.686) (-577.451) (-578.109) * (-576.051) (-576.337) [-576.290] (-577.249) -- 0:00:24
636000 -- [-577.412] (-582.200) (-575.945) (-580.313) * (-577.587) (-576.712) (-576.913) [-577.291] -- 0:00:24
636500 -- (-574.310) (-578.187) (-577.079) [-577.530] * (-576.201) [-575.206] (-574.412) (-580.875) -- 0:00:23
637000 -- (-579.509) (-573.583) (-574.683) [-576.717] * (-579.738) (-574.905) [-575.661] (-574.725) -- 0:00:23
637500 -- (-579.212) [-576.291] (-576.165) (-577.617) * (-579.781) (-576.032) [-574.550] (-575.613) -- 0:00:23
638000 -- (-577.806) [-573.170] (-580.436) (-580.022) * (-576.646) [-574.916] (-576.851) (-574.309) -- 0:00:23
638500 -- (-576.493) [-576.125] (-580.284) (-577.187) * (-577.122) (-575.668) [-573.874] (-575.413) -- 0:00:23
639000 -- (-575.359) (-582.599) [-580.476] (-579.463) * [-574.177] (-577.270) (-575.922) (-573.466) -- 0:00:23
639500 -- (-576.072) (-583.287) [-578.896] (-576.773) * (-574.538) (-575.915) [-578.806] (-579.677) -- 0:00:23
640000 -- (-573.813) (-580.771) [-582.100] (-575.700) * (-577.350) (-577.401) (-578.859) [-575.645] -- 0:00:23
Average standard deviation of split frequencies: 0.008339
640500 -- [-577.790] (-582.029) (-577.833) (-578.408) * (-576.818) (-575.971) [-574.644] (-574.753) -- 0:00:23
641000 -- (-576.767) (-580.597) (-582.779) [-575.423] * [-577.488] (-577.255) (-576.810) (-575.843) -- 0:00:23
641500 -- (-574.022) (-577.677) [-580.690] (-577.379) * (-581.590) (-579.308) (-574.843) [-578.275] -- 0:00:23
642000 -- [-577.870] (-576.953) (-584.965) (-580.309) * [-577.536] (-575.638) (-576.045) (-583.395) -- 0:00:23
642500 -- (-576.162) (-576.769) (-582.181) [-577.008] * (-577.034) (-576.155) (-579.862) [-577.244] -- 0:00:23
643000 -- [-575.620] (-575.704) (-578.497) (-576.152) * (-576.059) (-577.281) (-580.029) [-576.426] -- 0:00:23
643500 -- (-579.721) [-577.259] (-578.535) (-579.524) * (-577.898) [-575.318] (-576.006) (-577.917) -- 0:00:23
644000 -- (-579.828) (-577.383) [-578.401] (-575.875) * [-576.957] (-579.818) (-576.546) (-577.097) -- 0:00:23
644500 -- (-578.235) (-576.350) (-575.362) [-575.314] * (-574.072) (-575.313) [-576.574] (-576.028) -- 0:00:23
645000 -- [-584.848] (-577.960) (-575.436) (-574.794) * [-572.935] (-576.819) (-575.628) (-575.732) -- 0:00:23
Average standard deviation of split frequencies: 0.008027
645500 -- (-575.900) [-575.437] (-584.146) (-576.142) * (-577.300) [-577.927] (-577.096) (-577.628) -- 0:00:23
646000 -- (-576.286) (-577.511) [-575.519] (-579.009) * [-575.405] (-576.271) (-576.650) (-575.162) -- 0:00:23
646500 -- (-576.559) [-577.311] (-576.550) (-575.199) * (-582.270) (-576.587) (-577.653) [-576.446] -- 0:00:22
647000 -- (-576.895) (-577.658) (-576.596) [-576.584] * (-579.671) [-575.150] (-576.879) (-576.628) -- 0:00:22
647500 -- (-575.156) (-578.412) (-576.393) [-577.643] * (-576.432) (-574.123) [-576.449] (-575.529) -- 0:00:22
648000 -- (-576.763) [-576.709] (-574.812) (-575.720) * [-574.346] (-576.493) (-577.699) (-577.837) -- 0:00:22
648500 -- (-577.418) (-582.413) [-574.894] (-574.406) * (-580.412) (-578.231) [-576.408] (-576.495) -- 0:00:22
649000 -- (-575.750) (-578.363) (-575.899) [-576.423] * (-580.978) (-575.971) [-576.165] (-575.419) -- 0:00:22
649500 -- (-577.940) (-576.332) [-578.814] (-575.159) * (-579.377) [-575.846] (-577.422) (-575.333) -- 0:00:22
650000 -- (-575.973) (-575.391) (-576.299) [-573.956] * (-575.654) (-578.934) (-575.770) [-577.046] -- 0:00:23
Average standard deviation of split frequencies: 0.008452
650500 -- (-577.321) (-575.300) [-574.774] (-575.078) * [-577.319] (-577.403) (-576.100) (-578.647) -- 0:00:23
651000 -- (-575.152) [-577.254] (-575.624) (-579.370) * [-576.314] (-579.082) (-574.341) (-575.766) -- 0:00:23
651500 -- (-576.676) (-579.276) [-577.832] (-576.665) * [-577.985] (-578.078) (-577.748) (-577.237) -- 0:00:23
652000 -- (-576.727) [-576.151] (-575.685) (-578.424) * [-574.223] (-576.024) (-575.414) (-576.217) -- 0:00:22
652500 -- (-575.765) (-578.062) [-577.837] (-575.119) * (-577.065) (-576.115) [-574.406] (-579.142) -- 0:00:22
653000 -- (-575.513) (-581.460) (-578.768) [-576.348] * [-576.690] (-575.844) (-576.011) (-583.895) -- 0:00:22
653500 -- (-577.187) (-579.589) [-575.474] (-575.136) * (-575.404) (-575.153) (-575.799) [-581.052] -- 0:00:22
654000 -- (-576.720) [-575.551] (-575.466) (-578.406) * (-575.946) (-574.893) [-577.837] (-574.858) -- 0:00:22
654500 -- (-575.006) (-577.681) [-582.228] (-574.937) * (-575.631) (-577.174) (-580.466) [-577.877] -- 0:00:22
655000 -- [-574.564] (-575.672) (-580.214) (-576.317) * (-577.613) (-575.273) (-579.585) [-577.478] -- 0:00:22
Average standard deviation of split frequencies: 0.008575
655500 -- (-576.563) (-577.147) [-574.379] (-574.386) * (-579.182) [-574.121] (-577.271) (-578.342) -- 0:00:22
656000 -- (-577.325) (-578.051) [-575.131] (-576.250) * (-576.185) (-575.071) (-579.008) [-576.081] -- 0:00:22
656500 -- (-576.783) [-576.542] (-578.012) (-575.548) * [-576.122] (-576.355) (-579.022) (-578.333) -- 0:00:22
657000 -- (-575.206) (-576.608) [-576.236] (-576.178) * (-576.012) (-578.215) (-578.237) [-578.300] -- 0:00:22
657500 -- (-577.578) (-576.411) [-575.559] (-577.327) * (-577.722) (-578.939) [-577.832] (-578.047) -- 0:00:22
658000 -- [-580.002] (-576.953) (-577.031) (-576.031) * (-575.431) [-578.704] (-576.596) (-577.069) -- 0:00:22
658500 -- (-575.251) (-575.957) (-577.236) [-575.908] * [-574.703] (-579.068) (-578.487) (-577.700) -- 0:00:22
659000 -- [-576.284] (-577.582) (-576.798) (-575.542) * [-576.176] (-575.911) (-578.311) (-578.431) -- 0:00:22
659500 -- (-574.683) (-575.313) [-583.952] (-575.642) * (-578.364) (-577.462) (-580.104) [-575.388] -- 0:00:22
660000 -- (-578.624) [-575.841] (-580.163) (-574.420) * [-577.737] (-577.029) (-583.428) (-574.963) -- 0:00:22
Average standard deviation of split frequencies: 0.008515
660500 -- [-573.678] (-577.036) (-577.353) (-582.012) * (-575.780) (-580.814) (-577.029) [-574.911] -- 0:00:22
661000 -- (-581.055) (-576.705) (-574.608) [-579.514] * (-575.499) (-579.447) (-577.979) [-576.625] -- 0:00:22
661500 -- (-577.681) (-582.676) [-576.018] (-573.955) * [-576.803] (-575.489) (-576.338) (-573.524) -- 0:00:22
662000 -- (-576.681) (-576.756) [-577.087] (-577.520) * (-575.848) (-576.348) [-575.124] (-577.095) -- 0:00:21
662500 -- (-580.028) (-576.141) [-580.426] (-577.694) * (-577.027) (-579.694) [-578.267] (-577.098) -- 0:00:21
663000 -- (-576.158) (-576.571) (-577.240) [-576.681] * (-577.174) (-577.145) [-577.062] (-576.973) -- 0:00:21
663500 -- (-576.104) [-576.360] (-576.019) (-575.890) * (-577.420) [-576.386] (-580.829) (-577.313) -- 0:00:21
664000 -- [-576.285] (-576.054) (-577.414) (-575.044) * [-578.723] (-577.311) (-576.407) (-578.862) -- 0:00:21
664500 -- [-574.442] (-575.695) (-579.168) (-575.399) * (-577.337) (-579.153) (-579.027) [-579.007] -- 0:00:21
665000 -- (-576.058) (-575.527) (-579.481) [-576.365] * (-577.139) [-575.120] (-576.428) (-579.438) -- 0:00:21
Average standard deviation of split frequencies: 0.008892
665500 -- [-574.616] (-576.297) (-577.669) (-576.881) * (-580.711) (-575.622) [-578.909] (-574.213) -- 0:00:21
666000 -- (-575.391) (-576.152) [-574.478] (-576.033) * [-574.766] (-576.213) (-576.421) (-577.953) -- 0:00:22
666500 -- (-576.953) (-575.863) [-575.888] (-577.648) * (-577.098) (-576.220) (-576.663) [-575.787] -- 0:00:22
667000 -- (-575.308) (-579.629) [-575.551] (-578.883) * (-577.492) [-575.698] (-582.783) (-573.220) -- 0:00:21
667500 -- (-575.443) [-577.174] (-576.504) (-575.083) * [-576.536] (-575.181) (-577.124) (-578.087) -- 0:00:21
668000 -- (-575.893) (-579.102) (-577.806) [-576.378] * (-579.221) (-581.253) (-576.344) [-576.344] -- 0:00:21
668500 -- (-576.093) (-576.970) [-577.711] (-577.101) * (-575.730) [-576.603] (-577.862) (-578.412) -- 0:00:21
669000 -- (-575.331) (-578.519) (-577.293) [-579.046] * (-579.590) [-577.390] (-578.458) (-576.544) -- 0:00:21
669500 -- [-575.872] (-575.444) (-573.674) (-576.667) * (-575.062) [-576.444] (-575.913) (-576.406) -- 0:00:21
670000 -- (-574.878) (-579.886) (-578.129) [-576.781] * (-576.712) (-576.992) [-573.876] (-577.547) -- 0:00:21
Average standard deviation of split frequencies: 0.008391
670500 -- (-575.637) [-574.709] (-578.099) (-576.688) * (-576.178) (-576.352) (-577.145) [-576.974] -- 0:00:21
671000 -- (-577.630) [-576.294] (-576.824) (-576.825) * (-576.097) [-576.322] (-577.430) (-581.734) -- 0:00:21
671500 -- (-575.678) (-581.450) (-575.682) [-576.546] * (-577.550) (-579.306) (-577.445) [-585.691] -- 0:00:21
672000 -- (-576.063) (-578.572) [-577.971] (-576.595) * (-577.013) [-575.863] (-578.117) (-574.871) -- 0:00:21
672500 -- [-575.593] (-576.160) (-576.434) (-577.415) * (-574.211) (-578.217) (-573.325) [-576.275] -- 0:00:21
673000 -- (-575.061) (-576.364) [-575.448] (-576.129) * (-579.644) (-575.645) [-576.238] (-574.436) -- 0:00:21
673500 -- (-574.944) (-574.092) [-574.790] (-575.252) * (-578.110) (-577.183) (-574.731) [-577.028] -- 0:00:21
674000 -- (-575.425) (-576.539) (-577.547) [-580.093] * (-577.380) (-576.246) (-578.347) [-576.190] -- 0:00:21
674500 -- (-577.648) (-578.363) (-575.727) [-576.871] * [-578.069] (-575.913) (-576.072) (-575.424) -- 0:00:21
675000 -- (-576.569) (-581.203) [-576.615] (-582.116) * (-577.890) (-576.899) [-576.782] (-576.227) -- 0:00:21
Average standard deviation of split frequencies: 0.008089
675500 -- (-576.112) (-576.027) [-576.910] (-580.235) * (-579.158) (-578.724) (-576.165) [-576.777] -- 0:00:21
676000 -- (-574.919) (-575.637) (-577.008) [-578.266] * (-577.956) [-577.920] (-574.937) (-574.475) -- 0:00:21
676500 -- (-576.270) (-576.899) (-577.804) [-575.553] * (-577.076) (-579.344) (-573.850) [-575.864] -- 0:00:21
677000 -- (-577.897) (-576.012) (-575.314) [-575.852] * (-576.325) (-577.596) (-576.521) [-574.642] -- 0:00:20
677500 -- [-576.180] (-576.248) (-574.739) (-578.821) * (-574.756) (-575.430) [-576.021] (-574.298) -- 0:00:20
678000 -- (-574.899) [-575.356] (-574.705) (-577.108) * (-577.939) (-579.285) (-578.403) [-574.351] -- 0:00:20
678500 -- (-576.157) (-580.644) (-581.874) [-579.188] * (-579.718) [-576.431] (-580.179) (-573.775) -- 0:00:20
679000 -- [-575.327] (-575.827) (-578.167) (-577.115) * (-575.923) (-577.931) (-575.815) [-578.500] -- 0:00:20
679500 -- (-578.664) (-573.789) [-577.978] (-579.229) * [-576.901] (-575.608) (-575.861) (-578.386) -- 0:00:20
680000 -- (-578.322) (-575.857) [-575.637] (-576.884) * (-577.254) [-575.417] (-574.611) (-579.489) -- 0:00:20
Average standard deviation of split frequencies: 0.007526
680500 -- (-580.164) [-576.594] (-576.302) (-578.212) * (-575.703) [-575.716] (-577.456) (-574.352) -- 0:00:20
681000 -- (-574.232) (-576.918) (-578.280) [-580.162] * (-576.952) (-578.472) [-576.702] (-579.688) -- 0:00:20
681500 -- (-575.332) (-573.300) [-578.945] (-579.198) * (-578.036) (-576.399) (-576.163) [-573.146] -- 0:00:20
682000 -- [-574.104] (-576.480) (-577.463) (-578.958) * [-575.344] (-575.932) (-573.947) (-578.882) -- 0:00:20
682500 -- [-575.285] (-577.104) (-575.776) (-576.189) * (-575.564) [-574.282] (-576.541) (-575.787) -- 0:00:20
683000 -- (-574.984) (-576.451) [-574.841] (-577.879) * (-577.476) [-579.319] (-575.975) (-581.156) -- 0:00:20
683500 -- (-579.687) (-578.513) (-573.720) [-576.713] * [-575.157] (-577.159) (-575.842) (-576.680) -- 0:00:20
684000 -- (-574.986) (-576.071) [-573.909] (-577.835) * (-576.476) (-575.951) [-575.137] (-575.308) -- 0:00:20
684500 -- (-575.554) (-576.088) (-575.813) [-578.414] * (-579.175) (-579.012) (-575.990) [-576.283] -- 0:00:20
685000 -- (-577.005) (-580.778) [-577.405] (-578.302) * [-576.844] (-577.910) (-575.547) (-579.440) -- 0:00:20
Average standard deviation of split frequencies: 0.007774
685500 -- (-575.736) (-578.293) [-576.941] (-579.732) * [-576.744] (-575.771) (-576.259) (-575.524) -- 0:00:20
686000 -- (-579.379) (-574.968) (-576.316) [-576.167] * (-577.216) [-576.123] (-578.705) (-574.899) -- 0:00:20
686500 -- (-582.409) (-576.557) (-577.657) [-576.208] * (-576.203) (-575.578) (-582.996) [-573.729] -- 0:00:20
687000 -- [-576.870] (-578.790) (-578.619) (-576.913) * (-577.636) [-577.786] (-578.280) (-575.820) -- 0:00:20
687500 -- (-577.269) [-575.930] (-577.661) (-577.377) * [-576.760] (-582.427) (-576.991) (-576.854) -- 0:00:20
688000 -- (-576.378) [-579.536] (-577.355) (-575.761) * (-579.096) (-577.801) [-574.642] (-575.703) -- 0:00:20
688500 -- (-575.676) (-579.001) [-576.247] (-576.385) * (-581.010) (-577.990) [-573.705] (-580.614) -- 0:00:20
689000 -- (-574.279) (-575.819) (-581.655) [-576.795] * (-581.013) (-578.016) [-575.266] (-579.796) -- 0:00:20
689500 -- [-574.583] (-576.698) (-579.066) (-575.283) * [-576.167] (-575.859) (-578.995) (-576.940) -- 0:00:20
690000 -- (-575.710) [-574.955] (-580.448) (-577.363) * (-576.098) (-576.246) (-579.348) [-578.365] -- 0:00:20
Average standard deviation of split frequencies: 0.008105
690500 -- [-575.225] (-576.584) (-579.515) (-576.318) * (-575.650) (-577.380) [-577.260] (-577.461) -- 0:00:20
691000 -- (-576.449) (-575.746) (-578.492) [-579.155] * (-578.104) [-575.407] (-579.013) (-577.391) -- 0:00:20
691500 -- (-575.922) (-574.801) (-578.875) [-577.612] * (-580.187) [-578.209] (-576.543) (-579.911) -- 0:00:20
692000 -- [-577.051] (-573.553) (-577.352) (-575.931) * (-577.356) (-577.805) [-575.201] (-577.283) -- 0:00:20
692500 -- (-577.533) [-576.814] (-579.737) (-575.958) * (-580.582) (-576.602) (-576.770) [-575.781] -- 0:00:19
693000 -- (-577.856) (-580.259) (-576.332) [-578.264] * (-573.637) (-575.261) (-577.463) [-577.118] -- 0:00:19
693500 -- (-580.655) (-576.022) [-575.403] (-580.092) * (-574.272) [-574.687] (-580.123) (-577.827) -- 0:00:19
694000 -- (-579.321) (-577.295) [-574.520] (-576.009) * (-575.390) (-579.025) [-577.107] (-577.166) -- 0:00:19
694500 -- (-575.993) (-574.531) [-575.535] (-584.272) * (-575.670) (-576.949) [-576.359] (-578.779) -- 0:00:19
695000 -- [-579.469] (-575.540) (-576.725) (-577.388) * (-578.540) (-576.767) [-578.797] (-578.531) -- 0:00:19
Average standard deviation of split frequencies: 0.008353
695500 -- (-575.797) [-576.798] (-576.123) (-575.016) * [-574.778] (-574.835) (-575.954) (-575.930) -- 0:00:19
696000 -- [-576.044] (-576.991) (-577.574) (-577.509) * (-576.617) [-576.524] (-575.681) (-581.563) -- 0:00:19
696500 -- (-577.381) [-575.210] (-577.620) (-575.559) * (-579.405) [-574.806] (-576.826) (-576.166) -- 0:00:19
697000 -- (-577.784) (-574.899) (-577.288) [-575.713] * (-577.159) (-580.410) (-577.225) [-579.125] -- 0:00:19
697500 -- (-576.847) [-573.629] (-575.484) (-576.061) * (-576.874) (-575.729) [-572.742] (-580.161) -- 0:00:19
698000 -- [-577.163] (-578.115) (-577.424) (-574.975) * (-575.263) (-578.369) [-575.475] (-574.925) -- 0:00:19
698500 -- (-576.792) (-576.007) (-576.227) [-575.710] * (-574.057) (-578.752) [-575.472] (-578.506) -- 0:00:19
