--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:48:36 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/7res/ML1812/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/7res/ML1812/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1812/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/7res/ML1812/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1944.10 -1947.72 2 -1944.09 -1947.43 -------------------------------------- TOTAL -1944.10 -1947.59 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/7res/ML1812/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1812/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/7res/ML1812/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.909424 0.092869 0.338192 1.466898 0.876597 1499.37 1500.19 1.000 r(A<->C){all} 0.163630 0.018630 0.000051 0.433801 0.134179 124.26 215.21 1.003 r(A<->G){all} 0.179353 0.021066 0.000050 0.474028 0.143383 116.27 152.26 1.001 r(A<->T){all} 0.164806 0.019688 0.000021 0.459153 0.128540 285.90 368.38 1.002 r(C<->G){all} 0.168234 0.019699 0.000044 0.449578 0.129914 213.18 233.18 1.001 r(C<->T){all} 0.163021 0.018770 0.000008 0.433913 0.125648 206.48 226.94 1.006 r(G<->T){all} 0.160956 0.018721 0.000089 0.439185 0.125250 191.60 235.88 1.000 pi(A){all} 0.196347 0.000109 0.177053 0.217316 0.196285 1317.57 1409.28 1.000 pi(C){all} 0.299262 0.000141 0.275654 0.321912 0.298974 1192.57 1235.53 1.000 pi(G){all} 0.328867 0.000155 0.304622 0.352665 0.328635 1072.92 1238.64 1.000 pi(T){all} 0.175525 0.000101 0.157112 0.195754 0.175039 1163.85 1321.09 1.000 alpha{1,2} 0.410044 0.208880 0.000140 1.366661 0.245916 939.45 1060.08 1.001 alpha{3} 0.469910 0.248459 0.000228 1.442671 0.308962 1226.75 1257.17 1.000 pinvar{all} 0.998934 0.000002 0.996716 0.999999 0.999321 1053.84 1140.87 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1886.768787 Model 2: PositiveSelection -1886.768662 Model 0: one-ratio -1886.768663 Model 7: beta -1886.768858 Model 8: beta&w>1 -1886.768662 Model 0 vs 1 2.4799999982860754E-4 Model 2 vs 1 2.500000000509317E-4 Model 8 vs 7 3.9199999991978984E-4
>C1 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML EAPDIGLRVRVAPVRTSGMTPYVVRYIEY >C2 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML EAPDIGLRVRVAPVRTSGMTPYVVRYIEY >C3 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML EAPDIGLRVRVAPVRTSGMTPYVVRYIEY >C4 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML EAPDIGLRVRVAPVRTSGMTPYVVRYIEY >C5 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML EAPDIGLRVRVAPVRTSGMTPYVVRYIEY >C6 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML EAPDIGLRVRVAPVRTSGMTPYVVRYIEY CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=479 C1 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI C2 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI C3 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI C4 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI C5 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI C6 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI ************************************************** C1 ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ C2 ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ C3 ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ C4 ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ C5 ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ C6 ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ ************************************************** C1 SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART C2 SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART C3 SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART C4 SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART C5 SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART C6 SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART ************************************************** C1 LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA C2 LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA C3 LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA C4 LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA C5 LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA C6 LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA ************************************************** C1 LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP C2 LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP C3 LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP C4 LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP C5 LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP C6 LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP ************************************************** C1 FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY C2 FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY C3 FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY C4 FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY C5 FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY C6 FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY ************************************************** C1 AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS C2 AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS C3 AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS C4 AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS C5 AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS C6 AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS ************************************************** C1 EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG C2 EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG C3 EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG C4 EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG C5 EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG C6 EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG ************************************************** C1 VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML C2 VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML C3 VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML C4 VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML C5 VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML C6 VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML ************************************************** C1 EAPDIGLRVRVAPVRTSGMTPYVVRYIEY C2 EAPDIGLRVRVAPVRTSGMTPYVVRYIEY C3 EAPDIGLRVRVAPVRTSGMTPYVVRYIEY C4 EAPDIGLRVRVAPVRTSGMTPYVVRYIEY C5 EAPDIGLRVRVAPVRTSGMTPYVVRYIEY C6 EAPDIGLRVRVAPVRTSGMTPYVVRYIEY ***************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 479 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 479 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [14370] Library Relaxation: Multi_proc [96] Relaxation Summary: [14370]--->[14370] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.549 Mb, Max= 31.069 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI C2 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI C3 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI C4 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI C5 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI C6 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI ************************************************** C1 ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ C2 ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ C3 ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ C4 ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ C5 ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ C6 ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ ************************************************** C1 SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART C2 SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART C3 SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART C4 SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART C5 SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART C6 SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART ************************************************** C1 LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA C2 LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA C3 LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA C4 LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA C5 LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA C6 LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA ************************************************** C1 LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP C2 LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP C3 LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP C4 LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP C5 LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP C6 LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP ************************************************** C1 FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY C2 FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY C3 FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY C4 FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY C5 FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY C6 FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY ************************************************** C1 AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS C2 AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS C3 AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS C4 AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS C5 AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS C6 AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS ************************************************** C1 EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG C2 EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG C3 EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG C4 EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG C5 EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG C6 EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG ************************************************** C1 VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML C2 VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML C3 VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML C4 VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML C5 VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML C6 VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML ************************************************** C1 EAPDIGLRVRVAPVRTSGMTPYVVRYIEY C2 EAPDIGLRVRVAPVRTSGMTPYVVRYIEY C3 EAPDIGLRVRVAPVRTSGMTPYVVRYIEY C4 EAPDIGLRVRVAPVRTSGMTPYVVRYIEY C5 EAPDIGLRVRVAPVRTSGMTPYVVRYIEY C6 EAPDIGLRVRVAPVRTSGMTPYVVRYIEY ***************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAAACGGCCCCGCCGTGGCTCTGTTTCGCGACCGACCGCACGGTTTGT C2 ATGAAACGGCCCCGCCGTGGCTCTGTTTCGCGACCGACCGCACGGTTTGT C3 ATGAAACGGCCCCGCCGTGGCTCTGTTTCGCGACCGACCGCACGGTTTGT C4 ATGAAACGGCCCCGCCGTGGCTCTGTTTCGCGACCGACCGCACGGTTTGT C5 ATGAAACGGCCCCGCCGTGGCTCTGTTTCGCGACCGACCGCACGGTTTGT C6 ATGAAACGGCCCCGCCGTGGCTCTGTTTCGCGACCGACCGCACGGTTTGT ************************************************** C1 GCGGCCGGCCATTCCGTCACTCGTGAGTGCGGCCCTACTGGTATCCCTCC C2 GCGGCCGGCCATTCCGTCACTCGTGAGTGCGGCCCTACTGGTATCCCTCC C3 GCGGCCGGCCATTCCGTCACTCGTGAGTGCGGCCCTACTGGTATCCCTCC C4 GCGGCCGGCCATTCCGTCACTCGTGAGTGCGGCCCTACTGGTATCCCTCC C5 GCGGCCGGCCATTCCGTCACTCGTGAGTGCGGCCCTACTGGTATCCCTCC C6 GCGGCCGGCCATTCCGTCACTCGTGAGTGCGGCCCTACTGGTATCCCTCC ************************************************** C1 CGGTGCTGGCGACCGCTGATCCAGATGGAGACAACTTAGGCACCTTGATT C2 CGGTGCTGGCGACCGCTGATCCAGATGGAGACAACTTAGGCACCTTGATT C3 CGGTGCTGGCGACCGCTGATCCAGATGGAGACAACTTAGGCACCTTGATT C4 CGGTGCTGGCGACCGCTGATCCAGATGGAGACAACTTAGGCACCTTGATT C5 CGGTGCTGGCGACCGCTGATCCAGATGGAGACAACTTAGGCACCTTGATT C6 CGGTGCTGGCGACCGCTGATCCAGATGGAGACAACTTAGGCACCTTGATT ************************************************** C1 GCCGACGTCGCCAAGGTCAACCAGCGCCTAGAAGATCTCGGCGCGGCCAT C2 GCCGACGTCGCCAAGGTCAACCAGCGCCTAGAAGATCTCGGCGCGGCCAT C3 GCCGACGTCGCCAAGGTCAACCAGCGCCTAGAAGATCTCGGCGCGGCCAT C4 GCCGACGTCGCCAAGGTCAACCAGCGCCTAGAAGATCTCGGCGCGGCCAT C5 GCCGACGTCGCCAAGGTCAACCAGCGCCTAGAAGATCTCGGCGCGGCCAT C6 GCCGACGTCGCCAAGGTCAACCAGCGCCTAGAAGATCTCGGCGCGGCCAT ************************************************** C1 CGAGACCGAAGAGCAAAGTGTCAACAAGGCGATGGTTAGTGTGGAGATGG C2 CGAGACCGAAGAGCAAAGTGTCAACAAGGCGATGGTTAGTGTGGAGATGG C3 CGAGACCGAAGAGCAAAGTGTCAACAAGGCGATGGTTAGTGTGGAGATGG C4 CGAGACCGAAGAGCAAAGTGTCAACAAGGCGATGGTTAGTGTGGAGATGG C5 CGAGACCGAAGAGCAAAGTGTCAACAAGGCGATGGTTAGTGTGGAGATGG C6 CGAGACCGAAGAGCAAAGTGTCAACAAGGCGATGGTTAGTGTGGAGATGG ************************************************** C1 CCCGGGACAACGCGGTAGCGGCCGAACACGATTGCGAGGTTAGCCAACAG C2 CCCGGGACAACGCGGTAGCGGCCGAACACGATTGCGAGGTTAGCCAACAG C3 CCCGGGACAACGCGGTAGCGGCCGAACACGATTGCGAGGTTAGCCAACAG C4 CCCGGGACAACGCGGTAGCGGCCGAACACGATTGCGAGGTTAGCCAACAG C5 CCCGGGACAACGCGGTAGCGGCCGAACACGATTGCGAGGTTAGCCAACAG C6 CCCGGGACAACGCGGTAGCGGCCGAACACGATTGCGAGGTTAGCCAACAG ************************************************** C1 TCGGTCAAGGACGCGAATACGGCCATCAATGCTGCTCAGCATCGGTTTGA C2 TCGGTCAAGGACGCGAATACGGCCATCAATGCTGCTCAGCATCGGTTTGA C3 TCGGTCAAGGACGCGAATACGGCCATCAATGCTGCTCAGCATCGGTTTGA C4 TCGGTCAAGGACGCGAATACGGCCATCAATGCTGCTCAGCATCGGTTTGA C5 TCGGTCAAGGACGCGAATACGGCCATCAATGCTGCTCAGCATCGGTTTGA C6 TCGGTCAAGGACGCGAATACGGCCATCAATGCTGCTCAGCATCGGTTTGA ************************************************** C1 TAGCTTCGCAGCAGCCACATATATGAATGGCCCGTCGGGCAGTTACCTGA C2 TAGCTTCGCAGCAGCCACATATATGAATGGCCCGTCGGGCAGTTACCTGA C3 TAGCTTCGCAGCAGCCACATATATGAATGGCCCGTCGGGCAGTTACCTGA C4 TAGCTTCGCAGCAGCCACATATATGAATGGCCCGTCGGGCAGTTACCTGA C5 TAGCTTCGCAGCAGCCACATATATGAATGGCCCGTCGGGCAGTTACCTGA C6 TAGCTTCGCAGCAGCCACATATATGAATGGCCCGTCGGGCAGTTACCTGA ************************************************** C1 CTGCGACCAGCCCGGATGACATTATTGCCACCGCGACCGCCGCCAGGACG C2 CTGCGACCAGCCCGGATGACATTATTGCCACCGCGACCGCCGCCAGGACG C3 CTGCGACCAGCCCGGATGACATTATTGCCACCGCGACCGCCGCCAGGACG C4 CTGCGACCAGCCCGGATGACATTATTGCCACCGCGACCGCCGCCAGGACG C5 CTGCGACCAGCCCGGATGACATTATTGCCACCGCGACCGCCGCCAGGACG C6 CTGCGACCAGCCCGGATGACATTATTGCCACCGCGACCGCCGCCAGGACG ************************************************** C1 CTCACTGCCAGTTCCCAGGCGGTGATGGCCAATCTGCAGCGGGCCCGGAC C2 CTCACTGCCAGTTCCCAGGCGGTGATGGCCAATCTGCAGCGGGCCCGGAC C3 CTCACTGCCAGTTCCCAGGCGGTGATGGCCAATCTGCAGCGGGCCCGGAC C4 CTCACTGCCAGTTCCCAGGCGGTGATGGCCAATCTGCAGCGGGCCCGGAC C5 CTCACTGCCAGTTCCCAGGCGGTGATGGCCAATCTGCAGCGGGCCCGGAC C6 CTCACTGCCAGTTCCCAGGCGGTGATGGCCAATCTGCAGCGGGCCCGGAC ************************************************** C1 TGAGCAGGTGAACAAGGAGTCGGCTGCGCGGCTGGCCAAGCAAAAGGCCG C2 TGAGCAGGTGAACAAGGAGTCGGCTGCGCGGCTGGCCAAGCAAAAGGCCG C3 TGAGCAGGTGAACAAGGAGTCGGCTGCGCGGCTGGCCAAGCAAAAGGCCG C4 TGAGCAGGTGAACAAGGAGTCGGCTGCGCGGCTGGCCAAGCAAAAGGCCG C5 TGAGCAGGTGAACAAGGAGTCGGCTGCGCGGCTGGCCAAGCAAAAGGCCG C6 TGAGCAGGTGAACAAGGAGTCGGCTGCGCGGCTGGCCAAGCAAAAGGCCG ************************************************** C1 ATAAGGCCGCTGACGATGCAAAGGCCAGCATGGATGCCGCGGTGGCGGCA C2 ATAAGGCCGCTGACGATGCAAAGGCCAGCATGGATGCCGCGGTGGCGGCA C3 ATAAGGCCGCTGACGATGCAAAGGCCAGCATGGATGCCGCGGTGGCGGCA C4 ATAAGGCCGCTGACGATGCAAAGGCCAGCATGGATGCCGCGGTGGCGGCA C5 ATAAGGCCGCTGACGATGCAAAGGCCAGCATGGATGCCGCGGTGGCGGCA C6 ATAAGGCCGCTGACGATGCAAAGGCCAGCATGGATGCCGCGGTGGCGGCA ************************************************** C1 