699000 -- [-576.300] (-575.390) (-578.720) (-575.631) * (-576.448) (-577.593) (-573.925) [-577.005] -- 0:00:19
699500 -- (-580.401) (-575.675) (-579.596) [-576.195] * [-574.007] (-577.453) (-576.883) (-580.361) -- 0:00:19
700000 -- [-576.719] (-576.963) (-576.506) (-576.308) * [-575.137] (-573.276) (-578.836) (-579.959) -- 0:00:19
Average standard deviation of split frequencies: 0.007894
700500 -- [-575.169] (-580.914) (-576.045) (-577.359) * (-579.518) (-575.930) [-575.383] (-575.421) -- 0:00:19
701000 -- (-578.032) (-577.992) [-576.848] (-575.754) * (-578.993) [-575.468] (-576.294) (-576.389) -- 0:00:19
701500 -- [-576.314] (-580.225) (-575.806) (-577.210) * (-578.848) [-576.385] (-578.412) (-578.801) -- 0:00:19
702000 -- (-577.920) (-578.933) [-573.589] (-574.060) * (-578.211) [-578.701] (-577.391) (-577.479) -- 0:00:19
702500 -- (-576.772) [-574.849] (-576.368) (-574.710) * (-577.436) [-575.783] (-575.168) (-574.248) -- 0:00:19
703000 -- [-575.642] (-576.290) (-576.655) (-575.748) * [-575.925] (-581.544) (-577.594) (-576.192) -- 0:00:19
703500 -- (-579.690) (-576.798) (-574.313) [-572.987] * [-577.034] (-578.362) (-575.411) (-577.334) -- 0:00:19
704000 -- (-576.558) (-576.318) [-575.834] (-574.607) * [-577.757] (-577.655) (-573.917) (-577.328) -- 0:00:19
704500 -- (-579.636) (-575.043) [-576.940] (-574.356) * (-576.770) (-575.298) (-577.011) [-578.860] -- 0:00:19
705000 -- [-576.595] (-575.845) (-576.304) (-577.512) * (-576.173) [-574.885] (-576.712) (-579.707) -- 0:00:19
Average standard deviation of split frequencies: 0.008458
705500 -- (-575.664) [-577.328] (-577.332) (-577.620) * (-578.455) (-574.940) [-576.267] (-577.637) -- 0:00:19
706000 -- (-575.148) [-573.994] (-575.283) (-578.534) * (-577.202) (-579.492) [-574.671] (-579.005) -- 0:00:19
706500 -- (-574.198) (-573.572) [-576.301] (-576.654) * (-576.858) (-578.410) (-581.797) [-574.575] -- 0:00:19
707000 -- (-575.424) (-577.962) [-574.391] (-578.696) * (-584.654) (-577.904) (-580.846) [-575.534] -- 0:00:19
707500 -- [-576.199] (-576.464) (-575.236) (-578.326) * (-584.878) [-575.970] (-585.606) (-577.003) -- 0:00:19
708000 -- [-576.632] (-578.397) (-575.259) (-578.932) * (-576.291) [-577.918] (-576.084) (-575.966) -- 0:00:18
708500 -- (-577.462) [-574.934] (-577.177) (-580.468) * (-574.870) [-578.875] (-574.310) (-576.200) -- 0:00:18
709000 -- (-576.408) (-577.915) [-573.041] (-581.709) * [-576.348] (-573.697) (-575.219) (-577.536) -- 0:00:18
709500 -- [-576.661] (-576.606) (-574.268) (-576.944) * (-575.461) (-576.379) (-577.362) [-575.111] -- 0:00:18
710000 -- [-579.695] (-580.343) (-575.249) (-579.604) * (-583.708) (-578.069) [-573.796] (-577.823) -- 0:00:18
Average standard deviation of split frequencies: 0.008269
710500 -- (-577.505) (-579.013) [-577.641] (-577.957) * (-572.672) [-577.685] (-575.378) (-576.791) -- 0:00:18
711000 -- [-576.799] (-578.525) (-575.278) (-576.188) * [-575.152] (-579.394) (-575.389) (-582.109) -- 0:00:18
711500 -- (-574.019) (-579.316) [-573.901] (-577.593) * (-574.824) (-579.514) (-579.311) [-577.022] -- 0:00:18
712000 -- [-575.841] (-576.242) (-576.707) (-577.685) * (-575.080) (-581.518) [-576.376] (-576.269) -- 0:00:18
712500 -- (-577.265) [-579.860] (-573.313) (-576.941) * [-579.332] (-578.783) (-575.416) (-577.569) -- 0:00:18
713000 -- (-580.548) (-578.040) (-574.552) [-577.731] * [-577.302] (-579.290) (-576.870) (-577.224) -- 0:00:18
713500 -- [-575.767] (-579.048) (-576.700) (-578.042) * [-579.211] (-577.736) (-577.690) (-576.608) -- 0:00:18
714000 -- (-581.134) [-575.517] (-577.348) (-575.934) * (-576.398) (-574.175) [-576.647] (-576.800) -- 0:00:18
714500 -- (-576.548) [-577.627] (-578.662) (-578.778) * (-579.609) [-576.014] (-576.532) (-577.987) -- 0:00:18
715000 -- [-577.113] (-577.151) (-576.798) (-575.778) * [-574.165] (-578.035) (-578.038) (-577.425) -- 0:00:18
Average standard deviation of split frequencies: 0.007769
715500 -- (-578.573) (-583.896) [-574.882] (-578.593) * [-575.290] (-577.126) (-579.414) (-577.904) -- 0:00:18
716000 -- (-577.546) (-578.874) [-575.448] (-576.382) * [-573.194] (-574.666) (-576.703) (-576.614) -- 0:00:18
716500 -- (-576.978) (-579.680) (-574.610) [-576.698] * (-575.034) (-578.407) (-576.646) [-576.216] -- 0:00:18
717000 -- (-581.544) (-577.269) (-575.117) [-577.689] * [-575.426] (-575.470) (-577.339) (-578.004) -- 0:00:18
717500 -- [-576.320] (-579.744) (-578.670) (-576.277) * [-576.364] (-575.951) (-574.227) (-576.893) -- 0:00:18
718000 -- (-577.403) (-578.206) (-579.576) [-576.265] * (-576.167) [-574.007] (-574.484) (-575.905) -- 0:00:18
718500 -- (-578.861) [-574.171] (-579.167) (-577.730) * (-575.850) (-575.060) [-578.303] (-575.470) -- 0:00:18
719000 -- [-579.730] (-579.592) (-584.515) (-576.773) * (-574.214) (-579.029) [-577.965] (-574.976) -- 0:00:18
719500 -- (-577.557) [-576.979] (-584.342) (-579.674) * [-577.041] (-579.922) (-576.582) (-576.058) -- 0:00:18
720000 -- [-575.953] (-577.412) (-577.437) (-576.335) * (-576.909) (-577.628) (-577.087) [-580.160] -- 0:00:18
Average standard deviation of split frequencies: 0.007849
720500 -- (-576.512) [-577.070] (-576.213) (-580.091) * (-575.331) (-578.351) (-579.336) [-579.738] -- 0:00:18
721000 -- (-574.894) (-577.587) (-576.632) [-576.330] * (-575.191) [-580.196] (-578.860) (-576.210) -- 0:00:18
721500 -- [-575.194] (-575.406) (-577.508) (-574.300) * (-577.390) (-579.461) [-578.606] (-578.589) -- 0:00:18
722000 -- (-574.246) (-576.086) [-580.462] (-576.386) * [-576.728] (-580.710) (-575.631) (-579.763) -- 0:00:18
722500 -- (-575.099) (-579.603) (-578.245) [-575.320] * (-576.892) [-579.156] (-575.683) (-579.528) -- 0:00:18
723000 -- (-574.685) (-579.524) (-576.078) [-576.967] * [-580.347] (-579.287) (-578.312) (-577.664) -- 0:00:18
723500 -- (-577.117) [-579.738] (-576.093) (-579.898) * (-576.561) (-577.407) (-575.216) [-575.283] -- 0:00:17
724000 -- [-576.877] (-578.277) (-575.721) (-577.716) * [-575.995] (-578.768) (-574.869) (-575.449) -- 0:00:17
724500 -- [-574.832] (-578.231) (-574.761) (-581.616) * [-575.212] (-577.251) (-578.895) (-576.708) -- 0:00:17
725000 -- [-575.704] (-576.703) (-577.165) (-576.542) * (-579.289) (-576.596) (-578.324) [-578.334] -- 0:00:17
Average standard deviation of split frequencies: 0.007446
725500 -- [-575.895] (-575.373) (-577.097) (-577.271) * [-574.563] (-575.881) (-575.768) (-577.972) -- 0:00:17
726000 -- [-576.042] (-578.687) (-575.484) (-576.212) * (-576.858) [-576.473] (-577.133) (-576.572) -- 0:00:17
726500 -- [-574.879] (-575.353) (-574.825) (-579.451) * (-576.260) (-579.201) (-582.847) [-577.351] -- 0:00:17
727000 -- (-575.069) (-577.062) (-575.448) [-577.111] * (-575.626) [-578.112] (-576.876) (-579.088) -- 0:00:17
727500 -- [-577.143] (-577.296) (-575.720) (-577.078) * [-575.037] (-578.457) (-576.221) (-577.659) -- 0:00:17
728000 -- (-576.227) [-576.153] (-577.166) (-576.399) * (-576.706) (-576.608) (-577.023) [-576.008] -- 0:00:17
728500 -- [-574.412] (-580.535) (-575.859) (-574.986) * [-576.602] (-580.593) (-576.616) (-576.151) -- 0:00:17
729000 -- (-576.043) (-582.221) [-575.574] (-577.639) * [-577.933] (-577.080) (-578.041) (-573.378) -- 0:00:17
729500 -- [-579.481] (-576.407) (-577.774) (-577.966) * (-575.413) [-579.506] (-578.104) (-576.198) -- 0:00:17
730000 -- [-574.774] (-580.435) (-579.050) (-578.105) * (-581.873) (-579.345) [-575.729] (-576.508) -- 0:00:17
Average standard deviation of split frequencies: 0.007269
730500 -- (-578.990) [-581.123] (-574.769) (-577.168) * (-575.469) (-576.777) (-577.041) [-573.909] -- 0:00:17
731000 -- [-576.920] (-577.661) (-576.179) (-579.699) * [-575.589] (-578.401) (-575.187) (-575.448) -- 0:00:17
731500 -- [-579.051] (-575.246) (-578.049) (-580.230) * (-578.180) (-578.162) (-574.829) [-575.600] -- 0:00:17
732000 -- (-575.377) [-574.667] (-574.904) (-576.527) * (-576.459) (-575.929) (-582.549) [-575.549] -- 0:00:17
732500 -- (-574.763) (-576.194) (-577.720) [-576.584] * (-575.913) (-577.241) [-577.115] (-578.243) -- 0:00:17
733000 -- [-576.408] (-580.030) (-576.448) (-575.615) * (-576.721) [-577.264] (-576.401) (-578.622) -- 0:00:17
733500 -- (-577.818) (-576.061) (-575.924) [-576.538] * [-575.388] (-578.451) (-577.726) (-582.613) -- 0:00:17
734000 -- (-577.725) (-574.096) [-575.440] (-576.433) * (-576.078) (-578.299) [-574.740] (-581.189) -- 0:00:17
734500 -- (-578.001) [-576.816] (-576.049) (-577.847) * (-576.919) (-580.622) (-580.746) [-574.343] -- 0:00:17
735000 -- (-576.528) (-578.286) [-574.562] (-580.952) * (-577.804) [-577.214] (-575.888) (-575.732) -- 0:00:17
Average standard deviation of split frequencies: 0.007729
735500 -- (-576.451) (-579.499) [-577.681] (-578.144) * (-577.592) (-579.488) [-579.006] (-575.622) -- 0:00:17
736000 -- (-577.187) [-576.663] (-580.750) (-577.796) * (-578.193) (-578.469) [-577.677] (-577.360) -- 0:00:17
736500 -- (-574.148) (-577.975) [-578.820] (-577.045) * (-579.468) [-576.057] (-579.416) (-582.813) -- 0:00:17
737000 -- (-575.845) (-578.015) [-576.818] (-576.000) * (-576.951) [-575.605] (-580.811) (-580.293) -- 0:00:17
737500 -- (-576.882) [-575.089] (-575.636) (-578.467) * (-583.078) [-578.582] (-576.466) (-577.003) -- 0:00:17
738000 -- (-577.464) (-580.443) [-576.907] (-576.754) * [-577.218] (-577.526) (-574.083) (-574.870) -- 0:00:17
738500 -- [-580.233] (-577.544) (-577.045) (-575.297) * (-578.898) [-577.979] (-575.038) (-576.596) -- 0:00:16
739000 -- (-576.800) [-576.894] (-577.419) (-577.177) * [-579.080] (-575.867) (-575.981) (-580.701) -- 0:00:16
739500 -- [-576.512] (-579.629) (-575.202) (-576.486) * (-576.365) (-575.148) (-576.622) [-575.814] -- 0:00:16
740000 -- (-577.143) (-581.647) [-574.574] (-578.146) * (-574.412) (-577.340) (-576.951) [-574.847] -- 0:00:16
Average standard deviation of split frequencies: 0.007171
740500 -- [-575.928] (-578.986) (-576.018) (-574.622) * (-573.464) (-577.189) (-578.323) [-576.697] -- 0:00:16
741000 -- [-575.188] (-579.014) (-575.031) (-576.523) * (-579.683) (-575.523) (-576.371) [-574.873] -- 0:00:16
741500 -- [-576.119] (-575.450) (-580.419) (-580.571) * (-577.578) (-577.557) [-577.219] (-579.429) -- 0:00:16
742000 -- (-577.641) (-575.554) (-580.238) [-576.931] * (-577.239) [-574.197] (-578.827) (-580.278) -- 0:00:16
742500 -- (-575.719) (-576.037) (-579.687) [-575.016] * (-575.046) [-575.543] (-576.750) (-576.764) -- 0:00:16
743000 -- (-574.534) [-577.167] (-577.761) (-574.399) * [-576.339] (-574.760) (-577.270) (-576.208) -- 0:00:16
743500 -- [-574.954] (-575.836) (-579.439) (-574.804) * (-577.571) (-576.281) [-578.698] (-576.307) -- 0:00:16
744000 -- (-580.793) (-576.933) (-578.553) [-576.871] * (-574.996) (-575.782) (-584.373) [-577.210] -- 0:00:16
744500 -- (-578.404) (-575.903) (-579.037) [-574.807] * (-576.550) [-575.874] (-575.943) (-577.989) -- 0:00:16
745000 -- (-580.078) (-574.353) (-577.408) [-575.858] * [-576.618] (-579.619) (-576.133) (-576.362) -- 0:00:16
Average standard deviation of split frequencies: 0.007306
745500 -- (-577.067) (-574.633) [-576.100] (-576.148) * (-582.951) [-577.655] (-576.842) (-576.675) -- 0:00:16
746000 -- (-577.678) (-576.267) (-580.915) [-577.701] * (-579.847) (-580.695) [-576.584] (-577.112) -- 0:00:16
746500 -- [-576.912] (-578.207) (-577.752) (-578.858) * (-576.279) (-579.309) [-576.627] (-581.185) -- 0:00:16
747000 -- (-577.901) [-580.075] (-576.091) (-574.467) * [-575.222] (-579.173) (-575.432) (-576.190) -- 0:00:16
747500 -- (-581.222) (-575.728) [-576.763] (-575.773) * (-578.609) [-581.654] (-579.252) (-578.253) -- 0:00:16
748000 -- (-582.229) (-574.135) (-575.636) [-577.241] * (-575.291) (-576.959) (-577.702) [-576.809] -- 0:00:16
748500 -- [-577.863] (-576.436) (-575.689) (-583.823) * (-576.680) (-576.799) [-575.369] (-576.680) -- 0:00:16
749000 -- (-576.020) (-576.165) [-575.356] (-579.323) * (-577.614) [-576.531] (-578.314) (-577.157) -- 0:00:16
749500 -- (-576.197) [-576.955] (-576.039) (-580.240) * [-574.673] (-577.393) (-581.410) (-575.770) -- 0:00:16
750000 -- (-577.158) (-575.436) (-576.462) [-576.003] * (-577.200) (-577.512) (-577.005) [-575.884] -- 0:00:16
Average standard deviation of split frequencies: 0.007033
750500 -- (-577.306) (-575.312) (-574.583) [-577.781] * (-583.172) (-578.719) [-578.956] (-577.163) -- 0:00:16
751000 -- (-577.117) (-576.136) [-577.195] (-575.383) * (-575.656) (-577.375) [-576.081] (-577.093) -- 0:00:16
751500 -- (-574.482) (-576.023) (-581.764) [-575.548] * (-575.081) (-577.937) [-575.370] (-577.583) -- 0:00:16
752000 -- [-577.108] (-577.188) (-581.182) (-580.619) * [-575.605] (-575.197) (-577.581) (-577.508) -- 0:00:16
752500 -- (-576.171) [-578.646] (-577.164) (-578.151) * (-575.324) [-574.732] (-578.698) (-578.201) -- 0:00:16
753000 -- (-575.775) [-580.396] (-575.861) (-585.353) * (-575.336) [-579.393] (-575.527) (-577.390) -- 0:00:16
753500 -- (-577.730) [-574.215] (-580.821) (-575.301) * [-573.506] (-576.078) (-576.068) (-575.461) -- 0:00:16
754000 -- (-580.446) (-577.704) (-575.081) [-575.167] * (-576.533) (-577.133) (-574.311) [-575.537] -- 0:00:15
754500 -- (-580.156) (-578.879) [-575.830] (-575.079) * [-575.195] (-576.503) (-575.446) (-575.173) -- 0:00:15
755000 -- (-575.355) (-580.067) [-576.233] (-574.586) * [-575.020] (-577.002) (-576.681) (-576.643) -- 0:00:15
Average standard deviation of split frequencies: 0.006776
755500 -- (-575.609) [-575.630] (-576.493) (-575.000) * (-577.549) (-580.183) [-573.833] (-576.243) -- 0:00:15
756000 -- [-576.010] (-576.752) (-578.165) (-578.616) * [-575.057] (-578.933) (-575.388) (-576.713) -- 0:00:15
756500 -- (-575.695) (-574.602) (-580.023) [-576.555] * (-575.024) (-574.624) [-574.203] (-579.335) -- 0:00:15
757000 -- (-575.937) (-577.479) [-575.657] (-580.842) * [-584.100] (-576.510) (-575.481) (-579.405) -- 0:00:15
757500 -- (-577.024) (-580.416) [-576.423] (-578.583) * [-573.724] (-579.198) (-578.586) (-576.735) -- 0:00:15
758000 -- [-574.492] (-576.050) (-577.309) (-576.090) * [-575.584] (-576.600) (-575.661) (-577.436) -- 0:00:15
758500 -- (-577.818) [-575.551] (-575.478) (-576.950) * (-577.899) (-579.057) (-575.191) [-577.565] -- 0:00:15
759000 -- [-577.129] (-578.184) (-575.981) (-578.862) * (-581.858) (-576.600) (-579.634) [-575.732] -- 0:00:15
759500 -- (-573.974) (-575.499) (-579.088) [-579.417] * (-579.194) (-577.157) (-574.604) [-577.950] -- 0:00:15
760000 -- (-579.399) (-574.201) (-577.806) [-574.454] * (-576.698) [-577.975] (-576.310) (-578.151) -- 0:00:15
Average standard deviation of split frequencies: 0.007189
760500 -- (-577.181) [-576.157] (-574.900) (-575.771) * (-575.301) (-577.812) [-574.516] (-575.181) -- 0:00:15
761000 -- (-574.978) [-574.507] (-579.070) (-576.168) * [-576.274] (-576.364) (-577.722) (-576.336) -- 0:00:15
761500 -- (-575.794) [-578.529] (-576.504) (-576.010) * (-577.489) (-576.402) (-576.436) [-575.425] -- 0:00:15
762000 -- (-574.774) (-579.124) (-576.362) [-574.953] * (-577.788) (-575.132) [-577.456] (-574.076) -- 0:00:15
762500 -- [-575.479] (-574.565) (-575.642) (-575.154) * (-575.198) (-577.076) [-575.608] (-573.818) -- 0:00:15
763000 -- (-576.476) (-575.998) (-575.577) [-578.130] * [-576.252] (-580.840) (-578.224) (-576.784) -- 0:00:15
763500 -- [-577.437] (-577.882) (-579.374) (-578.640) * [-575.953] (-576.926) (-576.285) (-575.803) -- 0:00:15
764000 -- (-576.824) (-583.688) [-576.658] (-581.301) * [-576.660] (-578.012) (-579.634) (-578.952) -- 0:00:15
764500 -- (-575.844) [-575.687] (-577.367) (-576.914) * [-576.728] (-577.849) (-580.168) (-576.992) -- 0:00:15
765000 -- (-578.940) (-574.795) (-579.295) [-576.158] * [-575.428] (-576.091) (-574.755) (-577.030) -- 0:00:15
Average standard deviation of split frequencies: 0.007057
765500 -- (-577.418) [-575.179] (-575.741) (-577.099) * (-578.949) (-576.536) [-578.046] (-578.103) -- 0:00:15
766000 -- (-577.846) (-575.014) (-574.118) [-578.364] * (-577.818) (-578.412) (-578.384) [-579.221] -- 0:00:15
766500 -- (-575.982) [-573.838] (-578.333) (-579.408) * [-580.641] (-579.543) (-578.231) (-582.206) -- 0:00:15
767000 -- (-576.900) (-575.539) [-574.955] (-577.988) * [-577.700] (-575.624) (-584.366) (-577.153) -- 0:00:15
767500 -- (-578.789) (-575.736) [-576.416] (-577.032) * [-578.167] (-578.153) (-577.073) (-576.119) -- 0:00:15
768000 -- (-579.052) (-575.800) (-576.957) [-574.733] * [-576.522] (-580.062) (-577.302) (-577.540) -- 0:00:15
768500 -- (-583.077) (-578.509) (-578.240) [-578.888] * (-582.694) [-578.739] (-576.094) (-578.558) -- 0:00:15
769000 -- [-577.149] (-576.500) (-577.367) (-578.489) * (-580.754) [-579.163] (-577.413) (-577.173) -- 0:00:15
769500 -- (-576.576) (-575.614) [-577.574] (-579.654) * (-580.467) (-578.380) (-576.611) [-578.251] -- 0:00:14
770000 -- (-575.904) (-576.245) (-576.737) [-576.023] * (-575.743) [-576.188] (-575.457) (-576.382) -- 0:00:14
Average standard deviation of split frequencies: 0.007226
770500 -- (-575.692) [-575.864] (-575.928) (-577.577) * (-576.392) (-576.626) (-575.584) [-581.375] -- 0:00:14
771000 -- (-576.466) (-576.036) (-575.303) [-576.112] * [-575.896] (-575.343) (-577.645) (-575.708) -- 0:00:14
771500 -- (-580.617) (-576.984) (-578.132) [-575.583] * (-575.196) (-576.933) (-578.887) [-574.451] -- 0:00:14
772000 -- (-578.917) (-578.378) [-577.042] (-576.812) * (-576.441) (-576.629) (-575.270) [-573.950] -- 0:00:14
772500 -- [-576.024] (-576.251) (-579.320) (-576.003) * (-578.019) [-575.415] (-577.111) (-577.855) -- 0:00:14
773000 -- (-580.242) (-575.563) [-577.720] (-577.407) * (-575.193) (-575.068) (-575.490) [-576.481] -- 0:00:14
773500 -- (-580.563) (-580.262) [-575.651] (-579.287) * (-577.963) (-575.870) [-575.962] (-575.067) -- 0:00:14
774000 -- (-578.831) (-579.382) [-573.586] (-578.106) * (-576.337) (-573.806) (-574.946) [-577.475] -- 0:00:14
774500 -- (-575.837) (-578.323) [-575.141] (-575.475) * [-575.451] (-577.845) (-577.165) (-578.463) -- 0:00:14
775000 -- [-576.097] (-578.494) (-578.668) (-575.778) * (-577.496) (-575.812) (-576.943) [-576.254] -- 0:00:14
Average standard deviation of split frequencies: 0.007366
775500 -- [-575.280] (-577.246) (-578.430) (-575.905) * (-574.618) (-579.195) (-575.333) [-579.485] -- 0:00:14
776000 -- [-578.264] (-579.480) (-575.294) (-577.439) * (-575.045) (-576.900) [-578.433] (-578.812) -- 0:00:14
776500 -- (-578.600) [-580.634] (-574.173) (-582.671) * [-575.244] (-576.291) (-578.194) (-577.240) -- 0:00:14
777000 -- (-575.715) [-577.169] (-578.315) (-578.523) * (-578.569) (-574.889) (-577.401) [-576.807] -- 0:00:14
777500 -- [-575.553] (-578.698) (-576.794) (-578.254) * [-575.249] (-577.723) (-576.099) (-578.599) -- 0:00:14
778000 -- (-576.111) (-577.727) (-578.752) [-580.237] * (-574.848) (-577.686) [-575.116] (-579.680) -- 0:00:14
778500 -- (-575.822) (-578.770) [-575.578] (-575.809) * (-579.363) (-575.692) (-574.283) [-576.775] -- 0:00:14
779000 -- [-576.663] (-578.416) (-577.306) (-578.711) * (-576.289) (-576.433) (-577.832) [-580.933] -- 0:00:14
779500 -- (-576.748) (-576.623) (-578.118) [-578.235] * [-575.287] (-576.494) (-574.615) (-578.458) -- 0:00:14
780000 -- (-579.028) [-576.819] (-579.355) (-575.026) * (-576.449) (-577.200) [-574.565] (-577.474) -- 0:00:14
Average standard deviation of split frequencies: 0.007367
780500 -- (-577.998) (-574.504) [-577.730] (-576.716) * (-576.529) [-575.998] (-573.491) (-575.214) -- 0:00:14
781000 -- (-576.539) (-577.021) (-575.661) [-573.646] * [-577.844] (-577.869) (-575.450) (-574.948) -- 0:00:14
781500 -- (-578.350) [-580.652] (-575.514) (-575.192) * (-576.244) [-580.186] (-575.727) (-580.502) -- 0:00:14
782000 -- [-574.337] (-576.036) (-577.487) (-573.951) * [-578.037] (-581.597) (-577.173) (-578.307) -- 0:00:14
782500 -- (-581.483) (-578.673) (-577.145) [-574.100] * (-580.227) (-577.337) [-577.287] (-576.251) -- 0:00:14
783000 -- (-576.400) (-575.621) (-575.259) [-573.260] * (-579.282) (-578.024) [-575.789] (-578.006) -- 0:00:14
783500 -- (-577.334) (-575.854) [-575.254] (-586.123) * (-574.881) [-575.419] (-580.382) (-576.404) -- 0:00:14
784000 -- (-578.628) (-577.164) [-575.744] (-578.130) * [-573.189] (-575.542) (-578.980) (-576.498) -- 0:00:14
784500 -- [-578.330] (-575.355) (-577.189) (-578.043) * (-576.947) (-576.867) [-577.088] (-576.839) -- 0:00:14
785000 -- (-575.306) (-576.279) (-578.623) [-576.919] * [-576.094] (-578.617) (-579.097) (-574.239) -- 0:00:13
Average standard deviation of split frequencies: 0.007309
785500 -- [-578.201] (-576.149) (-575.664) (-574.071) * (-574.858) (-578.157) [-576.045] (-575.691) -- 0:00:13
786000 -- (-585.083) (-578.267) (-578.820) [-575.534] * [-579.873] (-580.791) (-574.341) (-575.826) -- 0:00:13
786500 -- (-578.239) (-576.758) (-576.488) [-575.996] * (-576.653) (-576.182) (-576.101) [-574.979] -- 0:00:13
787000 -- (-576.782) (-576.859) (-575.010) [-577.945] * (-576.582) (-575.481) (-578.856) [-576.938] -- 0:00:13
787500 -- (-576.098) (-581.320) (-576.002) [-577.723] * [-577.776] (-576.845) (-576.706) (-577.011) -- 0:00:13
788000 -- (-578.210) (-583.822) (-576.727) [-576.339] * (-577.940) (-576.932) (-577.858) [-576.378] -- 0:00:13
788500 -- [-578.640] (-582.439) (-577.813) (-576.003) * [-577.165] (-579.913) (-575.790) (-575.362) -- 0:00:13
789000 -- [-577.976] (-576.750) (-577.934) (-577.337) * (-577.654) (-576.851) [-576.750] (-575.342) -- 0:00:13
789500 -- (-577.941) [-576.059] (-577.263) (-574.051) * [-577.675] (-577.719) (-577.183) (-575.337) -- 0:00:13
790000 -- (-576.523) [-577.973] (-578.369) (-576.285) * (-578.771) (-576.509) (-577.864) [-574.619] -- 0:00:13
Average standard deviation of split frequencies: 0.007117
790500 -- (-575.756) (-575.406) [-576.964] (-575.610) * (-577.484) (-576.454) [-580.053] (-576.953) -- 0:00:13
791000 -- (-575.746) [-577.575] (-577.252) (-577.825) * (-575.459) (-578.038) [-577.331] (-577.443) -- 0:00:13
791500 -- (-577.224) (-577.324) (-579.728) [-576.496] * [-575.442] (-582.082) (-580.205) (-575.373) -- 0:00:13
792000 -- (-574.930) (-578.425) (-579.289) [-576.594] * [-574.584] (-576.597) (-576.539) (-578.196) -- 0:00:13
792500 -- [-575.887] (-575.176) (-579.161) (-574.726) * (-577.593) (-577.619) (-575.544) [-577.799] -- 0:00:13
793000 -- (-576.281) [-572.541] (-575.701) (-576.070) * (-574.773) [-579.574] (-576.328) (-573.096) -- 0:00:13
793500 -- (-576.695) (-577.229) (-576.038) [-576.794] * (-577.907) (-577.063) (-577.016) [-574.505] -- 0:00:13
794000 -- (-576.168) (-579.510) [-575.304] (-575.776) * (-577.679) (-576.709) [-577.377] (-576.271) -- 0:00:13
794500 -- [-578.836] (-580.133) (-574.832) (-579.702) * [-574.253] (-576.571) (-576.760) (-575.755) -- 0:00:13
795000 -- (-577.063) (-577.894) [-575.909] (-576.654) * (-578.550) (-577.537) (-578.433) [-579.955] -- 0:00:13
Average standard deviation of split frequencies: 0.007292
795500 -- (-577.816) (-575.110) (-577.389) [-574.968] * (-574.645) (-578.725) (-575.511) [-579.341] -- 0:00:13
796000 -- (-576.625) (-576.521) [-576.274] (-577.255) * (-576.528) (-575.814) [-575.625] (-577.310) -- 0:00:13
796500 -- [-577.246] (-578.257) (-578.960) (-576.806) * (-574.461) (-581.161) [-578.393] (-579.336) -- 0:00:13
797000 -- (-576.772) (-576.232) [-576.362] (-576.394) * (-574.161) [-575.902] (-574.380) (-580.552) -- 0:00:13
797500 -- (-577.858) (-574.091) [-578.780] (-576.016) * (-578.345) (-576.717) (-576.501) [-577.145] -- 0:00:13
798000 -- (-579.039) [-576.125] (-577.100) (-575.437) * (-577.626) (-582.487) (-577.531) [-576.154] -- 0:00:13
798500 -- (-579.795) (-576.341) [-577.206] (-577.251) * (-581.385) (-578.344) (-576.226) [-577.763] -- 0:00:13
799000 -- (-578.688) (-576.965) (-578.876) [-579.584] * (-577.546) (-575.670) [-573.320] (-575.260) -- 0:00:13
799500 -- (-576.868) [-575.224] (-575.407) (-579.086) * (-577.117) (-576.344) [-573.962] (-575.125) -- 0:00:13
800000 -- [-578.700] (-575.056) (-575.549) (-577.131) * (-581.656) (-581.658) (-575.101) [-576.786] -- 0:00:12
Average standard deviation of split frequencies: 0.007396
800500 -- (-577.169) (-577.695) (-579.659) [-576.811] * [-573.177] (-576.884) (-576.830) (-578.958) -- 0:00:12
801000 -- (-576.401) (-574.452) [-574.805] (-576.427) * (-574.176) (-579.649) [-578.254] (-580.418) -- 0:00:12
801500 -- (-576.581) (-577.574) [-576.548] (-580.222) * [-574.884] (-576.779) (-577.466) (-578.171) -- 0:00:12
802000 -- (-574.989) [-575.220] (-579.352) (-579.463) * (-575.415) [-579.046] (-576.633) (-577.732) -- 0:00:12
802500 -- (-576.382) (-576.959) (-574.658) [-576.643] * (-577.036) (-577.881) (-577.907) [-575.687] -- 0:00:12
803000 -- (-575.351) [-576.762] (-575.086) (-578.731) * (-579.078) [-576.491] (-576.547) (-574.381) -- 0:00:12
803500 -- (-579.765) (-577.514) [-574.776] (-578.542) * (-577.069) (-576.183) (-577.961) [-575.281] -- 0:00:12
804000 -- (-576.646) [-577.136] (-577.403) (-576.913) * [-574.473] (-578.825) (-576.073) (-575.631) -- 0:00:12
804500 -- (-576.365) (-576.297) (-574.517) [-580.546] * [-574.384] (-575.157) (-578.777) (-576.328) -- 0:00:12
805000 -- (-575.788) (-576.351) (-577.024) [-576.783] * (-575.086) [-580.018] (-575.159) (-575.702) -- 0:00:12
Average standard deviation of split frequencies: 0.007750
805500 -- (-576.121) (-574.604) (-574.127) [-577.806] * [-576.549] (-579.184) (-577.429) (-580.372) -- 0:00:12
806000 -- [-576.767] (-577.024) (-577.193) (-579.782) * [-574.628] (-579.233) (-578.154) (-575.781) -- 0:00:12
806500 -- (-579.563) [-576.802] (-575.185) (-578.229) * [-577.290] (-576.134) (-576.796) (-578.448) -- 0:00:12
807000 -- [-577.583] (-576.216) (-575.388) (-580.213) * [-576.366] (-573.902) (-575.674) (-574.381) -- 0:00:12
807500 -- (-579.437) [-575.582] (-577.442) (-579.622) * [-576.052] (-576.606) (-576.191) (-574.893) -- 0:00:12
808000 -- (-576.643) (-577.089) [-575.164] (-577.995) * (-576.491) [-575.332] (-577.127) (-574.969) -- 0:00:12
808500 -- (-576.834) [-577.813] (-576.410) (-576.034) * (-574.933) (-573.402) [-574.578] (-577.050) -- 0:00:12
809000 -- [-575.822] (-578.343) (-577.643) (-580.600) * (-576.659) (-576.007) [-578.854] (-577.818) -- 0:00:12
809500 -- (-579.552) (-579.059) (-576.917) [-578.805] * (-578.733) (-577.053) (-578.265) [-574.347] -- 0:00:12
810000 -- [-577.700] (-578.305) (-577.986) (-578.678) * (-574.432) [-581.197] (-575.307) (-575.249) -- 0:00:12
Average standard deviation of split frequencies: 0.007560
810500 -- (-575.910) [-574.591] (-575.378) (-580.090) * (-574.864) (-578.437) (-574.019) [-576.996] -- 0:00:12
811000 -- (-577.734) (-573.700) [-578.291] (-578.013) * (-575.787) (-575.600) (-573.001) [-574.835] -- 0:00:12
811500 -- [-577.232] (-575.795) (-576.985) (-577.845) * (-579.503) [-579.526] (-574.761) (-579.165) -- 0:00:12
812000 -- [-578.107] (-579.341) (-575.856) (-579.307) * (-578.491) (-576.257) [-576.667] (-576.150) -- 0:00:12
812500 -- [-576.043] (-575.309) (-579.423) (-576.800) * (-579.501) [-576.627] (-577.152) (-576.149) -- 0:00:12
813000 -- (-576.526) [-575.787] (-579.487) (-574.731) * [-575.235] (-576.933) (-578.860) (-577.043) -- 0:00:12
813500 -- (-578.256) (-575.268) [-576.774] (-577.245) * [-576.871] (-576.571) (-577.227) (-576.008) -- 0:00:12
814000 -- (-578.031) (-575.268) [-580.771] (-577.595) * (-577.763) [-575.880] (-573.787) (-577.318) -- 0:00:12
814500 -- (-576.789) (-577.543) (-575.825) [-576.616] * (-577.304) (-575.105) [-573.692] (-577.682) -- 0:00:12
815000 -- (-575.160) [-576.937] (-576.471) (-578.292) * [-576.710] (-577.798) (-578.373) (-579.639) -- 0:00:12
Average standard deviation of split frequencies: 0.007546
815500 -- (-578.656) [-577.739] (-578.720) (-576.055) * [-577.288] (-575.444) (-577.507) (-580.800) -- 0:00:11
816000 -- (-578.914) (-576.156) (-578.330) [-578.818] * (-577.348) [-576.910] (-574.568) (-576.416) -- 0:00:11
816500 -- (-577.849) [-576.968] (-574.285) (-578.285) * [-576.433] (-576.679) (-574.737) (-581.521) -- 0:00:11
817000 -- [-576.769] (-577.151) (-576.366) (-575.103) * (-578.802) [-575.341] (-581.221) (-575.751) -- 0:00:11
817500 -- (-576.189) (-573.358) [-575.895] (-578.128) * (-576.239) [-576.556] (-576.088) (-576.818) -- 0:00:11
818000 -- (-578.982) (-576.996) (-576.556) [-575.017] * (-582.026) (-578.806) [-576.036] (-576.634) -- 0:00:11
818500 -- (-578.521) (-576.992) (-579.034) [-575.181] * (-574.300) (-582.219) (-576.668) [-574.998] -- 0:00:11
819000 -- (-576.808) (-574.957) [-579.271] (-578.457) * (-576.934) (-579.352) [-575.570] (-574.521) -- 0:00:11
819500 -- (-581.408) [-577.551] (-576.191) (-578.743) * [-576.935] (-575.604) (-574.065) (-580.889) -- 0:00:11
820000 -- (-578.096) (-574.737) (-575.651) [-575.931] * (-577.591) (-575.023) [-573.828] (-576.742) -- 0:00:11
Average standard deviation of split frequencies: 0.007647
820500 -- [-578.118] (-577.083) (-577.587) (-579.646) * (-575.891) (-577.935) (-574.864) [-575.592] -- 0:00:11
821000 -- (-576.524) [-575.023] (-580.771) (-580.049) * (-574.582) (-581.238) [-576.033] (-577.546) -- 0:00:11
821500 -- (-576.173) (-579.773) (-576.402) [-578.163] * (-574.662) (-582.426) [-573.465] (-575.110) -- 0:00:11
822000 -- (-575.920) (-578.520) (-577.536) [-576.467] * (-575.806) (-583.897) [-578.684] (-575.991) -- 0:00:11
822500 -- [-576.767] (-574.674) (-579.925) (-576.811) * (-582.118) (-578.141) (-578.514) [-576.465] -- 0:00:11
823000 -- (-577.554) (-579.554) (-576.222) [-578.159] * [-577.243] (-575.649) (-577.978) (-577.354) -- 0:00:11
823500 -- (-585.234) (-574.742) (-576.191) [-578.188] * (-576.619) (-576.540) [-576.406] (-574.345) -- 0:00:11
824000 -- (-579.294) (-575.842) [-574.962] (-576.959) * (-575.313) (-576.146) (-576.011) [-575.142] -- 0:00:11
824500 -- (-578.050) [-577.672] (-573.922) (-578.384) * (-577.856) [-577.915] (-575.718) (-579.960) -- 0:00:11
825000 -- (-576.542) (-575.369) [-574.069] (-580.115) * (-574.424) (-579.160) [-577.720] (-578.740) -- 0:00:11