CTCACCGCGTCCAAGCGCAAATTTGATGAGCAGCGGGACGAAGTTAATCG C2 CTCACCGCGTCCAAGCGCAAATTTGATGAGCAGCGGGACGAAGTTAATCG C3 CTCACCGCGTCCAAGCGCAAATTTGATGAGCAGCGGGACGAAGTTAATCG C4 CTCACCGCGTCCAAGCGCAAATTTGATGAGCAGCGGGACGAAGTTAATCG C5 CTCACCGCGTCCAAGCGCAAATTTGATGAGCAGCGGGACGAAGTTAATCG C6 CTCACCGCGTCCAAGCGCAAATTTGATGAGCAGCGGGACGAAGTTAATCG ************************************************** C1 CCTGGCTGCTGAGCGTGACGAGGCTCAGGCCAGGCTCGAAGTGGCCCAAA C2 CCTGGCTGCTGAGCGTGACGAGGCTCAGGCCAGGCTCGAAGTGGCCCAAA C3 CCTGGCTGCTGAGCGTGACGAGGCTCAGGCCAGGCTCGAAGTGGCCCAAA C4 CCTGGCTGCTGAGCGTGACGAGGCTCAGGCCAGGCTCGAAGTGGCCCAAA C5 CCTGGCTGCTGAGCGTGACGAGGCTCAGGCCAGGCTCGAAGTGGCCCAAA C6 CCTGGCTGCTGAGCGTGACGAGGCTCAGGCCAGGCTCGAAGTGGCCCAAA ************************************************** C1 TAGCGGCAGCAACGTGGGTGCCAGGGATGGGAGGGCATGGCACGCCACCG C2 TAGCGGCAGCAACGTGGGTGCCAGGGATGGGAGGGCATGGCACGCCACCG C3 TAGCGGCAGCAACGTGGGTGCCAGGGATGGGAGGGCATGGCACGCCACCG C4 TAGCGGCAGCAACGTGGGTGCCAGGGATGGGAGGGCATGGCACGCCACCG C5 TAGCGGCAGCAACGTGGGTGCCAGGGATGGGAGGGCATGGCACGCCACCG C6 TAGCGGCAGCAACGTGGGTGCCAGGGATGGGAGGGCATGGCACGCCACCG ************************************************** C1 TTCGGTGACCGGTGGGAACCTGGTTCGCCAGCTTCAGCTGGCCCGGCCGG C2 TTCGGTGACCGGTGGGAACCTGGTTCGCCAGCTTCAGCTGGCCCGGCCGG C3 TTCGGTGACCGGTGGGAACCTGGTTCGCCAGCTTCAGCTGGCCCGGCCGG C4 TTCGGTGACCGGTGGGAACCTGGTTCGCCAGCTTCAGCTGGCCCGGCCGG C5 TTCGGTGACCGGTGGGAACCTGGTTCGCCAGCTTCAGCTGGCCCGGCCGG C6 TTCGGTGACCGGTGGGAACCTGGTTCGCCAGCTTCAGCTGGCCCGGCCGG ************************************************** C1 GGGCCGCAAATGGGACGGCTGGGATCCCACGCTGCCGCAGGTACCCAGCG C2 GGGCCGCAAATGGGACGGCTGGGATCCCACGCTGCCGCAGGTACCCAGCG C3 GGGCCGCAAATGGGACGGCTGGGATCCCACGCTGCCGCAGGTACCCAGCG C4 GGGCCGCAAATGGGACGGCTGGGATCCCACGCTGCCGCAGGTACCCAGCG C5 GGGCCGCAAATGGGACGGCTGGGATCCCACGCTGCCGCAGGTACCCAGCG C6 GGGCCGCAAATGGGACGGCTGGGATCCCACGCTGCCGCAGGTACCCAGCG ************************************************** C1 CCAACGTCCCGGGAGACCCGATCGCAGTGATCAACCAGGTGTTGGGGTAC C2 CCAACGTCCCGGGAGACCCGATCGCAGTGATCAACCAGGTGTTGGGGTAC C3 CCAACGTCCCGGGAGACCCGATCGCAGTGATCAACCAGGTGTTGGGGTAC C4 CCAACGTCCCGGGAGACCCGATCGCAGTGATCAACCAGGTGTTGGGGTAC C5 CCAACGTCCCGGGAGACCCGATCGCAGTGATCAACCAGGTGTTGGGGTAC C6 CCAACGTCCCGGGAGACCCGATCGCAGTGATCAACCAGGTGTTGGGGTAC ************************************************** C1 GCGGCGACTTCGACGCAGGTCACCGCCAGCATGGGGCGCAACTTCTTGCA C2 GCGGCGACTTCGACGCAGGTCACCGCCAGCATGGGGCGCAACTTCTTGCA C3 GCGGCGACTTCGACGCAGGTCACCGCCAGCATGGGGCGCAACTTCTTGCA C4 GCGGCGACTTCGACGCAGGTCACCGCCAGCATGGGGCGCAACTTCTTGCA C5 GCGGCGACTTCGACGCAGGTCACCGCCAGCATGGGGCGCAACTTCTTGCA C6 GCGGCGACTTCGACGCAGGTCACCGCCAGCATGGGGCGCAACTTCTTGCA ************************************************** C1 GCAACTGGGCATCTTGAAACCGAACGACACTGGTATCACTAACGCCCCGA C2 GCAACTGGGCATCTTGAAACCGAACGACACTGGTATCACTAACGCCCCGA C3 GCAACTGGGCATCTTGAAACCGAACGACACTGGTATCACTAACGCCCCGA C4 GCAACTGGGCATCTTGAAACCGAACGACACTGGTATCACTAACGCCCCGA C5 GCAACTGGGCATCTTGAAACCGAACGACACTGGTATCACTAACGCCCCGA C6 GCAACTGGGCATCTTGAAACCGAACGACACTGGTATCACTAACGCCCCGA ************************************************** C1 TTGGTTCGACGCAGGGACGTATTCCGCGGGTTTACGGGCGGCAGGCCTCC