Average standard deviation of split frequencies: 0.007705
825500 -- (-577.042) [-577.503] (-580.495) (-575.175) * (-577.053) (-576.664) [-576.407] (-576.907) -- 0:00:11
826000 -- (-575.664) (-577.565) [-575.168] (-576.018) * (-575.814) [-575.892] (-576.137) (-578.098) -- 0:00:11
826500 -- (-579.407) (-577.584) (-577.842) [-577.559] * (-576.600) [-574.322] (-575.528) (-580.301) -- 0:00:11
827000 -- (-577.225) [-577.561] (-576.537) (-577.078) * [-575.737] (-579.001) (-575.212) (-576.969) -- 0:00:11
827500 -- [-576.163] (-573.852) (-576.466) (-578.209) * (-577.649) (-580.923) (-577.655) [-577.689] -- 0:00:11
828000 -- (-576.708) [-576.821] (-578.190) (-576.472) * (-575.883) [-577.479] (-575.601) (-577.340) -- 0:00:11
828500 -- (-576.911) (-577.382) [-576.302] (-577.865) * (-575.672) (-575.739) (-577.338) [-576.965] -- 0:00:11
829000 -- (-578.750) (-575.218) (-578.978) [-576.591] * [-575.340] (-574.389) (-576.325) (-574.702) -- 0:00:11
829500 -- (-577.071) (-575.432) [-576.212] (-577.814) * [-578.643] (-576.559) (-576.322) (-576.229) -- 0:00:11
830000 -- (-577.010) (-575.011) (-575.239) [-579.259] * (-575.668) [-576.145] (-576.669) (-576.077) -- 0:00:11
Average standard deviation of split frequencies: 0.007803
830500 -- [-575.193] (-576.928) (-577.365) (-576.954) * (-576.119) (-575.749) (-577.035) [-575.343] -- 0:00:11
831000 -- [-577.514] (-576.155) (-577.879) (-577.628) * (-580.016) (-576.860) [-581.138] (-577.600) -- 0:00:10
831500 -- [-576.302] (-579.050) (-577.939) (-576.066) * (-579.675) (-577.323) [-577.115] (-579.838) -- 0:00:10
832000 -- (-577.016) [-574.104] (-580.903) (-576.134) * (-580.415) (-577.369) (-574.692) [-579.364] -- 0:00:10
832500 -- [-576.988] (-577.442) (-576.601) (-576.014) * (-580.758) [-576.771] (-575.874) (-577.194) -- 0:00:10
833000 -- (-578.537) (-579.069) [-574.882] (-578.687) * (-575.663) [-574.461] (-577.322) (-578.281) -- 0:00:10
833500 -- (-576.950) (-577.388) [-577.709] (-576.760) * (-575.525) [-576.639] (-576.857) (-576.854) -- 0:00:10
834000 -- [-577.397] (-575.465) (-577.121) (-575.376) * [-576.852] (-576.096) (-577.298) (-576.814) -- 0:00:10
834500 -- [-579.008] (-575.864) (-579.204) (-575.821) * (-579.590) (-578.848) [-575.232] (-576.731) -- 0:00:10
835000 -- (-578.041) (-577.113) (-577.769) [-579.967] * (-576.974) [-575.794] (-578.721) (-582.324) -- 0:00:10
Average standard deviation of split frequencies: 0.007859
835500 -- (-580.394) (-575.692) [-576.289] (-583.308) * (-575.052) (-576.866) [-575.561] (-578.392) -- 0:00:10
836000 -- [-576.663] (-577.641) (-578.170) (-580.903) * (-576.237) (-574.774) [-576.714] (-574.609) -- 0:00:10
836500 -- (-578.723) [-580.410] (-577.231) (-580.841) * [-577.248] (-577.691) (-577.905) (-576.384) -- 0:00:10
837000 -- (-580.903) (-579.070) [-579.746] (-577.793) * (-578.029) [-576.372] (-583.186) (-577.418) -- 0:00:10
837500 -- (-577.403) (-577.764) [-575.468] (-576.369) * (-580.373) (-577.675) (-579.966) [-575.019] -- 0:00:10
838000 -- [-577.941] (-578.532) (-575.072) (-576.373) * (-576.128) (-578.897) (-583.723) [-574.791] -- 0:00:10
838500 -- [-577.115] (-584.464) (-574.618) (-579.369) * (-575.294) [-579.032] (-577.280) (-574.373) -- 0:00:10
839000 -- (-577.844) (-581.302) [-575.754] (-575.289) * (-575.320) (-580.452) (-575.212) [-573.484] -- 0:00:10
839500 -- (-575.561) (-579.476) (-575.364) [-576.250] * [-575.493] (-576.198) (-575.700) (-575.812) -- 0:00:10
840000 -- (-579.551) (-583.527) [-577.692] (-575.996) * [-575.827] (-577.597) (-576.084) (-575.729) -- 0:00:10
Average standard deviation of split frequencies: 0.007535
840500 -- (-579.282) (-579.014) (-575.409) [-577.375] * (-574.642) (-576.391) (-573.166) [-579.672] -- 0:00:10
841000 -- (-575.006) (-578.181) (-576.606) [-573.997] * (-575.593) (-576.946) (-574.606) [-574.740] -- 0:00:10
841500 -- (-577.373) (-577.698) (-575.695) [-575.964] * (-576.770) [-576.585] (-574.556) (-577.794) -- 0:00:10
842000 -- (-574.676) (-578.315) [-573.961] (-576.695) * (-580.566) (-576.552) (-577.230) [-576.295] -- 0:00:10
842500 -- (-579.096) (-577.632) [-577.339] (-574.959) * (-574.617) (-578.672) (-578.195) [-574.934] -- 0:00:10
843000 -- (-575.173) [-577.782] (-580.237) (-576.425) * (-577.052) (-576.581) [-575.528] (-576.356) -- 0:00:10
843500 -- (-575.654) (-577.143) [-577.647] (-578.283) * [-577.368] (-578.617) (-577.831) (-574.625) -- 0:00:10
844000 -- [-577.705] (-580.869) (-574.303) (-576.897) * (-576.253) (-577.561) [-578.614] (-574.836) -- 0:00:10
844500 -- (-578.934) (-578.893) [-575.159] (-575.953) * (-573.800) (-578.187) (-580.351) [-573.546] -- 0:00:10
845000 -- (-576.244) (-577.476) (-575.939) [-577.705] * (-575.375) (-579.655) [-579.310] (-576.074) -- 0:00:10
Average standard deviation of split frequencies: 0.007731
845500 -- (-577.336) (-580.344) (-576.523) [-578.657] * [-578.419] (-581.694) (-574.648) (-575.264) -- 0:00:10
846000 -- [-579.366] (-577.032) (-576.969) (-578.258) * (-579.835) (-579.006) (-580.140) [-574.744] -- 0:00:10
846500 -- (-575.501) (-577.555) [-580.031] (-575.839) * (-579.502) (-577.585) [-577.629] (-581.486) -- 0:00:09
847000 -- (-577.387) (-577.468) (-584.273) [-576.962] * [-578.494] (-583.500) (-578.063) (-576.193) -- 0:00:09
847500 -- [-577.361] (-579.167) (-577.918) (-575.620) * (-577.875) (-577.194) [-580.181] (-577.485) -- 0:00:09
848000 -- [-576.313] (-577.964) (-576.175) (-578.515) * (-579.742) (-577.344) [-579.954] (-577.339) -- 0:00:09
848500 -- [-574.060] (-581.116) (-575.745) (-576.022) * (-574.400) [-576.458] (-576.232) (-577.275) -- 0:00:09
849000 -- (-577.522) (-576.910) (-579.018) [-574.604] * [-574.865] (-577.802) (-573.672) (-576.247) -- 0:00:09
849500 -- [-574.142] (-575.814) (-580.106) (-577.325) * (-583.189) (-578.831) [-578.058] (-575.373) -- 0:00:09
850000 -- (-576.911) (-576.464) (-577.144) [-576.384] * (-580.165) (-581.712) (-578.372) [-575.032] -- 0:00:09
Average standard deviation of split frequencies: 0.007550
850500 -- (-578.075) (-578.997) (-577.583) [-574.627] * [-575.856] (-577.684) (-575.872) (-576.453) -- 0:00:09
851000 -- (-575.185) (-576.442) (-579.896) [-578.467] * (-577.398) (-577.081) [-575.041] (-577.420) -- 0:00:09
851500 -- [-577.951] (-577.545) (-577.355) (-575.856) * [-577.340] (-575.996) (-575.671) (-575.492) -- 0:00:09
852000 -- [-576.486] (-577.017) (-577.656) (-578.276) * (-579.707) (-582.794) [-574.376] (-577.979) -- 0:00:09
852500 -- [-576.397] (-579.309) (-577.499) (-579.181) * (-580.010) (-576.416) [-574.668] (-577.271) -- 0:00:09
853000 -- (-576.869) (-576.588) [-577.958] (-577.864) * (-576.599) (-577.386) (-575.741) [-574.982] -- 0:00:09
853500 -- (-584.509) [-576.113] (-578.423) (-579.605) * (-580.714) [-579.854] (-575.911) (-574.949) -- 0:00:09
854000 -- (-579.374) (-578.277) (-575.397) [-575.856] * (-577.432) (-577.386) (-576.676) [-574.740] -- 0:00:09
854500 -- (-576.904) (-576.854) (-574.989) [-573.914] * (-578.285) (-577.038) [-576.010] (-581.641) -- 0:00:09
855000 -- (-576.933) (-577.516) (-575.097) [-575.962] * [-576.284] (-579.460) (-579.544) (-580.111) -- 0:00:09
Average standard deviation of split frequencies: 0.007572
855500 -- [-578.580] (-577.066) (-577.247) (-577.171) * (-578.125) (-575.818) (-575.841) [-577.309] -- 0:00:09
856000 -- (-576.935) (-578.910) [-576.229] (-574.981) * (-576.606) (-573.664) [-577.516] (-576.591) -- 0:00:09
856500 -- [-577.554] (-577.097) (-576.655) (-575.449) * (-575.894) [-577.653] (-578.192) (-577.983) -- 0:00:09
857000 -- (-576.833) (-576.493) (-577.749) [-576.266] * (-576.976) [-580.724] (-574.527) (-577.229) -- 0:00:09
857500 -- [-574.600] (-581.492) (-577.685) (-583.817) * (-581.138) [-575.450] (-576.224) (-575.477) -- 0:00:09
858000 -- [-577.127] (-581.896) (-577.582) (-578.327) * [-579.146] (-577.279) (-574.224) (-577.260) -- 0:00:09
858500 -- (-577.106) (-580.311) (-576.251) [-579.473] * (-576.322) [-579.533] (-573.999) (-578.142) -- 0:00:09
859000 -- [-576.975] (-578.390) (-576.534) (-577.967) * (-574.996) (-574.281) (-576.627) [-583.226] -- 0:00:09
859500 -- [-576.100] (-581.660) (-577.492) (-576.979) * (-580.054) (-577.525) (-575.103) [-581.004] -- 0:00:09
860000 -- (-576.312) [-579.946] (-575.195) (-576.239) * [-578.494] (-579.939) (-575.681) (-575.857) -- 0:00:09
Average standard deviation of split frequencies: 0.007851
860500 -- [-575.997] (-578.959) (-577.533) (-575.404) * (-578.130) (-578.322) (-576.811) [-577.764] -- 0:00:09
861000 -- (-576.153) [-578.664] (-577.711) (-577.455) * (-577.545) (-578.502) [-573.452] (-578.125) -- 0:00:09
861500 -- (-578.500) (-577.162) [-578.552] (-576.197) * [-575.741] (-575.523) (-577.502) (-581.584) -- 0:00:09
862000 -- (-573.977) (-576.568) [-574.775] (-576.686) * (-575.787) (-576.811) (-575.903) [-574.161] -- 0:00:08
862500 -- (-574.159) (-575.601) [-576.371] (-577.161) * (-573.551) (-576.584) (-575.473) [-576.484] -- 0:00:08
863000 -- [-576.051] (-582.333) (-576.017) (-577.709) * [-577.118] (-579.823) (-576.289) (-577.178) -- 0:00:08
863500 -- (-574.932) (-576.567) (-575.010) [-577.511] * (-576.893) [-575.735] (-575.487) (-574.054) -- 0:00:08
864000 -- [-576.935] (-577.822) (-577.019) (-577.817) * [-575.163] (-577.869) (-574.990) (-581.006) -- 0:00:08
864500 -- (-577.040) [-575.286] (-575.988) (-577.554) * (-576.375) [-577.239] (-574.229) (-577.681) -- 0:00:08
865000 -- [-576.452] (-576.077) (-578.554) (-579.008) * [-575.693] (-580.527) (-580.933) (-577.833) -- 0:00:08
Average standard deviation of split frequencies: 0.007553
865500 -- (-573.383) (-576.470) (-576.462) [-576.874] * (-576.272) [-576.474] (-582.525) (-576.386) -- 0:00:08
866000 -- (-578.394) [-576.506] (-576.833) (-575.939) * (-578.955) (-577.708) (-580.134) [-574.177] -- 0:00:08
866500 -- (-576.210) (-577.173) (-575.615) [-577.964] * [-578.636] (-577.921) (-577.258) (-576.196) -- 0:00:08
867000 -- (-575.286) (-578.011) [-574.928] (-577.117) * (-576.434) (-578.376) [-574.468] (-576.148) -- 0:00:08
867500 -- [-573.899] (-574.226) (-576.153) (-578.505) * [-576.810] (-576.528) (-576.404) (-578.743) -- 0:00:08
868000 -- (-576.629) (-575.846) (-583.108) [-580.002] * (-573.839) (-578.724) [-576.952] (-577.394) -- 0:00:08
868500 -- (-579.702) (-576.609) (-580.747) [-581.417] * (-576.359) (-576.555) (-579.608) [-577.620] -- 0:00:08
869000 -- (-576.484) (-575.331) [-579.913] (-575.209) * (-580.478) [-575.982] (-576.689) (-574.108) -- 0:00:08
869500 -- (-574.676) (-578.944) [-578.519] (-576.687) * (-576.154) [-575.968] (-579.009) (-576.047) -- 0:00:08
870000 -- (-579.502) (-577.790) [-576.288] (-575.401) * (-574.065) (-577.832) (-579.002) [-575.872] -- 0:00:08
Average standard deviation of split frequencies: 0.007715
870500 -- (-576.617) (-579.788) [-577.814] (-578.226) * (-576.734) [-575.790] (-576.274) (-577.025) -- 0:00:08
871000 -- (-574.216) (-577.571) [-575.779] (-578.378) * (-575.135) (-578.988) (-578.595) [-574.357] -- 0:00:08
871500 -- (-578.343) [-578.179] (-582.854) (-581.533) * (-576.122) (-576.309) (-577.288) [-575.815] -- 0:00:08
872000 -- (-575.709) (-574.519) [-574.493] (-579.303) * [-578.581] (-575.315) (-577.072) (-576.312) -- 0:00:08
872500 -- (-576.284) (-578.358) [-575.624] (-578.604) * (-577.808) (-576.300) (-577.329) [-574.582] -- 0:00:08
873000 -- [-578.260] (-578.106) (-578.164) (-577.079) * (-576.051) (-584.593) (-576.650) [-577.501] -- 0:00:08
873500 -- (-580.631) (-579.411) [-577.186] (-576.484) * (-577.983) (-579.888) (-577.973) [-574.784] -- 0:00:08
874000 -- [-575.195] (-578.418) (-575.518) (-576.753) * (-575.611) (-580.718) (-574.348) [-575.123] -- 0:00:08
874500 -- (-579.196) (-574.408) [-574.817] (-579.669) * (-574.528) (-578.215) [-577.120] (-575.659) -- 0:00:08
875000 -- [-577.750] (-575.227) (-579.723) (-578.538) * (-574.556) (-576.878) (-578.282) [-576.528] -- 0:00:08
Average standard deviation of split frequencies: 0.007736
875500 -- (-575.930) (-576.557) (-580.233) [-576.300] * [-577.519] (-577.133) (-577.057) (-576.840) -- 0:00:08
876000 -- (-575.596) (-578.853) [-574.266] (-576.953) * (-578.051) (-577.367) [-575.142] (-575.802) -- 0:00:08
876500 -- [-576.707] (-577.907) (-579.173) (-579.301) * (-579.049) [-575.226] (-577.080) (-575.713) -- 0:00:08
877000 -- [-579.823] (-577.643) (-577.562) (-577.952) * [-576.805] (-576.437) (-581.767) (-582.059) -- 0:00:07
877500 -- (-578.607) (-578.989) [-574.452] (-583.727) * (-576.076) (-577.009) (-579.479) [-580.995] -- 0:00:07
878000 -- (-578.549) [-575.921] (-576.567) (-576.842) * (-575.737) (-574.081) [-577.811] (-578.092) -- 0:00:07
878500 -- (-578.363) [-575.822] (-575.620) (-580.295) * (-576.383) [-577.137] (-579.501) (-575.370) -- 0:00:07
879000 -- [-578.804] (-575.146) (-578.265) (-577.959) * (-576.633) [-575.410] (-575.103) (-579.061) -- 0:00:07
879500 -- [-578.273] (-580.858) (-577.366) (-577.802) * (-575.986) (-579.760) (-574.719) [-577.917] -- 0:00:07
880000 -- [-576.109] (-576.511) (-574.242) (-578.145) * (-578.617) (-572.786) (-576.251) [-575.720] -- 0:00:07
Average standard deviation of split frequencies: 0.007423
880500 -- [-575.697] (-576.627) (-576.797) (-580.765) * (-575.177) (-578.729) [-576.994] (-581.143) -- 0:00:07
881000 -- [-576.773] (-576.730) (-577.257) (-576.539) * (-577.385) (-577.592) (-576.997) [-577.815] -- 0:00:07
881500 -- (-581.448) (-577.535) (-577.195) [-579.850] * [-573.502] (-575.621) (-576.973) (-575.540) -- 0:00:07
882000 -- (-580.259) (-576.679) (-576.603) [-578.010] * [-575.214] (-576.370) (-575.628) (-575.371) -- 0:00:07
882500 -- (-577.920) (-577.680) [-574.745] (-578.000) * (-576.915) (-577.164) [-575.109] (-574.427) -- 0:00:07
883000 -- (-577.922) [-578.981] (-580.300) (-576.918) * (-576.042) (-578.090) (-578.755) [-576.683] -- 0:00:07
883500 -- (-576.702) (-581.691) [-576.865] (-577.898) * [-574.683] (-577.799) (-575.947) (-577.122) -- 0:00:07
884000 -- [-576.653] (-578.114) (-579.505) (-579.987) * (-574.037) (-582.781) (-579.090) [-575.937] -- 0:00:07
884500 -- (-577.322) (-576.383) [-580.645] (-581.782) * [-576.471] (-575.917) (-582.262) (-576.048) -- 0:00:07
885000 -- (-578.759) [-577.589] (-578.013) (-576.607) * (-580.969) (-575.862) [-579.253] (-574.935) -- 0:00:07
Average standard deviation of split frequencies: 0.007482
885500 -- (-574.648) (-578.156) [-578.918] (-574.701) * (-578.766) (-577.724) [-577.327] (-576.904) -- 0:00:07
886000 -- (-577.358) [-575.646] (-579.315) (-577.325) * (-574.846) [-574.979] (-579.912) (-582.367) -- 0:00:07
886500 -- (-576.587) (-575.462) [-575.680] (-576.646) * (-576.871) (-578.953) [-575.930] (-579.736) -- 0:00:07
887000 -- (-578.549) (-577.223) [-576.463] (-580.190) * (-573.483) [-576.230] (-575.125) (-578.402) -- 0:00:07
887500 -- (-573.998) [-578.281] (-577.106) (-576.276) * (-575.385) (-576.982) [-576.293] (-578.206) -- 0:00:07
888000 -- (-580.682) [-578.879] (-576.272) (-577.426) * (-576.434) (-574.417) [-575.151] (-577.775) -- 0:00:07
888500 -- (-575.086) (-574.691) (-577.082) [-577.519] * (-575.828) [-575.074] (-575.748) (-576.678) -- 0:00:07
889000 -- [-576.536] (-575.826) (-579.099) (-578.616) * [-576.081] (-574.620) (-575.622) (-579.488) -- 0:00:07
889500 -- (-577.471) (-577.996) [-578.277] (-579.229) * (-576.536) (-574.620) (-577.140) [-581.025] -- 0:00:07
890000 -- (-578.180) (-577.573) (-587.153) [-579.051] * [-579.910] (-576.246) (-576.327) (-578.025) -- 0:00:07
Average standard deviation of split frequencies: 0.007833
890500 -- (-575.498) [-578.138] (-578.905) (-577.740) * (-577.949) [-574.994] (-576.477) (-578.254) -- 0:00:07
891000 -- (-578.426) (-575.724) [-575.353] (-578.298) * (-577.853) (-575.655) (-580.278) [-576.168] -- 0:00:07
891500 -- (-580.467) (-574.978) (-576.674) [-576.809] * (-575.122) [-577.160] (-575.439) (-576.553) -- 0:00:07
892000 -- (-579.929) [-575.095] (-576.589) (-579.770) * (-576.077) (-575.077) (-579.866) [-576.663] -- 0:00:07
892500 -- (-578.912) [-579.444] (-578.233) (-576.322) * (-576.699) (-579.607) [-575.575] (-576.847) -- 0:00:06
893000 -- (-579.141) (-579.539) (-576.771) [-574.400] * (-577.049) [-577.202] (-580.094) (-576.603) -- 0:00:06
893500 -- (-576.429) (-580.039) [-576.282] (-578.271) * (-577.665) (-575.083) (-578.215) [-577.936] -- 0:00:06
894000 -- (-575.589) [-576.034] (-576.741) (-577.660) * (-576.658) (-575.408) (-584.015) [-575.799] -- 0:00:06
894500 -- (-578.773) (-575.813) [-574.582] (-577.641) * [-581.712] (-576.586) (-577.956) (-576.786) -- 0:00:06
895000 -- (-576.192) (-576.507) (-579.415) [-575.666] * (-575.109) [-580.963] (-577.974) (-576.161) -- 0:00:06
Average standard deviation of split frequencies: 0.007464
895500 -- (-582.201) (-576.034) [-574.877] (-578.158) * (-576.805) [-580.524] (-580.510) (-578.313) -- 0:00:06
896000 -- (-577.362) (-577.379) [-576.486] (-576.721) * [-575.839] (-574.139) (-581.842) (-576.545) -- 0:00:06
896500 -- (-577.481) (-577.000) [-574.696] (-578.158) * (-576.392) (-576.937) [-578.930] (-574.505) -- 0:00:06
897000 -- (-575.928) [-577.591] (-573.987) (-578.649) * (-576.170) [-575.713] (-579.925) (-576.249) -- 0:00:06
897500 -- [-576.417] (-579.210) (-577.088) (-575.990) * (-578.612) (-575.473) [-580.452] (-576.055) -- 0:00:06
898000 -- [-577.438] (-576.100) (-574.252) (-577.136) * (-575.868) (-579.875) [-578.511] (-579.647) -- 0:00:06
898500 -- (-574.993) (-574.871) (-576.386) [-575.905] * (-575.763) (-578.714) (-579.660) [-577.072] -- 0:00:06
899000 -- (-575.580) (-574.614) [-575.527] (-575.980) * (-581.230) (-575.684) (-582.847) [-575.487] -- 0:00:06
899500 -- (-577.519) (-579.581) (-579.297) [-581.134] * (-580.877) [-576.990] (-580.108) (-578.141) -- 0:00:06
900000 -- (-576.975) [-577.603] (-579.504) (-583.150) * (-583.647) [-575.798] (-579.980) (-581.115) -- 0:00:06
Average standard deviation of split frequencies: 0.007642
900500 -- (-577.146) (-578.076) (-582.032) [-576.854] * (-584.520) [-575.634] (-577.115) (-576.140) -- 0:00:06
901000 -- [-575.486] (-575.276) (-575.001) (-575.615) * (-579.046) (-575.348) [-576.792] (-577.317) -- 0:00:06
901500 -- [-575.785] (-577.831) (-577.504) (-576.029) * (-576.525) (-576.117) [-578.366] (-577.373) -- 0:00:06
902000 -- (-576.378) [-577.130] (-574.389) (-577.283) * (-579.354) [-575.446] (-579.428) (-579.172) -- 0:00:06
902500 -- [-576.266] (-575.175) (-578.751) (-575.003) * [-577.310] (-576.101) (-578.597) (-578.118) -- 0:00:06
903000 -- (-576.293) (-576.457) (-580.135) [-576.091] * (-580.202) (-574.232) (-578.740) [-576.302] -- 0:00:06
903500 -- (-578.746) [-575.606] (-578.877) (-584.666) * (-577.450) (-576.058) [-574.867] (-577.451) -- 0:00:06
904000 -- [-575.010] (-576.239) (-576.939) (-576.007) * [-573.898] (-578.914) (-575.980) (-578.388) -- 0:00:06
904500 -- (-576.527) [-574.518] (-581.090) (-578.113) * (-574.809) (-577.946) [-577.074] (-577.493) -- 0:00:06
905000 -- (-575.285) (-575.074) (-575.139) [-574.678] * (-577.656) [-575.840] (-578.778) (-580.704) -- 0:00:06
Average standard deviation of split frequencies: 0.007701
905500 -- [-577.213] (-575.999) (-576.181) (-576.911) * [-580.227] (-577.710) (-576.010) (-577.206) -- 0:00:06
906000 -- (-575.514) (-575.259) [-577.304] (-575.598) * (-578.674) (-576.668) (-575.832) [-576.252] -- 0:00:06
906500 -- (-574.951) (-574.623) (-576.194) [-579.761] * (-577.811) (-576.903) (-575.897) [-578.114] -- 0:00:06
907000 -- (-578.903) [-576.014] (-574.831) (-574.526) * (-578.771) (-580.292) (-576.370) [-577.681] -- 0:00:06
907500 -- (-576.730) [-576.735] (-574.844) (-576.839) * (-576.226) (-576.452) [-578.424] (-576.339) -- 0:00:06
908000 -- (-577.197) [-576.732] (-577.210) (-577.561) * (-576.307) [-574.685] (-575.854) (-576.841) -- 0:00:05
908500 -- (-575.622) (-576.112) [-574.641] (-577.137) * (-575.586) [-580.996] (-578.441) (-576.929) -- 0:00:05
909000 -- (-574.723) (-576.617) (-578.899) [-577.741] * (-575.313) (-579.930) [-577.182] (-579.018) -- 0:00:05
909500 -- [-575.353] (-575.001) (-576.728) (-579.808) * [-575.829] (-576.018) (-577.178) (-578.273) -- 0:00:05
910000 -- (-579.283) [-576.573] (-576.058) (-588.534) * (-583.103) [-574.657] (-576.696) (-581.465) -- 0:00:05
Average standard deviation of split frequencies: 0.007868
910500 -- (-577.922) (-578.227) (-575.152) [-578.399] * (-576.713) [-575.725] (-577.089) (-579.872) -- 0:00:05
911000 -- [-576.992] (-575.757) (-574.646) (-578.306) * [-575.010] (-577.486) (-577.885) (-578.505) -- 0:00:05
911500 -- (-578.044) (-577.820) [-576.388] (-575.870) * (-579.849) (-578.827) [-575.435] (-577.060) -- 0:00:05
912000 -- (-578.952) (-575.821) (-575.745) [-576.276] * (-578.279) [-576.106] (-575.771) (-577.232) -- 0:00:05
912500 -- [-583.202] (-575.854) (-575.839) (-582.775) * (-578.001) [-577.730] (-581.321) (-578.544) -- 0:00:05
913000 -- (-575.694) [-576.284] (-576.700) (-577.026) * (-577.167) (-575.854) [-577.189] (-577.498) -- 0:00:05
913500 -- (-577.722) (-578.998) (-576.895) [-576.032] * (-576.329) (-576.740) [-576.247] (-579.007) -- 0:00:05
914000 -- (-576.131) (-576.313) [-575.420] (-576.558) * [-577.143] (-578.305) (-575.829) (-579.066) -- 0:00:05
914500 -- (-575.322) (-578.334) [-575.955] (-576.647) * (-577.440) (-578.438) [-581.351] (-579.495) -- 0:00:05
915000 -- (-575.310) [-580.340] (-575.767) (-576.683) * (-576.580) (-577.077) (-575.412) [-577.265] -- 0:00:05
Average standard deviation of split frequencies: 0.008028
915500 -- (-577.607) (-578.401) [-575.120] (-577.416) * (-577.429) (-575.629) [-574.601] (-579.250) -- 0:00:05
916000 -- (-575.474) (-578.288) (-576.468) [-575.838] * [-577.964] (-574.565) (-576.505) (-578.359) -- 0:00:05
916500 -- (-574.810) [-578.936] (-576.387) (-574.457) * (-576.275) [-574.397] (-579.909) (-576.800) -- 0:00:05
917000 -- (-578.104) (-579.136) [-576.681] (-578.775) * (-578.366) (-577.740) (-576.759) [-575.948] -- 0:00:05
917500 -- (-574.550) [-577.850] (-580.610) (-577.574) * (-578.679) [-576.685] (-580.255) (-576.548) -- 0:00:05
918000 -- (-579.463) (-578.987) (-574.633) [-575.377] * (-574.967) (-574.559) (-576.671) [-576.254] -- 0:00:05
918500 -- (-577.786) (-579.834) (-575.770) [-581.087] * (-577.463) (-579.967) [-576.163] (-576.237) -- 0:00:05
919000 -- (-577.731) [-577.568] (-576.245) (-578.767) * (-578.954) (-575.253) (-576.174) [-580.248] -- 0:00:05
919500 -- (-579.658) [-577.702] (-577.179) (-579.846) * (-576.425) [-579.310] (-576.266) (-578.417) -- 0:00:05
920000 -- (-578.888) (-578.187) [-577.493] (-579.587) * (-575.721) [-578.839] (-575.283) (-577.362) -- 0:00:05
Average standard deviation of split frequencies: 0.008192
920500 -- (-575.353) (-579.613) [-578.839] (-575.728) * (-578.998) [-576.178] (-576.453) (-575.763) -- 0:00:05
921000 -- [-576.291] (-578.210) (-580.285) (-577.805) * (-580.062) [-577.200] (-577.164) (-574.979) -- 0:00:05
921500 -- (-576.699) (-576.943) (-578.088) [-578.380] * (-577.675) [-575.556] (-576.300) (-575.265) -- 0:00:05
922000 -- [-576.776] (-575.505) (-576.484) (-575.707) * (-577.053) [-575.819] (-578.407) (-581.893) -- 0:00:05
922500 -- [-576.025] (-577.897) (-576.407) (-576.650) * (-577.475) (-574.352) [-578.225] (-575.167) -- 0:00:05
923000 -- (-574.307) (-577.322) (-577.935) [-575.048] * (-575.989) (-577.093) (-577.758) [-576.152] -- 0:00:05
923500 -- (-575.912) [-576.593] (-577.348) (-576.186) * [-577.890] (-576.426) (-579.992) (-576.177) -- 0:00:04
924000 -- (-575.207) (-577.549) [-576.351] (-578.450) * (-576.524) (-575.743) (-577.727) [-576.910] -- 0:00:04
924500 -- (-579.564) (-579.668) (-575.862) [-576.661] * (-577.485) (-574.156) [-578.224] (-577.396) -- 0:00:04
925000 -- [-578.257] (-575.298) (-579.985) (-575.816) * (-577.974) [-577.370] (-574.743) (-576.823) -- 0:00:04
Average standard deviation of split frequencies: 0.008315
925500 -- [-577.812] (-575.164) (-574.262) (-576.551) * (-577.333) (-578.322) [-575.027] (-576.744) -- 0:00:04
926000 -- (-578.726) [-577.821] (-580.767) (-573.814) * (-576.928) (-576.597) (-579.386) [-576.612] -- 0:00:04
926500 -- (-574.214) (-577.524) [-577.317] (-573.946) * [-576.691] (-577.369) (-578.012) (-579.394) -- 0:00:04
927000 -- [-575.147] (-579.959) (-576.599) (-578.196) * [-576.590] (-576.545) (-576.611) (-580.000) -- 0:00:04
927500 -- [-575.389] (-582.117) (-575.905) (-574.816) * (-577.495) (-574.989) (-578.192) [-578.569] -- 0:00:04
928000 -- [-576.378] (-579.742) (-575.290) (-576.026) * [-577.682] (-576.591) (-578.431) (-574.442) -- 0:00:04
928500 -- (-575.243) [-577.000] (-576.492) (-577.152) * (-576.905) (-575.329) [-576.793] (-574.899) -- 0:00:04
929000 -- [-576.055] (-580.082) (-576.015) (-574.434) * [-579.580] (-576.154) (-577.184) (-576.792) -- 0:00:04
929500 -- (-575.077) [-579.489] (-579.033) (-578.487) * (-578.692) [-577.203] (-575.051) (-580.676) -- 0:00:04
930000 -- (-577.699) (-578.588) (-576.975) [-576.251] * (-578.185) (-580.946) [-577.914] (-580.321) -- 0:00:04
Average standard deviation of split frequencies: 0.007902
930500 -- (-576.759) [-575.118] (-583.671) (-576.010) * (-579.153) [-575.106] (-577.312) (-578.055) -- 0:00:04
931000 -- [-574.907] (-575.574) (-576.259) (-576.612) * (-578.742) (-574.142) (-576.687) [-575.744] -- 0:00:04
931500 -- (-578.275) (-580.442) (-576.157) [-575.767] * [-573.833] (-576.058) (-577.974) (-574.785) -- 0:00:04
932000 -- (-574.656) (-578.042) (-575.785) [-576.503] * (-575.318) (-575.108) [-577.382] (-575.116) -- 0:00:04
932500 -- (-577.781) (-578.770) [-574.672] (-576.015) * (-577.472) (-574.061) [-577.510] (-581.494) -- 0:00:04
933000 -- (-578.077) (-576.663) (-577.431) [-577.893] * (-575.696) (-576.586) (-576.861) [-577.608] -- 0:00:04
933500 -- [-577.025] (-575.656) (-576.782) (-578.227) * (-577.550) (-576.595) [-577.678] (-579.129) -- 0:00:04
934000 -- [-579.711] (-576.539) (-574.867) (-577.662) * (-574.433) (-574.939) (-580.883) [-578.611] -- 0:00:04
934500 -- [-577.683] (-578.589) (-573.624) (-575.403) * (-577.666) [-574.283] (-576.706) (-581.139) -- 0:00:04
935000 -- (-579.361) (-579.088) (-576.668) [-576.702] * (-579.706) (-579.025) (-577.241) [-575.095] -- 0:00:04
Average standard deviation of split frequencies: 0.007722
935500 -- (-576.446) (-577.146) [-578.082] (-576.377) * (-578.925) (-576.899) [-575.321] (-578.133) -- 0:00:04
936000 -- [-577.010] (-580.055) (-579.027) (-583.545) * (-576.207) [-578.620] (-582.415) (-580.545) -- 0:00:04
936500 -- (-575.062) (-589.956) (-576.517) [-574.760] * (-577.600) (-577.698) (-574.661) [-576.506] -- 0:00:04
937000 -- (-576.459) (-579.658) [-575.752] (-578.922) * (-576.787) (-579.527) [-575.074] (-575.147) -- 0:00:04
937500 -- [-576.366] (-578.223) (-578.927) (-579.673) * (-579.528) (-579.960) [-575.225] (-573.901) -- 0:00:04
938000 -- (-575.660) (-580.051) (-576.857) [-577.259] * (-575.824) [-574.746] (-574.646) (-580.648) -- 0:00:04
938500 -- (-576.569) [-576.926] (-580.237) (-575.503) * (-576.790) (-577.026) (-578.018) [-575.643] -- 0:00:03
939000 -- (-574.898) (-578.397) (-576.881) [-578.011] * (-577.929) (-576.835) [-576.570] (-577.239) -- 0:00:03
939500 -- (-574.965) (-576.828) (-574.434) [-575.403] * (-578.685) [-579.290] (-573.415) (-578.669) -- 0:00:03
940000 -- (-575.088) [-576.366] (-576.543) (-577.474) * (-574.943) (-575.642) (-579.591) [-575.411] -- 0:00:03
Average standard deviation of split frequencies: 0.007383
940500 -- [-576.687] (-577.741) (-578.966) (-575.101) * (-576.925) (-573.748) [-578.193] (-574.417) -- 0:00:03
941000 -- (-573.542) [-579.508] (-577.858) (-578.752) * (-579.231) [-575.864] (-579.093) (-577.293) -- 0:00:03
941500 -- (-577.636) (-575.951) [-577.213] (-581.546) * (-581.796) (-574.852) [-578.958] (-575.749) -- 0:00:03
942000 -- (-577.224) (-575.740) (-577.661) [-581.889] * (-581.335) [-575.969] (-581.656) (-575.469) -- 0:00:03
942500 -- (-577.173) (-580.148) (-575.697) [-576.627] * (-576.081) (-578.363) [-578.458] (-579.744) -- 0:00:03
943000 -- (-577.114) (-581.777) (-577.418) [-575.116] * (-576.565) (-575.182) (-577.005) [-577.698] -- 0:00:03
943500 -- (-576.222) [-582.231] (-578.540) (-578.046) * (-576.640) (-575.981) [-575.063] (-576.049) -- 0:00:03
944000 -- [-573.828] (-580.294) (-575.607) (-575.157) * (-576.813) (-574.895) (-575.446) [-575.610] -- 0:00:03
944500 -- [-578.155] (-578.944) (-576.692) (-575.544) * (-576.543) (-576.832) [-575.126] (-575.914) -- 0:00:03
945000 -- (-576.490) (-578.990) [-576.664] (-579.405) * (-575.802) (-580.170) (-575.257) [-576.266] -- 0:00:03
Average standard deviation of split frequencies: 0.007508
945500 -- (-585.889) [-577.692] (-578.397) (-574.178) * (-575.652) (-576.925) (-575.049) [-576.836] -- 0:00:03
946000 -- [-575.684] (-578.883) (-580.967) (-575.269) * (-577.828) (-577.010) [-573.836] (-576.698) -- 0:00:03
946500 -- (-575.366) (-576.417) [-579.564] (-575.866) * (-578.486) (-575.366) (-576.721) [-577.958] -- 0:00:03
947000 -- [-574.955] (-576.841) (-576.329) (-576.729) * (-579.492) (-577.472) [-574.345] (-576.286) -- 0:00:03
947500 -- [-577.523] (-578.029) (-573.970) (-576.335) * (-580.316) (-575.895) (-576.764) [-577.702] -- 0:00:03
948000 -- (-580.138) (-578.917) (-577.744) [-576.407] * [-575.922] (-578.133) (-578.175) (-577.842) -- 0:00:03
948500 -- (-577.101) [-575.474] (-577.900) (-574.725) * (-579.283) (-576.674) [-575.249] (-578.150) -- 0:00:03
949000 -- [-577.731] (-577.137) (-575.492) (-575.699) * (-575.918) (-578.047) (-574.488) [-576.270] -- 0:00:03
949500 -- (-576.810) (-579.832) (-578.552) [-575.346] * [-577.515] (-580.369) (-576.169) (-579.190) -- 0:00:03
950000 -- (-578.377) (-577.466) (-578.285) [-579.340] * [-577.823] (-580.469) (-574.748) (-577.574) -- 0:00:03
Average standard deviation of split frequencies: 0.007339
950500 -- [-577.213] (-577.848) (-579.384) (-580.862) * (-577.370) (-581.390) (-575.405) [-577.111] -- 0:00:03
951000 -- (-575.803) [-575.821] (-578.745) (-576.195) * (-577.094) [-577.024] (-575.585) (-577.647) -- 0:00:03