C2 TTGGTTCGACGCAGGGACGTATTCCGCGGGTTTACGGGCGGCAGGCCTCC C3 TTGGTTCGACGCAGGGACGTATTCCGCGGGTTTACGGGCGGCAGGCCTCC C4 TTGGTTCGACGCAGGGACGTATTCCGCGGGTTTACGGGCGGCAGGCCTCC C5 TTGGTTCGACGCAGGGACGTATTCCGCGGGTTTACGGGCGGCAGGCCTCC C6 TTGGTTCGACGCAGGGACGTATTCCGCGGGTTTACGGGCGGCAGGCCTCC ************************************************** C1 GAATACGTGATCCGTCGCGGGATATCGCAGATCGGCGTGCCCTACTCCTG C2 GAATACGTGATCCGTCGCGGGATATCGCAGATCGGCGTGCCCTACTCCTG C3 GAATACGTGATCCGTCGCGGGATATCGCAGATCGGCGTGCCCTACTCCTG C4 GAATACGTGATCCGTCGCGGGATATCGCAGATCGGCGTGCCCTACTCCTG C5 GAATACGTGATCCGTCGCGGGATATCGCAGATCGGCGTGCCCTACTCCTG C6 GAATACGTGATCCGTCGCGGGATATCGCAGATCGGCGTGCCCTACTCCTG ************************************************** C1 GGGTGGTGGCAACGCAGCTGGCCCGAGTAGGGGAATAGACTCGGGTGCTG C2 GGGTGGTGGCAACGCAGCTGGCCCGAGTAGGGGAATAGACTCGGGTGCTG C3 GGGTGGTGGCAACGCAGCTGGCCCGAGTAGGGGAATAGACTCGGGTGCTG C4 GGGTGGTGGCAACGCAGCTGGCCCGAGTAGGGGAATAGACTCGGGTGCTG C5 GGGTGGTGGCAACGCAGCTGGCCCGAGTAGGGGAATAGACTCGGGTGCTG C6 GGGTGGTGGCAACGCAGCTGGCCCGAGTAGGGGAATAGACTCGGGTGCTG ************************************************** C1 GGATTACCGGCTTCGACTGTTCGGGGCTAGTTTTGTATTCTTTCGCCGGG C2 GGATTACCGGCTTCGACTGTTCGGGGCTAGTTTTGTATTCTTTCGCCGGG C3 GGATTACCGGCTTCGACTGTTCGGGGCTAGTTTTGTATTCTTTCGCCGGG C4 GGATTACCGGCTTCGACTGTTCGGGGCTAGTTTTGTATTCTTTCGCCGGG C5 GGATTACCGGCTTCGACTGTTCGGGGCTAGTTTTGTATTCTTTCGCCGGG C6 GGATTACCGGCTTCGACTGTTCGGGGCTAGTTTTGTATTCTTTCGCCGGG ************************************************** C1 GTGGGCATCAGGCTGCCGCACTACTCGGGCTCGCAGTACAACCTGGGCCG C2 GTGGGCATCAGGCTGCCGCACTACTCGGGCTCGCAGTACAACCTGGGCCG C3 GTGGGCATCAGGCTGCCGCACTACTCGGGCTCGCAGTACAACCTGGGCCG C4 GTGGGCATCAGGCTGCCGCACTACTCGGGCTCGCAGTACAACCTGGGCCG C5 GTGGGCATCAGGCTGCCGCACTACTCGGGCTCGCAGTACAACCTGGGCCG C6 GTGGGCATCAGGCTGCCGCACTACTCGGGCTCGCAGTACAACCTGGGCCG ************************************************** C1 CAAGATCCCGTCTGCTCAGATGCGCCGCGGCGACGTCATCTTCTACGGCC C2 CAAGATCCCGTCTGCTCAGATGCGCCGCGGCGACGTCATCTTCTACGGCC C3 CAAGATCCCGTCTGCTCAGATGCGCCGCGGCGACGTCATCTTCTACGGCC C4 CAAGATCCCGTCTGCTCAGATGCGCCGCGGCGACGTCATCTTCTACGGCC C5 CAAGATCCCGTCTGCTCAGATGCGCCGCGGCGACGTCATCTTCTACGGCC C6 CAAGATCCCGTCTGCTCAGATGCGCCGCGGCGACGTCATCTTCTACGGCC ************************************************** C1 CGGGCGGCAGCCAGCACGTGACGATCTACCTCGGCCATGGCCAGATGCTC C2 CGGGCGGCAGCCAGCACGTGACGATCTACCTCGGCCATGGCCAGATGCTC C3 CGGGCGGCAGCCAGCACGTGACGATCTACCTCGGCCATGGCCAGATGCTC C4 CGGGCGGCAGCCAGCACGTGACGATCTACCTCGGCCATGGCCAGATGCTC C5 CGGGCGGCAGCCAGCACGTGACGATCTACCTCGGCCATGGCCAGATGCTC C6 CGGGCGGCAGCCAGCACGTGACGATCTACCTCGGCCATGGCCAGATGCTC ************************************************** C1 GAGGCTCCGGACATCGGCTTGAGGGTGCGTGTTGCACCTGTGCGCACCAG C2 GAGGCTCCGGACATCGGCTTGAGGGTGCGTGTTGCACCTGTGCGCACCAG C3 GAGGCTCCGGACATCGGCTTGAGGGTGCGTGTTGCACCTGTGCGCACCAG C4 GAGGCTCCGGACATCGGCTTGAGGGTGCGTGTTGCACCTGTGCGCACCAG C5 GAGGCTCCGGACATCGGCTTGAGGGTGCGTGTTGCACCTGTGCGCACCAG C6 GAGGCTCCGGACATCGGCTTGAGGGTGCGTGTTGCACCTGTGCGCACCAG ************************************************** C1 TGGCATGACTCCGTATGTGGTCCGCTACATCGAATAC C2 TGGCATGACTCCGTATGTGGTCCGCTACATCGAATAC C3 