951500 -- (-577.122) (-576.291) (-579.084) [-576.887] * [-578.146] (-578.815) (-579.551) (-578.379) -- 0:00:03
952000 -- (-579.860) (-582.799) [-575.887] (-574.873) * (-582.334) (-576.817) [-579.454] (-576.075) -- 0:00:03
952500 -- (-578.297) (-577.091) [-576.362] (-575.082) * (-580.506) (-579.439) [-576.648] (-578.964) -- 0:00:03
953000 -- (-578.359) (-574.429) (-576.001) [-578.545] * (-585.339) (-577.399) (-577.723) [-579.001] -- 0:00:03
953500 -- (-576.883) (-580.032) (-576.200) [-576.485] * (-580.632) (-576.562) [-577.209] (-577.269) -- 0:00:03
954000 -- (-576.882) [-579.118] (-576.757) (-577.858) * [-577.876] (-579.103) (-576.482) (-578.010) -- 0:00:02
954500 -- (-576.998) (-577.444) (-576.963) [-577.316] * (-579.739) (-578.383) [-575.421] (-578.075) -- 0:00:02
955000 -- [-578.555] (-576.439) (-576.480) (-577.109) * (-579.606) (-577.902) (-575.502) [-578.486] -- 0:00:02
Average standard deviation of split frequencies: 0.007232
955500 -- (-574.913) (-575.952) (-575.830) [-576.755] * (-578.636) (-576.202) (-580.319) [-575.966] -- 0:00:02
956000 -- (-579.767) (-573.764) (-578.611) [-575.362] * (-580.032) (-576.537) [-578.682] (-578.732) -- 0:00:02
956500 -- (-578.183) (-574.518) [-576.730] (-576.184) * [-577.869] (-576.673) (-576.063) (-580.368) -- 0:00:02
957000 -- (-581.557) [-576.716] (-577.111) (-574.959) * (-578.168) (-578.479) [-576.715] (-576.966) -- 0:00:02
957500 -- (-576.620) [-574.143] (-575.588) (-578.067) * (-577.773) (-576.368) (-578.312) [-578.905] -- 0:00:02
958000 -- (-579.022) (-577.878) [-575.387] (-583.498) * (-578.833) (-578.338) [-576.252] (-581.160) -- 0:00:02
958500 -- [-575.995] (-575.690) (-577.556) (-581.546) * (-579.447) (-577.488) (-575.831) [-577.755] -- 0:00:02
959000 -- [-574.536] (-577.366) (-577.056) (-580.663) * (-577.892) (-579.585) (-578.804) [-579.331] -- 0:00:02
959500 -- (-577.864) (-577.560) [-576.130] (-579.755) * [-576.795] (-576.403) (-574.700) (-586.826) -- 0:00:02
960000 -- [-576.613] (-574.980) (-575.231) (-576.915) * (-574.623) [-576.540] (-577.021) (-584.171) -- 0:00:02
Average standard deviation of split frequencies: 0.007328
960500 -- (-577.080) (-577.146) [-576.487] (-575.597) * (-580.939) (-577.589) [-575.001] (-577.194) -- 0:00:02
961000 -- (-577.813) (-577.071) [-576.520] (-574.444) * [-577.294] (-575.585) (-578.600) (-576.776) -- 0:00:02
961500 -- (-577.662) (-577.546) (-575.648) [-576.421] * [-574.460] (-580.082) (-576.898) (-576.451) -- 0:00:02
962000 -- (-579.652) (-574.004) (-575.907) [-577.843] * (-574.738) (-577.942) [-576.589] (-577.905) -- 0:00:02
962500 -- (-581.588) (-578.143) (-576.193) [-574.419] * (-576.824) (-576.840) (-576.596) [-576.214] -- 0:00:02
963000 -- (-579.027) (-575.836) [-578.747] (-577.333) * (-575.403) (-575.969) [-574.233] (-578.842) -- 0:00:02
963500 -- (-577.518) (-579.049) [-576.722] (-577.454) * (-578.450) [-575.432] (-577.019) (-577.702) -- 0:00:02
964000 -- (-574.536) (-577.238) [-578.333] (-580.782) * (-574.917) (-578.703) (-578.934) [-575.856] -- 0:00:02
964500 -- (-575.635) (-576.281) [-575.102] (-577.968) * (-574.210) (-577.490) (-577.950) [-576.159] -- 0:00:02
965000 -- (-575.205) (-575.751) [-577.587] (-580.220) * (-577.249) [-576.283] (-577.373) (-575.872) -- 0:00:02
Average standard deviation of split frequencies: 0.007483
965500 -- (-574.179) [-575.529] (-577.786) (-577.997) * (-577.305) (-575.284) [-579.765] (-579.252) -- 0:00:02
966000 -- [-573.781] (-574.795) (-576.572) (-580.784) * (-575.664) (-575.347) (-583.008) [-577.321] -- 0:00:02
966500 -- (-577.545) (-577.825) (-581.412) [-575.972] * [-576.920] (-577.474) (-585.179) (-576.751) -- 0:00:02
967000 -- [-574.965] (-576.541) (-575.758) (-576.483) * (-581.097) (-575.075) [-579.509] (-579.966) -- 0:00:02
967500 -- (-576.738) [-576.505] (-581.374) (-576.112) * (-575.491) (-575.873) [-580.514] (-578.119) -- 0:00:02
968000 -- (-580.306) [-584.586] (-577.144) (-577.242) * (-576.230) [-576.225] (-576.511) (-577.290) -- 0:00:02
968500 -- (-577.938) (-577.432) [-575.398] (-576.197) * (-575.081) [-575.714] (-574.424) (-576.202) -- 0:00:02
969000 -- [-579.464] (-579.451) (-576.600) (-581.938) * (-576.424) (-574.173) (-577.819) [-574.368] -- 0:00:02
969500 -- [-577.966] (-582.155) (-577.168) (-579.451) * [-575.223] (-574.271) (-575.165) (-576.859) -- 0:00:01
970000 -- (-577.243) (-576.845) [-577.933] (-579.490) * (-575.266) (-581.648) [-574.723] (-577.196) -- 0:00:01
Average standard deviation of split frequencies: 0.007673
970500 -- (-578.642) [-576.165] (-575.718) (-577.239) * [-575.811] (-576.206) (-577.667) (-576.748) -- 0:00:01
971000 -- (-576.562) (-575.988) [-577.615] (-577.324) * [-577.812] (-578.826) (-575.839) (-578.655) -- 0:00:01
971500 -- [-576.183] (-576.297) (-578.295) (-577.064) * (-576.060) (-578.955) [-575.658] (-577.026) -- 0:00:01
972000 -- [-577.211] (-576.927) (-575.236) (-580.182) * (-577.320) (-578.596) (-576.955) [-576.594] -- 0:00:01
972500 -- (-578.627) (-576.421) (-576.705) [-577.042] * (-577.091) [-579.400] (-577.397) (-580.006) -- 0:00:01
973000 -- [-576.683] (-581.927) (-576.612) (-582.748) * (-577.793) [-575.125] (-577.142) (-575.444) -- 0:00:01
973500 -- (-576.742) (-578.044) (-576.944) [-577.064] * [-574.705] (-578.350) (-575.020) (-577.045) -- 0:00:01
974000 -- (-576.674) (-575.757) [-576.642] (-574.172) * (-574.703) (-578.115) [-575.833] (-576.464) -- 0:00:01
974500 -- (-576.360) (-580.078) (-578.297) [-577.799] * (-578.586) (-579.791) (-576.770) [-574.645] -- 0:00:01
975000 -- (-576.840) [-576.732] (-579.642) (-575.688) * (-575.775) (-577.940) (-577.529) [-575.795] -- 0:00:01
Average standard deviation of split frequencies: 0.007567
975500 -- [-576.420] (-576.156) (-577.056) (-577.688) * (-574.553) (-576.687) [-578.206] (-577.918) -- 0:00:01
976000 -- [-576.255] (-576.909) (-579.562) (-577.783) * (-576.500) [-576.596] (-575.483) (-577.315) -- 0:00:01
976500 -- (-576.682) (-574.859) [-577.563] (-576.421) * [-577.023] (-578.091) (-576.342) (-578.204) -- 0:00:01
977000 -- [-576.247] (-577.651) (-577.951) (-575.672) * (-574.693) (-577.165) (-578.233) [-574.274] -- 0:00:01
977500 -- (-576.682) (-579.134) [-575.329] (-580.403) * (-577.185) (-577.381) (-577.035) [-578.028] -- 0:00:01
978000 -- (-575.832) (-573.904) [-576.286] (-577.595) * (-577.414) (-576.390) (-578.682) [-575.626] -- 0:00:01
978500 -- (-577.499) (-575.787) [-577.015] (-575.599) * (-580.104) [-574.749] (-576.818) (-576.560) -- 0:00:01
979000 -- (-576.596) (-574.977) [-577.794] (-576.781) * (-575.969) (-574.507) (-578.957) [-579.346] -- 0:00:01
979500 -- (-575.342) (-576.637) (-579.679) [-574.970] * (-578.439) [-577.881] (-575.523) (-576.898) -- 0:00:01
980000 -- (-580.140) (-579.513) [-576.628] (-576.129) * (-574.200) (-575.412) [-575.178] (-576.945) -- 0:00:01
Average standard deviation of split frequencies: 0.007210
980500 -- (-579.930) [-575.157] (-576.580) (-578.270) * (-577.673) (-585.358) [-575.300] (-578.731) -- 0:00:01
981000 -- [-575.030] (-574.578) (-579.752) (-575.100) * [-575.486] (-579.114) (-574.820) (-579.627) -- 0:00:01
981500 -- (-574.440) [-576.772] (-576.984) (-576.118) * (-575.625) (-578.421) (-575.276) [-575.795] -- 0:00:01
982000 -- (-574.482) (-575.410) [-578.132] (-578.205) * [-576.409] (-581.838) (-575.713) (-576.900) -- 0:00:01
982500 -- (-577.983) (-577.063) [-575.911] (-576.252) * (-578.143) [-576.604] (-578.528) (-577.834) -- 0:00:01
983000 -- (-578.010) (-577.312) (-579.599) [-575.730] * (-576.111) (-576.525) [-577.589] (-575.876) -- 0:00:01
983500 -- (-575.660) [-575.946] (-575.736) (-580.392) * [-575.215] (-580.304) (-578.468) (-576.110) -- 0:00:01
984000 -- (-577.704) (-574.796) [-574.714] (-576.933) * (-578.746) (-576.391) (-581.667) [-577.036] -- 0:00:01
984500 -- (-577.806) (-574.941) [-576.082] (-576.698) * [-574.238] (-575.864) (-580.414) (-578.245) -- 0:00:01
985000 -- (-574.122) (-574.301) [-575.024] (-578.625) * [-574.863] (-576.505) (-578.276) (-577.642) -- 0:00:00
Average standard deviation of split frequencies: 0.007171
985500 -- (-577.651) (-575.123) [-576.941] (-574.053) * [-575.406] (-575.960) (-576.713) (-579.852) -- 0:00:00
986000 -- [-578.271] (-574.363) (-578.527) (-576.077) * (-577.746) (-573.313) (-576.859) [-576.168] -- 0:00:00
986500 -- (-577.133) (-580.353) [-579.612] (-577.009) * (-575.747) (-575.959) (-578.949) [-577.562] -- 0:00:00
987000 -- (-578.488) (-576.992) [-578.312] (-577.219) * (-579.021) (-576.005) (-576.469) [-576.506] -- 0:00:00
987500 -- (-574.551) (-575.631) (-576.357) [-579.531] * [-575.400] (-575.711) (-575.179) (-574.350) -- 0:00:00
988000 -- (-577.860) (-576.553) [-577.536] (-576.450) * (-578.391) (-575.301) [-575.344] (-577.614) -- 0:00:00
988500 -- [-576.518] (-576.306) (-575.120) (-576.218) * (-577.511) [-577.489] (-573.464) (-576.194) -- 0:00:00
989000 -- (-579.319) [-578.631] (-578.594) (-576.206) * (-576.987) [-576.186] (-576.533) (-577.510) -- 0:00:00
989500 -- (-578.510) (-578.391) (-576.418) [-576.438] * (-578.677) (-579.332) (-577.027) [-576.403] -- 0:00:00
990000 -- [-577.945] (-574.921) (-574.483) (-578.719) * (-576.441) (-576.954) (-578.503) [-576.760] -- 0:00:00
Average standard deviation of split frequencies: 0.007455
990500 -- [-576.916] (-576.542) (-574.250) (-575.892) * (-577.210) (-574.872) [-578.173] (-580.120) -- 0:00:00
991000 -- (-577.772) [-575.991] (-576.202) (-576.053) * [-575.574] (-575.039) (-579.169) (-575.589) -- 0:00:00
991500 -- (-577.807) (-577.073) [-575.147] (-576.808) * (-576.440) (-576.173) [-575.586] (-579.284) -- 0:00:00
992000 -- (-578.453) [-577.011] (-576.221) (-577.226) * (-576.566) (-577.149) (-576.824) [-574.984] -- 0:00:00
992500 -- (-581.250) [-576.070] (-576.971) (-575.083) * (-576.246) (-577.470) [-573.871] (-577.182) -- 0:00:00
993000 -- (-581.032) (-576.858) (-582.982) [-577.883] * (-575.910) (-577.879) [-576.914] (-578.206) -- 0:00:00
993500 -- (-577.048) [-576.620] (-581.958) (-575.436) * [-577.427] (-576.516) (-575.560) (-575.010) -- 0:00:00
994000 -- (-579.196) [-577.003] (-577.445) (-579.235) * [-578.764] (-576.784) (-576.705) (-576.556) -- 0:00:00
994500 -- (-577.030) (-576.164) (-578.169) [-574.817] * (-577.736) (-578.190) [-578.279] (-583.422) -- 0:00:00
995000 -- (-577.305) (-582.229) (-573.148) [-580.291] * [-576.530] (-576.541) (-576.051) (-574.999) -- 0:00:00
Average standard deviation of split frequencies: 0.007447
995500 -- [-582.417] (-575.891) (-578.088) (-576.552) * (-577.284) (-574.305) [-574.898] (-574.876) -- 0:00:00
996000 -- (-577.601) [-575.292] (-574.896) (-575.497) * (-578.719) (-578.435) [-577.415] (-576.574) -- 0:00:00
996500 -- [-576.854] (-573.979) (-574.702) (-576.706) * (-577.539) (-576.872) [-576.475] (-575.279) -- 0:00:00
997000 -- (-577.241) [-574.966] (-579.461) (-577.361) * (-576.530) (-578.588) [-575.892] (-576.305) -- 0:00:00
997500 -- (-576.860) (-577.027) [-575.122] (-576.112) * (-576.104) [-573.767] (-575.346) (-579.013) -- 0:00:00
998000 -- (-584.746) (-577.281) [-575.916] (-576.425) * (-576.112) (-580.793) [-575.505] (-576.862) -- 0:00:00
998500 -- (-586.526) (-576.289) (-576.972) [-575.038] * (-578.458) (-577.276) (-577.298) [-577.717] -- 0:00:00
999000 -- (-581.099) (-576.261) [-576.139] (-578.473) * (-576.839) (-575.106) [-575.892] (-580.381) -- 0:00:00
999500 -- (-576.630) (-575.845) (-575.869) [-576.679] * (-576.847) [-575.535] (-576.551) (-574.661) -- 0:00:00
1000000 -- (-575.940) (-578.996) (-575.414) [-574.427] * (-580.024) (-575.572) [-574.623] (-577.967) -- 0:00:00
Average standard deviation of split frequencies: 0.007537
Analysis completed in 1 mins 5 seconds
Analysis used 64.20 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -571.87
Likelihood of best state for "cold" chain of run 2 was -571.70
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 65 %) Dirichlet(Revmat{all})
98.2 % ( 96 %) Slider(Revmat{all})
33.3 % ( 33 %) Dirichlet(Pi{all})
34.4 % ( 32 %) Slider(Pi{all})
69.6 % ( 34 %) Multiplier(Alpha{1,2})
79.0 % ( 44 %) Multiplier(Alpha{3})
27.9 % ( 27 %) Slider(Pinvar{all})
97.0 % ( 98 %) ExtSPR(Tau{all},V{all})
68.8 % ( 74 %) ExtTBR(Tau{all},V{all})
98.0 % ( 96 %) NNI(Tau{all},V{all})
87.8 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 29 %) Multiplier(V{all})
95.0 % ( 94 %) Nodeslider(V{all})
30.4 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 80 %) Dirichlet(Revmat{all})
98.4 % ( 97 %) Slider(Revmat{all})
34.7 % ( 30 %) Dirichlet(Pi{all})
35.2 % ( 23 %) Slider(Pi{all})
69.1 % ( 36 %) Multiplier(Alpha{1,2})
79.1 % ( 59 %) Multiplier(Alpha{3})
27.7 % ( 26 %) Slider(Pinvar{all})
97.2 % ( 96 %) ExtSPR(Tau{all},V{all})
69.1 % ( 63 %) ExtTBR(Tau{all},V{all})
98.0 % (100 %) NNI(Tau{all},V{all})
87.9 % ( 83 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
94.9 % ( 97 %) Nodeslider(V{all})
30.0 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166792 0.82 0.66
3 | 166733 166723 0.83
4 | 166706 166626 166420
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166750 0.82 0.66
3 | 166208 165933 0.83
4 | 167580 166906 166623
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -575.72
|2 1 |
| 2 |
| 2 2 2 2 2 2 22 2 |
| 1 2 1 2 21 2 2|
| 1 1 1 *2 2 2 2 |
|1 1 12 22 * * 1 2 1 2 1 2 2 |
| 2 2 2 2 2 1 1 2 2 1 |
| 1 2 1 1 1 2 * 1 12 21 1 |
| 12 1 1 ** 21 1 * 1|
| 1 1 1 1 111 1 1 |
| 22 1 1 2 2 11 2 1 1 |
| 1 2 2 2 2 1 |
| 1 1 1 2 |
| 1 2 1 1 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -577.61
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -575.71 -579.96
2 -575.54 -579.27
--------------------------------------
TOTAL -575.62 -579.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.872374 0.089171 0.333549 1.460786 0.837809 1384.70 1398.59 1.000
r(A<->C){all} 0.131734 0.015087 0.000129 0.396826 0.095132 180.80 258.65 1.001
r(A<->G){all} 0.171518 0.020103 0.000036 0.459507 0.134820 129.01 188.81 1.010
r(A<->T){all} 0.158093 0.019537 0.000112 0.443362 0.114838 198.22 245.63 1.001
r(C<->G){all} 0.228255 0.029763 0.000026 0.564118 0.190702 131.19 171.50 1.020
r(C<->T){all} 0.142863 0.016044 0.000010 0.401790 0.105873 189.81 244.26 1.002
r(G<->T){all} 0.167537 0.019543 0.000011 0.442787 0.133778 115.49 158.54 1.001
pi(A){all} 0.287759 0.000495 0.243239 0.328695 0.287397 1290.77 1395.89 1.000
pi(C){all} 0.298968 0.000523 0.254467 0.342288 0.298965 1184.74 1218.20 1.000
pi(G){all} 0.231859 0.000423 0.193587 0.273499 0.231004 1258.15 1341.52 1.000
pi(T){all} 0.181413 0.000365 0.143086 0.218639 0.180750 1029.24 1265.12 1.000
alpha{1,2} 0.325781 0.131832 0.000363 1.072983 0.212697 1121.87 1229.34 1.003
alpha{3} 0.405462 0.231152 0.000139 1.401608 0.233517 1237.14 1292.08 1.000
pinvar{all} 0.991464 0.000050 0.977720 0.999626 0.993428 1427.45 1434.62 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .***.*
8 -- .**...
9 -- ..****
10 -- .**.**
11 -- .****.
12 -- .*.*..
13 -- ...*.*
14 -- ..**..
15 -- ..*..*
16 -- .*..*.
17 -- ...**.
18 -- .*...*
19 -- ....**
20 -- ..*.*.
21 -- .*.***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 464 0.154564 0.016017 0.143238 0.165889 2
8 458 0.152565 0.009422 0.145903 0.159227 2
9 455 0.151566 0.009893 0.144570 0.158561 2
10 439 0.146236 0.006124 0.141905 0.150566 2
11 435 0.144903 0.001413 0.143904 0.145903 2
12 435 0.144903 0.020257 0.130580 0.159227 2
13 430 0.143238 0.006595 0.138574 0.147901 2
14 425 0.141572 0.000471 0.141239 0.141905 2
15 425 0.141572 0.001413 0.140573 0.142572 2
16 424 0.141239 0.010364 0.133911 0.148568 2
17 422 0.140573 0.005653 0.136576 0.144570 2
18 419 0.139574 0.006124 0.135243 0.143904 2
19 417 0.138907 0.008951 0.132578 0.145237 2
20 416 0.138574 0.001884 0.137242 0.139907 2
21 378 0.125916 0.008480 0.119920 0.131912 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.090411 0.009089 0.000032 0.289542 0.060084 1.000 2
length{all}[2] 0.089513 0.008667 0.000002 0.273820 0.059711 1.000 2
length{all}[3] 0.091534 0.008573 0.000082 0.278651 0.063229 1.000 2
length{all}[4] 0.092059 0.008724 0.000002 0.276428 0.064211 1.000 2
length{all}[5] 0.091072 0.008956 0.000166 0.285142 0.060123 1.001 2
length{all}[6] 0.137130 0.014460 0.000016 0.375203 0.104790 1.000 2
length{all}[7] 0.098867 0.009994 0.000137 0.285324 0.064704 0.998 2
length{all}[8] 0.092039 0.009808 0.000112 0.311726 0.060385 1.001 2
length{all}[9] 0.085836 0.007524 0.000021 0.268716 0.057901 0.998 2
length{all}[10] 0.091565 0.007633 0.000075 0.262870 0.070745 0.998 2
length{all}[11] 0.097372 0.010297 0.000015 0.301550 0.062812 0.998 2
length{all}[12] 0.091963 0.009102 0.000070 0.251251 0.059802 0.998 2
length{all}[13] 0.093865 0.009792 0.000179 0.302146 0.067379 1.003 2
length{all}[14] 0.090819 0.007877 0.000682 0.258783 0.063145 0.998 2
length{all}[15] 0.092683 0.008103 0.000226 0.278142 0.067213 0.998 2
length{all}[16] 0.099323 0.012720 0.000291 0.283149 0.065182 0.998 2
length{all}[17] 0.094739 0.009753 0.000387 0.301021 0.060114 0.998 2
length{all}[18] 0.092297 0.008132 0.000321 0.273232 0.064928 0.999 2
length{all}[19] 0.096213 0.009729 0.000381 0.281811 0.068417 0.998 2
length{all}[20] 0.099131 0.010246 0.000230 0.310085 0.066943 0.998 2
length{all}[21] 0.096680 0.008876 0.000348 0.269475 0.071042 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007537
Maximum standard deviation of split frequencies = 0.020257
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------- C1 (1)
|
|----------------------------------------- C2 (2)
|
|------------------------------------------- C3 (3)
+
|-------------------------------------------- C4 (4)
|
|----------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 411
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 51 patterns at 137 / 137 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 51 patterns at 137 / 137 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
49776 bytes for conP
4488 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.109927 0.098782 0.063491 0.055332 0.038598 0.046058 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -597.354064
Iterating by ming2
Initial: fx= 597.354064
x= 0.10993 0.09878 0.06349 0.05533 0.03860 0.04606 0.30000 1.30000
1 h-m-p 0.0000 0.0003 320.6559 +++ 568.374863 m 0.0003 14 | 1/8
2 h-m-p 0.0000 0.0000 2189.3738 ++ 559.229064 m 0.0000 25 | 2/8
3 h-m-p 0.0000 0.0002 87.9998 ++ 555.896160 m 0.0002 36 | 3/8
4 h-m-p 0.0001 0.0005 99.5972 ++ 546.158723 m 0.0005 47 | 4/8
5 h-m-p 0.0000 0.0001 209.4144 ++ 544.540265 m 0.0001 58 | 5/8
6 h-m-p 0.0088 0.6645 0.4531 ++++ 544.384255 m 0.6645 71 | 6/8
7 h-m-p 0.6164 8.0000 0.1237 +CCC 544.366477 2 3.0927 90 | 6/8
8 h-m-p 1.3843 8.0000 0.2763 +YCCC 544.323097 3 4.3057 109 | 6/8
9 h-m-p 1.6000 8.0000 0.4025 YCCC 544.301268 3 3.1379 127 | 6/8
10 h-m-p 1.6000 8.0000 0.5868 +YCCC 544.285851 3 4.1383 146 | 6/8
11 h-m-p 1.6000 8.0000 1.0297 YC 544.275796 1 2.7512 160 | 6/8
12 h-m-p 1.6000 8.0000 1.3940 +YC 544.268618 1 4.2396 173 | 6/8
13 h-m-p 1.6000 8.0000 2.2040 CC 544.264406 1 2.5270 186 | 6/8
14 h-m-p 1.6000 8.0000 3.0259 +YC 544.260996 1 4.8077 199 | 6/8
15 h-m-p 1.6000 8.0000 5.0170 CC 544.259199 1 2.3050 212 | 6/8
16 h-m-p 1.6000 8.0000 6.6211 +CC 544.257616 1 5.3470 226 | 6/8
17 h-m-p 1.6000 8.0000 11.6247 CC 544.256852 1 2.1938 239 | 6/8
18 h-m-p 1.6000 8.0000 14.8469 +CC 544.256148 1 5.7024 253 | 6/8
19 h-m-p 1.6000 8.0000 26.5698 CC 544.255825 1 2.1227 266 | 6/8
20 h-m-p 1.6000 8.0000 33.6678 +C 544.255514 0 6.1850 278 | 6/8
21 h-m-p 1.6000 8.0000 60.3844 C 544.255377 0 2.0207 289 | 6/8
22 h-m-p 1.1105 5.5526 75.5910 ++ 544.255246 m 5.5526 300 | 7/8
23 h-m-p 1.6000 8.0000 0.0000 YC 544.255230 1 0.9986 312 | 7/8
24 h-m-p 1.6000 8.0000 0.0000 -----------C 544.255230 0 0.0000 335
Out..
lnL = -544.255230
336 lfun, 336 eigenQcodon, 2016 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.067517 0.028291 0.068506 0.075567 0.059555 0.093600 0.000100 0.666881 0.482411
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.865268
np = 9
lnL0 = -592.758021
Iterating by ming2
Initial: fx= 592.758021
x= 0.06752 0.02829 0.06851 0.07557 0.05955 0.09360 0.00011 0.66688 0.48241
1 h-m-p 0.0000 0.0000 310.6135 ++ 592.420006 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0003 412.8533 +++ 565.954819 m 0.0003 27 | 2/9
3 h-m-p 0.0000 0.0002 393.8421 ++ 549.512171 m 0.0002 39 | 3/9
4 h-m-p 0.0001 0.0003 182.4623 ++ 546.389896 m 0.0003 51 | 4/9
5 h-m-p 0.0000 0.0000 10540.6392 ++ 546.147369 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 2123.0009 ++ 545.320848 m 0.0000 75 | 6/9
7 h-m-p 0.0171 0.2559 1.2875 +YCYYCCC 544.747699 6 0.1451 98 | 6/9
8 h-m-p 0.2047 1.0235 0.6808 CYCCC 544.583452 4 0.3467 117 | 6/9
9 h-m-p 0.4672 2.3361 0.2738 YYCC 544.507472 3 0.6579 136 | 6/9
10 h-m-p 0.4595 2.2976 0.1947 ++ 544.427744 m 2.2976 151 | 7/9
11 h-m-p 0.0623 0.3113 0.5739 C 544.427671 0 0.0179 166 | 7/9
12 h-m-p 1.6000 8.0000 0.0001 Y 544.427671 0 1.1627 180 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 ----C 544.427671 0 0.0016 198 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 ---------Y 544.427671 0 0.0000 221
Out..
lnL = -544.427671
222 lfun, 666 eigenQcodon, 2664 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.063378 0.073237 0.029769 0.016473 0.089581 0.101372 0.000100 1.505827 0.491411 0.413327 1178.019125
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.075653
np = 11
lnL0 = -561.293758
Iterating by ming2
Initial: fx= 561.293758
x= 0.06338 0.07324 0.02977 0.01647 0.08958 0.10137 0.00011 1.50583 0.49141 0.41333 951.42857
1 h-m-p 0.0000 0.0000 47.0544 ++ 561.187094 m 0.0000 16 | 1/11
2 h-m-p 0.0002 0.0154 13.8902 ++++ 558.695783 m 0.0154 32 | 2/11
3 h-m-p 0.0005 0.0025 20.0794 ++ 557.113908 m 0.0025 46 | 3/11
4 h-m-p 0.0017 0.0243 28.8066 +CYYYYCYCCC 552.672722 10 0.0214 76 | 3/11
5 h-m-p 0.0043 0.0216 15.9899 ++ 549.879195 m 0.0216 90 | 4/11
6 h-m-p 0.0002 0.0012 71.2734 ++ 548.076114 m 0.0012 104 | 5/11
7 h-m-p 0.0000 0.0002 1322.2637 ++ 546.613991 m 0.0002 118 | 6/11
8 h-m-p 0.1038 0.5190 0.7780 +YYYYCYYCCC 544.362368 9 0.4581 146 | 6/11
9 h-m-p 0.4009 2.0047 0.1109 YC 544.361861 1 0.0701 166 | 6/11
10 h-m-p 0.0382 8.0000 0.2034 ++++ 544.284599 m 8.0000 187 | 6/11
11 h-m-p 1.6000 8.0000 0.3193 CC 544.277573 1 1.6312 208 | 6/11
12 h-m-p 1.6000 8.0000 0.3120 YCCC 544.272408 3 2.8231 232 | 6/11
13 h-m-p 1.6000 8.0000 0.1923 C 544.271666 0 1.6000 251 | 6/11
14 h-m-p 1.6000 8.0000 0.0804 +YC 544.271202 1 5.3054 272 | 6/11
15 h-m-p 1.6000 8.0000 0.0610 ++ 544.268918 m 8.0000 291 | 6/11
16 h-m-p 0.4911 2.4554 0.8056 ++ 544.262073 m 2.4554 310 | 7/11
17 h-m-p 1.6000 8.0000 0.9061 YCC 544.257424 2 2.5209 332 | 7/11
18 h-m-p 1.6000 8.0000 0.5484 YC 544.256147 1 2.8921 351 | 7/11
19 h-m-p 1.6000 8.0000 0.6728 YC 544.255582 1 3.0878 370 | 7/11
20 h-m-p 1.6000 8.0000 0.6977 CC 544.255378 1 2.2241 390 | 7/11
21 h-m-p 1.6000 8.0000 0.7021 YC 544.255289 1 3.2138 409 | 7/11
22 h-m-p 1.6000 8.0000 0.6872 C 544.255260 0 2.1581 427 | 7/11
23 h-m-p 1.6000 8.0000 0.6529 Y 544.255248 0 3.1359 445 | 7/11
24 h-m-p 1.6000 8.0000 0.6859 C 544.255243 0 2.2135 463 | 7/11
25 h-m-p 1.6000 8.0000 0.6656 Y 544.255241 0 2.9542 481 | 7/11
26 h-m-p 1.6000 8.0000 0.6922 C 544.255240 0 2.3270 499 | 7/11
27 h-m-p 1.6000 8.0000 0.6557 Y 544.255240 0 2.6698 517 | 7/11
28 h-m-p 1.6000 8.0000 0.7170 Y 544.255240 0 2.7161 535 | 7/11
29 h-m-p 1.6000 8.0000 0.6196 C 544.255240 0 2.0630 553 | 7/11
30 h-m-p 1.6000 8.0000 0.7592 +Y 544.255239 0 4.4930 572 | 7/11
31 h-m-p 1.6000 8.0000 0.4820 Y 544.255239 0 1.2234 590 | 7/11
32 h-m-p 0.8790 8.0000 0.6708 +Y 544.255239 0 2.7992 609 | 7/11
33 h-m-p 1.6000 8.0000 0.7919 Y 544.255239 0 3.4914 627 | 7/11
34 h-m-p 1.6000 8.0000 0.1980 C 544.255239 0 0.6169 645 | 7/11
35 h-m-p 0.1338 8.0000 0.9130 +Y 544.255239 0 0.3725 664 | 7/11
36 h-m-p 0.4888 8.0000 0.6956 Y 544.255239 0 0.2146 682 | 7/11
37 h-m-p 0.0692 8.0000 2.1586 +C 544.255239 0 0.2663 701 | 7/11
38 h-m-p 0.9820 8.0000 0.5853 ---C 544.255239 0 0.0038 718 | 7/11
39 h-m-p 0.3110 8.0000 0.0072 -------C 544.255239 0 0.0000 743 | 7/11
40 h-m-p 0.1167 8.0000 0.0000 -----Y 544.255239 0 0.0000 766
Out..
lnL = -544.255239
767 lfun, 3068 eigenQcodon, 13806 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -549.197195 S = -547.758368 -2.367384
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:05
did 20 / 51 patterns 0:05
did 30 / 51 patterns 0:05
did 40 / 51 patterns 0:05
did 50 / 51 patterns 0:05
did 51 / 51 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.034481 0.085111 0.082885 0.083330 0.051385 0.053250 0.000100 0.735468 1.252735
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.840281
np = 9
lnL0 = -590.997857
Iterating by ming2
Initial: fx= 590.997857
x= 0.03448 0.08511 0.08288 0.08333 0.05139 0.05325 0.00011 0.73547 1.25274
1 h-m-p 0.0000 0.0000 282.9873 ++ 590.837797 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0003 203.0580 ++CYCYYYYYYY 584.667823 10 0.0002 39 | 1/9
3 h-m-p 0.0010 0.0108 51.2871 ++ 562.733202 m 0.0108 51 | 2/9
4 h-m-p 0.0001 0.0004 110.6429 ++ 556.477327 m 0.0004 63 | 3/9
5 h-m-p 0.0003 0.0014 101.1020 +YYYYYCCCCC 552.214329 9 0.0011 89 | 3/9
6 h-m-p 0.0189 0.0946 3.3524 -------------.. | 3/9
7 h-m-p 0.0000 0.0001 230.8762 ++ 546.993516 m 0.0001 124 | 4/9
8 h-m-p 0.0000 0.0000 8142.7031 ++ 546.884486 m 0.0000 136 | 5/9
9 h-m-p 0.0000 0.0000 17721.1394 ++ 546.686440 m 0.0000 148 | 6/9
10 h-m-p 0.0004 0.0601 0.8376 +++YCCC 546.590598 3 0.0198 168 | 6/9
11 h-m-p 0.0168 1.2836 0.9923 ++++ 544.454534 m 1.2836 185 | 7/9
12 h-m-p 1.6000 8.0000 0.0009 YYC 544.445282 2 1.1523 202 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 ++ 544.445267 m 8.0000 216 | 7/9
14 h-m-p 0.3508 8.0000 0.0010 +++ 544.444632 m 8.0000 231 | 7/9
15 h-m-p 0.7963 6.9460 0.0103 ----------------.. | 7/9
16 h-m-p 0.0160 8.0000 4.3709 ---CC 544.444131 1 0.0001 278 | 7/9
17 h-m-p 0.0160 8.0000 0.2438 ++++C 544.427675 0 4.0960 294 | 7/9
18 h-m-p 1.6000 8.0000 0.0000 Y 544.427672 0 1.0402 308 | 7/9
19 h-m-p 1.6000 8.0000 0.0000 -------Y 544.427672 0 0.0000 329
Out..
lnL = -544.427672
330 lfun, 3630 eigenQcodon, 19800 P(t)
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.026454 0.105391 0.096776 0.056942 0.066323 0.073065 0.000100 0.900000 0.891073 1.741265 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.105908
np = 11
lnL0 = -558.986259
Iterating by ming2
Initial: fx= 558.986259
x= 0.02645 0.10539 0.09678 0.05694 0.06632 0.07307 0.00011 0.90000 0.89107 1.74126 951.42857
1 h-m-p 0.0000 0.0011 94.6111 +++YYCYYYYYYY 548.297282 10 0.0010 30 | 0/11
2 h-m-p 0.0001 0.0004 18.0777 ++ 548.176677 m 0.0004 44 | 1/11
3 h-m-p 0.0004 0.0044 19.7881 ++ 547.507538 m 0.0044 58 | 2/11
4 h-m-p 0.0030 0.0149 4.7395 ++ 546.493137 m 0.0149 72 | 3/11
5 h-m-p 0.0012 0.0062 2.0781 ++ 546.387697 m 0.0062 86 | 4/11
6 h-m-p 0.0010 0.0049 5.8995 ++ 546.059221 m 0.0049 100 | 5/11
7 h-m-p 0.0848 1.8785 0.2340 --------------.. | 5/11
8 h-m-p 0.0000 0.0001 84.2674 +YYYCC 545.898343 4 0.0000 152 | 5/11
9 h-m-p 0.0002 0.0008 14.4420 ++ 545.687100 m 0.0008 166 | 6/11
10 h-m-p 0.0096 2.4083 0.3966 -------------.. | 6/11
11 h-m-p 0.0001 0.0320 6.2985 C 545.685864 0 0.0001 210 | 6/11
12 h-m-p 0.0000 0.0111 15.0487 ++++YYYCYYYYC 545.033564 8 0.0088 237 | 6/11
13 h-m-p 0.0910 0.4551 0.1012 CYCCC 544.991165 4 0.1728 258 | 6/11
14 h-m-p 0.0326 0.1630 0.0834 ++ 544.727620 m 0.1630 277 | 6/11
15 h-m-p 0.0367 8.0000 0.3703 +YYC 544.704560 2 0.1887 299 | 6/11
16 h-m-p 0.0138 0.0689 0.6870 ++ 544.682716 m 0.0689 318 | 7/11
17 h-m-p 0.1178 8.0000 0.4018 +YCCC 544.621453 3 0.9653 343 | 6/11
18 h-m-p 0.0000 0.0000 268106.6217 CCCC 544.587368 3 0.0000 367 | 6/11
19 h-m-p 0.4978 2.4889 0.1074 ++ 544.507136 m 2.4889 381 | 7/11
20 h-m-p 0.5086 3.1192 0.5258 YCCC 544.479764 3 1.1903 405 | 6/11
21 h-m-p 0.0000 0.0000 101450.0743 YCCC 544.476280 3 0.0000 428 | 6/11
22 h-m-p 0.0481 0.2406 0.5426 ++ 544.450750 m 0.2406 442 | 7/11
23 h-m-p 0.0136 0.0681 6.1564 YCCC 544.439435 3 0.0252 466 | 7/11
24 h-m-p 0.0408 0.2040 1.4400 +
QuantileBeta(0.85, 3.18183, 0.00500) = 1.000000e+00 2000 rounds
+ 544.429332 m 0.2040 480
QuantileBeta(0.85, 3.18183, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.18183, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.18183, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.18183, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.18183, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.18183, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.18183, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.18183, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.18183, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.18183, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.18183, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
25 h-m-p 1.6000 8.0000 0.0159
QuantileBeta(0.85, 3.15641, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.08017, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16662, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 3.16693, 0.00500) = 1.000000e+00 2000 rounds
C 544.428664 1 0.9380 495
QuantileBeta(0.85, 3.16693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16707, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16678, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16693, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16693, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
26 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.85, 3.16712, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16770, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
Y 544.428664 0 1.1018 512
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16721, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16692, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
27 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 3.16705, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
N 544.428664 0 0.0000 538
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -544.428664
539 lfun, 6468 eigenQcodon, 35574 P(t)
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -544.966325 S = -541.348237 -3.087290
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:20
did 20 / 51 patterns 0:20
did 30 / 51 patterns 0:20
did 40 / 51 patterns 0:21
did 50 / 51 patterns 0:21
did 51 / 51 patterns 0:21
QuantileBeta(0.85, 3.16706, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:21
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=137
NC_011896_1_WP_010908540_1_1918_MLBR_RS09100 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
NC_002677_1_NP_302219_1_1091_ML1796 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
NZ_LVXE01000020_1_WP_010908540_1_870_A3216_RS07230 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
NZ_LYPH01000025_1_WP_010908540_1_1026_A8144_RS04885 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
NZ_CP029543_1_WP_010908540_1_1947_DIJ64_RS09915 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
NZ_AP014567_1_WP_119607989_1_1996_JK2ML_RS10160 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN
**************************************************
NC_011896_1_WP_010908540_1_1918_MLBR_RS09100 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
NC_002677_1_NP_302219_1_1091_ML1796 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
NZ_LVXE01000020_1_WP_010908540_1_870_A3216_RS07230 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
NZ_LYPH01000025_1_WP_010908540_1_1026_A8144_RS04885 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
NZ_CP029543_1_WP_010908540_1_1947_DIJ64_RS09915 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG
NZ_AP014567_1_WP_119607989_1_1996_JK2ML_RS10160 VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTENRAG
*********************************************:****
NC_011896_1_WP_010908540_1_1918_MLBR_RS09100 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
NC_002677_1_NP_302219_1_1091_ML1796 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
NZ_LVXE01000020_1_WP_010908540_1_870_A3216_RS07230 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
NZ_LYPH01000025_1_WP_010908540_1_1026_A8144_RS04885 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
NZ_CP029543_1_WP_010908540_1_1947_DIJ64_RS09915 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
NZ_AP014567_1_WP_119607989_1_1996_JK2ML_RS10160 IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
*************************************
>NC_011896_1_WP_010908540_1_1918_MLBR_RS09100 ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCCAAAACCGAGCGGGA ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG CTGCGGCTGGC >NC_002677_1_NP_302219_1_1091_ML1796 ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCCAAAACCGAGCGGGA ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG CTGCGGCTGGC >NZ_LVXE01000020_1_WP_010908540_1_870_A3216_RS07230 ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCCAAAACCGAGCGGGA ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG CTGCGGCTGGC >NZ_LYPH01000025_1_WP_010908540_1_1026_A8144_RS04885 ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCCAAAACCGAGCGGGA ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG CTGCGGCTGGC >NZ_CP029543_1_WP_010908540_1_1947_DIJ64_RS09915 ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCCAAAACCGAGCGGGA ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG CTGCGGCTGGC >NZ_AP014567_1_WP_119607989_1_1996_JK2ML_RS10160 ATGTCGTCCCTAACTACCGACCTGATGCTCACCCACAGGCACCTCAACGA CCGCGGTCAAGTAGCGGCCACCATTGACGAAATCCTGAACACACATAAGT TATTCAGCACCCGTCACCGGATTATCGACACCAGCGAAAATGTGGACAAC GTCATCGTAATTGCTGATCAGCTGTTCGACGACCGAGGAGCAACGATCGG AACGTATGATTTCTACATCGATGTTTCGGCCCTACCGGAACAAGTGCACG AGGGCATCGTCATAGCGAGACTAGCCAAGAGCACCGAAAACCGAGCGGGA ATCGAGCAGACCAAGAGCATGTTGATGCTGATCGATGGTATAACCTACGA CACCCCGTTCAACCTGCTCAAATACGCTGTCCCAGGAAACCAACATCAAG CTGCGGCTGGC
>NC_011896_1_WP_010908540_1_1918_MLBR_RS09100 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG >NC_002677_1_NP_302219_1_1091_ML1796 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG >NZ_LVXE01000020_1_WP_010908540_1_870_A3216_RS07230 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG >NZ_LYPH01000025_1_WP_010908540_1_1026_A8144_RS04885 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG >NZ_CP029543_1_WP_010908540_1_1947_DIJ64_RS09915 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTQNRAG IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG >NZ_AP014567_1_WP_119607989_1_1996_JK2ML_RS10160 MSSLTTDLMLTHRHLNDRGQVAATIDEILNTHKLFSTRHRIIDTSENVDN VIVIADQLFDDRGATIGTYDFYIDVSALPEQVHEGIVIARLAKSTENRAG IEQTKSMLMLIDGITYDTPFNLLKYAVPGNQHQAAAG
#NEXUS
[ID: 5565402287]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908540_1_1918_MLBR_RS09100
NC_002677_1_NP_302219_1_1091_ML1796
NZ_LVXE01000020_1_WP_010908540_1_870_A3216_RS07230
NZ_LYPH01000025_1_WP_010908540_1_1026_A8144_RS04885
NZ_CP029543_1_WP_010908540_1_1947_DIJ64_RS09915
NZ_AP014567_1_WP_119607989_1_1996_JK2ML_RS10160
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908540_1_1918_MLBR_RS09100,
2 NC_002677_1_NP_302219_1_1091_ML1796,
3 NZ_LVXE01000020_1_WP_010908540_1_870_A3216_RS07230,
4 NZ_LYPH01000025_1_WP_010908540_1_1026_A8144_RS04885,
5 NZ_CP029543_1_WP_010908540_1_1947_DIJ64_RS09915,
6 NZ_AP014567_1_WP_119607989_1_1996_JK2ML_RS10160
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0600843,2:0.05971052,3:0.0632293,4:0.06421149,5:0.06012268,6:0.1047905);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0600843,2:0.05971052,3:0.0632293,4:0.06421149,5:0.06012268,6:0.1047905);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -575.71 -579.96
2 -575.54 -579.27
--------------------------------------
TOTAL -575.62 -579.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1796/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.872374 0.089171 0.333549 1.460786 0.837809 1384.70 1398.59 1.000
r(A<->C){all} 0.131734 0.015087 0.000129 0.396826 0.095132 180.80 258.65 1.001
r(A<->G){all} 0.171518 0.020103 0.000036 0.459507 0.134820 129.01 188.81 1.010
r(A<->T){all} 0.158093 0.019537 0.000112 0.443362 0.114838 198.22 245.63 1.001
r(C<->G){all} 0.228255 0.029763 0.000026 0.564118 0.190702 131.19 171.50 1.020
r(C<->T){all} 0.142863 0.016044 0.000010 0.401790 0.105873 189.81 244.26 1.002
r(G<->T){all} 0.167537 0.019543 0.000011 0.442787 0.133778 115.49 158.54 1.001
pi(A){all} 0.287759 0.000495 0.243239 0.328695 0.287397 1290.77 1395.89 1.000
pi(C){all} 0.298968 0.000523 0.254467 0.342288 0.298965 1184.74 1218.20 1.000
pi(G){all} 0.231859 0.000423 0.193587 0.273499 0.231004 1258.15 1341.52 1.000
pi(T){all} 0.181413 0.000365 0.143086 0.218639 0.180750 1029.24 1265.12 1.000
alpha{1,2} 0.325781 0.131832 0.000363 1.072983 0.212697 1121.87 1229.34 1.003
alpha{3} 0.405462 0.231152 0.000139 1.401608 0.233517 1237.14 1292.08 1.000
pinvar{all} 0.991464 0.000050 0.977720 0.999626 0.993428 1427.45 1434.62 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1796/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 137
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 1 1 1 1 1 1 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 1 1 1 1 1 1
CTC 3 3 3 3 3 3 | CCC 0 0 0 0 0 0 | CAC 4 4 4 4 4 4 | CGC 1 1 1 1 1 1
CTA 3 3 3 3 3 3 | CCA 1 1 1 1 1 1 | Gln CAA 5 5 5 5 5 4 | CGA 2 2 2 2 2 2
CTG 5 5 5 5 5 5 | CCG 2 2 2 2 2 2 | CAG 2 2 2 2 2 2 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 8 8 8 8 8 8 | ACC 9 9 9 9 9 9 | AAC 6 6 6 6 6 6 | AGC 4 4 4 4 4 4
ATA 2 2 2 2 2 2 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 1 1 1 1 1 1
Met ATG 4 4 4 4 4 4 | ACG 2 2 2 2 2 2 | AAG 3 3 3 3 3 3 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 4 4 4 4 4 4 | Asp GAT 4 4 4 4 4 4 | Gly GGT 2 2 2 2 2 2
GTC 3 3 3 3 3 3 | GCC 3 3 3 3 3 3 | GAC 8 8 8 8 8 8 | GGC 2 2 2 2 2 2
GTA 2 2 2 2 2 2 | GCA 1 1 1 1 1 1 | Glu GAA 3 3 3 3 3 4 | GGA 4 4 4 4 4 4
GTG 2 2 2 2 2 2 | GCG 4 4 4 4 4 4 | GAG 2 2 2 2 2 2 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908540_1_1918_MLBR_RS09100
position 1: T:0.09489 C:0.23358 A:0.34307 G:0.32847
position 2: T:0.30657 C:0.22628 A:0.32847 G:0.13869
position 3: T:0.14599 C:0.43066 A:0.19708 G:0.22628
Average T:0.18248 C:0.29684 A:0.28954 G:0.23114
#2: NC_002677_1_NP_302219_1_1091_ML1796
position 1: T:0.09489 C:0.23358 A:0.34307 G:0.32847
position 2: T:0.30657 C:0.22628 A:0.32847 G:0.13869
position 3: T:0.14599 C:0.43066 A:0.19708 G:0.22628
Average T:0.18248 C:0.29684 A:0.28954 G:0.23114
#3: NZ_LVXE01000020_1_WP_010908540_1_870_A3216_RS07230
position 1: T:0.09489 C:0.23358 A:0.34307 G:0.32847
position 2: T:0.30657 C:0.22628 A:0.32847 G:0.13869
position 3: T:0.14599 C:0.43066 A:0.19708 G:0.22628
Average T:0.18248 C:0.29684 A:0.28954 G:0.23114
#4: NZ_LYPH01000025_1_WP_010908540_1_1026_A8144_RS04885
position 1: T:0.09489 C:0.23358 A:0.34307 G:0.32847
position 2: T:0.30657 C:0.22628 A:0.32847 G:0.13869
position 3: T:0.14599 C:0.43066 A:0.19708 G:0.22628
Average T:0.18248 C:0.29684 A:0.28954 G:0.23114
#5: NZ_CP029543_1_WP_010908540_1_1947_DIJ64_RS09915
position 1: T:0.09489 C:0.23358 A:0.34307 G:0.32847
position 2: T:0.30657 C:0.22628 A:0.32847 G:0.13869
position 3: T:0.14599 C:0.43066 A:0.19708 G:0.22628
Average T:0.18248 C:0.29684 A:0.28954 G:0.23114
#6: NZ_AP014567_1_WP_119607989_1_1996_JK2ML_RS10160
position 1: T:0.09489 C:0.22628 A:0.34307 G:0.33577
position 2: T:0.30657 C:0.22628 A:0.32847 G:0.13869
position 3: T:0.14599 C:0.43066 A:0.19708 G:0.22628
Average T:0.18248 C:0.29440 A:0.28954 G:0.23358
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 24 | TCC 6 | TAC 18 | TGC 0
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 12 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 6
CTC 18 | CCC 0 | CAC 24 | CGC 6
CTA 18 | CCA 6 | Gln Q CAA 29 | CGA 12
CTG 30 | CCG 12 | CAG 12 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 0
ATC 48 | ACC 54 | AAC 36 | AGC 24
ATA 12 | ACA 6 | Lys K AAA 6 | Arg R AGA 6
Met M ATG 24 | ACG 12 | AAG 18 | AGG 6
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 24 | Asp D GAT 24 | Gly G GGT 12
GTC 18 | GCC 18 | GAC 48 | GGC 12
GTA 12 | GCA 6 | Glu E GAA 19 | GGA 24
GTG 12 | GCG 24 | GAG 12 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09489 C:0.23236 A:0.34307 G:0.32968
position 2: T:0.30657 C:0.22628 A:0.32847 G:0.13869
position 3: T:0.14599 C:0.43066 A:0.19708 G:0.22628
Average T:0.18248 C:0.29643 A:0.28954 G:0.23155
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -544.255230 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.007313 0.000100 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.007333
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.007313);
(NC_011896_1_WP_010908540_1_1918_MLBR_RS09100: 0.000004, NC_002677_1_NP_302219_1_1091_ML1796: 0.000004, NZ_LVXE01000020_1_WP_010908540_1_870_A3216_RS07230: 0.000004, NZ_LYPH01000025_1_WP_010908540_1_1026_A8144_RS04885: 0.000004, NZ_CP029543_1_WP_010908540_1_1947_DIJ64_RS09915: 0.000004, NZ_AP014567_1_WP_119607989_1_1996_JK2ML_RS10160: 0.007313);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 342.8 68.2 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 342.8 68.2 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 342.8 68.2 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 342.8 68.2 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 342.8 68.2 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.007 342.8 68.2 999.0000 0.0029 0.0000 1.0 0.0
tree length for dN: 0.0029
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -544.427671 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.007376 0.000100 0.831718 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.007396
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.007376);
(NC_011896_1_WP_010908540_1_1918_MLBR_RS09100: 0.000004, NC_002677_1_NP_302219_1_1091_ML1796: 0.000004, NZ_LVXE01000020_1_WP_010908540_1_870_A3216_RS07230: 0.000004, NZ_LYPH01000025_1_WP_010908540_1_1026_A8144_RS04885: 0.000004, NZ_CP029543_1_WP_010908540_1_1947_DIJ64_RS09915: 0.000004, NZ_AP014567_1_WP_119607989_1_1996_JK2ML_RS10160: 0.007376);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.83172 0.16828
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 342.8 68.2 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 342.8 68.2 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 342.8 68.2 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 342.8 68.2 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 342.8 68.2 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.007 342.8 68.2 1.0000 0.0025 0.0025 0.8 0.2
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -544.255239 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.007314 0.000100 0.000000 0.000000 1.000000 951.432172
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.007334
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.007314);
(NC_011896_1_WP_010908540_1_1918_MLBR_RS09100: 0.000004, NC_002677_1_NP_302219_1_1091_ML1796: 0.000004, NZ_LVXE01000020_1_WP_010908540_1_870_A3216_RS07230: 0.000004, NZ_LYPH01000025_1_WP_010908540_1_1026_A8144_RS04885: 0.000004, NZ_CP029543_1_WP_010908540_1_1947_DIJ64_RS09915: 0.000004, NZ_AP014567_1_WP_119607989_1_1996_JK2ML_RS10160: 0.007314);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 951.43217
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 342.8 68.2 951.4321 0.0000 0.0000 0.0 0.0
7..2 0.000 342.8 68.2 951.4321 0.0000 0.0000 0.0 0.0
7..3 0.000 342.8 68.2 951.4321 0.0000 0.0000 0.0 0.0
7..4 0.000 342.8 68.2 951.4321 0.0000 0.0000 0.0 0.0
7..5 0.000 342.8 68.2 951.4321 0.0000 0.0000 0.0 0.0
7..6 0.007 342.8 68.2 951.4321 0.0029 0.0000 1.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908540_1_1918_MLBR_RS09100)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.432
2 S 1.000** 951.432
3 S 1.000** 951.432
4 L 1.000** 951.432
5 T 1.000** 951.432
6 T 1.000** 951.432
7 D 1.000** 951.432
8 L 1.000** 951.432
9 M 1.000** 951.432
10 L 1.000** 951.432
11 T 1.000** 951.432
12 H 1.000** 951.432
13 R 1.000** 951.432
14 H 1.000** 951.432
15 L 1.000** 951.432
16 N 1.000** 951.432
17 D 1.000** 951.432
18 R 1.000** 951.432
19 G 1.000** 951.432
20 Q 1.000** 951.432
21 V 1.000** 951.432
22 A 1.000** 951.432
23 A 1.000** 951.432
24 T 1.000** 951.432
25 I 1.000** 951.432
26 D 1.000** 951.432
27 E 1.000** 951.432
28 I 1.000** 951.432
29 L 1.000** 951.432
30 N 1.000** 951.432
31 T 1.000** 951.432
32 H 1.000** 951.432
33 K 1.000** 951.432
34 L 1.000** 951.432
35 F 1.000** 951.432
36 S 1.000** 951.432
37 T 1.000** 951.432
38 R 1.000** 951.432
39 H 1.000** 951.432
40 R 1.000** 951.432
41 I 1.000** 951.432
42 I 1.000** 951.432
43 D 1.000** 951.432
44 T 1.000** 951.432
45 S 1.000** 951.432
46 E 1.000** 951.432
47 N 1.000** 951.432
48 V 1.000** 951.432
49 D 1.000** 951.432
50 N 1.000** 951.432
51 V 1.000** 951.432
52 I 1.000** 951.432
53 V 1.000** 951.432
54 I 1.000** 951.432
55 A 1.000** 951.432
56 D 1.000** 951.432
57 Q 1.000** 951.432
58 L 1.000** 951.432
59 F 1.000** 951.432
60 D 1.000** 951.432
61 D 1.000** 951.432
62 R 1.000** 951.432
63 G 1.000** 951.432
64 A 1.000** 951.432
65 T 1.000** 951.432
66 I 1.000** 951.432
67 G 1.000** 951.432
68 T 1.000** 951.432
69 Y 1.000** 951.432
70 D 1.000** 951.432
71 F 1.000** 951.432
72 Y 1.000** 951.432
73 I 1.000** 951.432
74 D 1.000** 951.432
75 V 1.000** 951.432
76 S 1.000** 951.432
77 A 1.000** 951.432
78 L 1.000** 951.432
79 P 1.000** 951.432
80 E 1.000** 951.432
81 Q 1.000** 951.432
82 V 1.000** 951.432
83 H 1.000** 951.432
84 E 1.000** 951.432
85 G 1.000** 951.432
86 I 1.000** 951.432
87 V 1.000** 951.432
88 I 1.000** 951.432
89 A 1.000** 951.432
90 R 1.000** 951.432
91 L 1.000** 951.432
92 A 1.000** 951.432
93 K 1.000** 951.432
94 S 1.000** 951.432
95 T 1.000** 951.432
96 Q 1.000** 951.432
97 N 1.000** 951.432
98 R 1.000** 951.432
99 A 1.000** 951.432
100 G 1.000** 951.432
101 I 1.000** 951.432
102 E 1.000** 951.432
103 Q 1.000** 951.432
104 T 1.000** 951.432
105 K 1.000** 951.432
106 S 1.000** 951.432
107 M 1.000** 951.432
108 L 1.000** 951.432
109 M 1.000** 951.432
110 L 1.000** 951.432
111 I 1.000** 951.432
112 D 1.000** 951.432
113 G 1.000** 951.432
114 I 1.000** 951.432
115 T 1.000** 951.432
116 Y 1.000** 951.432
117 D 1.000** 951.432
118 T 1.000** 951.432
119 P 1.000** 951.432
120 F 1.000** 951.432
121 N 1.000** 951.432
122 L 1.000** 951.432
123 L 1.000** 951.432
124 K 1.000** 951.432
125 Y 1.000** 951.432
126 A 1.000** 951.432
127 V 1.000** 951.432
128 P 1.000** 951.432
129 G 1.000** 951.432
130 N 1.000** 951.432
131 Q 1.000** 951.432
132 H 1.000** 951.432
133 Q 1.000** 951.432
134 A 1.000** 951.432
135 A 1.000** 951.432
136 A 1.000** 951.432
137 G 1.000** 951.432
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908540_1_1918_MLBR_RS09100)
Pr(w>1) post mean +- SE for w
96 Q 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -544.427672 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.007376 0.000100 1.075572 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.007396
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.007376);
(NC_011896_1_WP_010908540_1_1918_MLBR_RS09100: 0.000004, NC_002677_1_NP_302219_1_1091_ML1796: 0.000004, NZ_LVXE01000020_1_WP_010908540_1_870_A3216_RS07230: 0.000004, NZ_LYPH01000025_1_WP_010908540_1_1026_A8144_RS04885: 0.000004, NZ_CP029543_1_WP_010908540_1_1947_DIJ64_RS09915: 0.000004, NZ_AP014567_1_WP_119607989_1_1996_JK2ML_RS10160: 0.007376);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 1.07557 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99997 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 342.8 68.2 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 342.8 68.2 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 342.8 68.2 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 342.8 68.2 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 342.8 68.2 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.007 342.8 68.2 1.0000 0.0025 0.0025 0.8 0.2
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -544.428664 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.007431 0.000100 0.999990 3.167062 0.005000 951.432436
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.007451
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.007431);
(NC_011896_1_WP_010908540_1_1918_MLBR_RS09100: 0.000004, NC_002677_1_NP_302219_1_1091_ML1796: 0.000004, NZ_LVXE01000020_1_WP_010908540_1_870_A3216_RS07230: 0.000004, NZ_LYPH01000025_1_WP_010908540_1_1026_A8144_RS04885: 0.000004, NZ_CP029543_1_WP_010908540_1_1947_DIJ64_RS09915: 0.000004, NZ_AP014567_1_WP_119607989_1_1996_JK2ML_RS10160: 0.007431);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 3.16706 q = 0.00500
(p1 = 0.00001) w = 951.43244
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 951.43244
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 342.8 68.2 1.0095 0.0000 0.0000 0.0 0.0
7..2 0.000 342.8 68.2 1.0095 0.0000 0.0000 0.0 0.0
7..3 0.000 342.8 68.2 1.0095 0.0000 0.0000 0.0 0.0
7..4 0.000 342.8 68.2 1.0095 0.0000 0.0000 0.0 0.0
7..5 0.000 342.8 68.2 1.0095 0.0000 0.0000 0.0 0.0
7..6 0.007 342.8 68.2 1.0095 0.0025 0.0025 0.9 0.2
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908540_1_1918_MLBR_RS09100)
Pr(w>1) post mean +- SE for w
96 Q 0.754 3.930 +- 3.004
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.047 0.054 0.062 0.072 0.085 0.102 0.122 0.143 0.160 0.151
p : 0.098 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.162 0.154 0.135 0.115 0.098 0.085 0.074 0.066 0.059 0.053
Time used: 0:21
Model 1: NearlyNeutral -544.427671 Model 2: PositiveSelection -544.255239 Model 0: one-ratio -544.25523 Model 7: beta -544.427672 Model 8: beta&w>1 -544.428664 Model 0 vs 1 0.34488200000009783 Model 2 vs 1 0.3448640000001433 Model 8 vs 7 0.0019839999999931024
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