TGGCATGACTCCGTATGTGGTCCGCTACATCGAATAC C4 TGGCATGACTCCGTATGTGGTCCGCTACATCGAATAC C5 TGGCATGACTCCGTATGTGGTCCGCTACATCGAATAC C6 TGGCATGACTCCGTATGTGGTCCGCTACATCGAATAC ************************************* >C1 ATGAAACGGCCCCGCCGTGGCTCTGTTTCGCGACCGACCGCACGGTTTGT GCGGCCGGCCATTCCGTCACTCGTGAGTGCGGCCCTACTGGTATCCCTCC CGGTGCTGGCGACCGCTGATCCAGATGGAGACAACTTAGGCACCTTGATT GCCGACGTCGCCAAGGTCAACCAGCGCCTAGAAGATCTCGGCGCGGCCAT CGAGACCGAAGAGCAAAGTGTCAACAAGGCGATGGTTAGTGTGGAGATGG CCCGGGACAACGCGGTAGCGGCCGAACACGATTGCGAGGTTAGCCAACAG TCGGTCAAGGACGCGAATACGGCCATCAATGCTGCTCAGCATCGGTTTGA TAGCTTCGCAGCAGCCACATATATGAATGGCCCGTCGGGCAGTTACCTGA CTGCGACCAGCCCGGATGACATTATTGCCACCGCGACCGCCGCCAGGACG CTCACTGCCAGTTCCCAGGCGGTGATGGCCAATCTGCAGCGGGCCCGGAC TGAGCAGGTGAACAAGGAGTCGGCTGCGCGGCTGGCCAAGCAAAAGGCCG ATAAGGCCGCTGACGATGCAAAGGCCAGCATGGATGCCGCGGTGGCGGCA CTCACCGCGTCCAAGCGCAAATTTGATGAGCAGCGGGACGAAGTTAATCG CCTGGCTGCTGAGCGTGACGAGGCTCAGGCCAGGCTCGAAGTGGCCCAAA TAGCGGCAGCAACGTGGGTGCCAGGGATGGGAGGGCATGGCACGCCACCG TTCGGTGACCGGTGGGAACCTGGTTCGCCAGCTTCAGCTGGCCCGGCCGG GGGCCGCAAATGGGACGGCTGGGATCCCACGCTGCCGCAGGTACCCAGCG CCAACGTCCCGGGAGACCCGATCGCAGTGATCAACCAGGTGTTGGGGTAC GCGGCGACTTCGACGCAGGTCACCGCCAGCATGGGGCGCAACTTCTTGCA GCAACTGGGCATCTTGAAACCGAACGACACTGGTATCACTAACGCCCCGA TTGGTTCGACGCAGGGACGTATTCCGCGGGTTTACGGGCGGCAGGCCTCC GAATACGTGATCCGTCGCGGGATATCGCAGATCGGCGTGCCCTACTCCTG GGGTGGTGGCAACGCAGCTGGCCCGAGTAGGGGAATAGACTCGGGTGCTG GGATTACCGGCTTCGACTGTTCGGGGCTAGTTTTGTATTCTTTCGCCGGG GTGGGCATCAGGCTGCCGCACTACTCGGGCTCGCAGTACAACCTGGGCCG CAAGATCCCGTCTGCTCAGATGCGCCGCGGCGACGTCATCTTCTACGGCC CGGGCGGCAGCCAGCACGTGACGATCTACCTCGGCCATGGCCAGATGCTC GAGGCTCCGGACATCGGCTTGAGGGTGCGTGTTGCACCTGTGCGCACCAG TGGCATGACTCCGTATGTGGTCCGCTACATCGAATAC >C2 ATGAAACGGCCCCGCCGTGGCTCTGTTTCGCGACCGACCGCACGGTTTGT GCGGCCGGCCATTCCGTCACTCGTGAGTGCGGCCCTACTGGTATCCCTCC CGGTGCTGGCGACCGCTGATCCAGATGGAGACAACTTAGGCACCTTGATT GCCGACGTCGCCAAGGTCAACCAGCGCCTAGAAGATCTCGGCGCGGCCAT CGAGACCGAAGAGCAAAGTGTCAACAAGGCGATGGTTAGTGTGGAGATGG CCCGGGACAACGCGGTAGCGGCCGAACACGATTGCGAGGTTAGCCAACAG TCGGTCAAGGACGCGAATACGGCCATCAATGCTGCTCAGCATCGGTTTGA TAGCTTCGCAGCAGCCACATATATGAATGGCCCGTCGGGCAGTTACCTGA CTGCGACCAGCCCGGATGACATTATTGCCACCGCGACCGCCGCCAGGACG CTCACTGCCAGTTCCCAGGCGGTGATGGCCAATCTGCAGCGGGCCCGGAC TGAGCAGGTGAACAAGGAGTCGGCTGCGCGGCTGGCCAAGCAAAAGGCCG ATAAGGCCGCTGACGATGCAAAGGCCAGCATGGATGCCGCGGTGGCGGCA CTCACCGCGTCCAAGCGCAAATTTGATGAGCAGCGGGACGAAGTTAATCG CCTGGCTGCTGAGCGTGACGAGGCTCAGGCCAGGCTCGAAGTGGCCCAAA TAGCGGCAGCAACGTGGGTGCCAGGGATGGGAGGGCATGGCACGCCACCG TTCGGTGACCGGTGGGAACCTGGTTCGCCAGCTTCAGCTGGCCCGGCCGG GGGCCGCAAATGGGACGGCTGGGATCCCACGCTGCCGCAGGTACCCAGCG CCAACGTCCCGGGAGACCCGATCGCAGTGATCAACCAGGTGTTGGGGTAC GCGGCGACTTCGACGCAGGTCACCGCCAGCATGGGGCGCAACTTCTTGCA GCAACTGGGCATCTTGAAACCGAACGACACTGGTATCACTAACGCCCCGA TTGGTTCGACGCAGGGACGTATTCCGCGGGTTTACGGGCGGCAGGCCTCC GAATACGTGATCCGTCGCGGGATATCGCAGATCGGCGTGCCCTACTCCTG GGGTGGTGGCAACGCAGCTGGCCCGAGTAGGGGAATAGACTCGGGTGCTG GGATTACCGGCTTCGACTGTTCGGGGCTAGTTTTGTATTCTTTCGCCGGG GTGGGCATCAGGCTGCCGCACTACTCGGGCTCGCAGTACAACCTGGGCCG CAAGATCCCGTCTGCTCAGATGCGCCGCGGCGACGTCATCTTCTACGGCC CGGGCGGCAGCCAGCACGTGACGATCTACCTCGGCCATGGCCAGATGCTC GAGGCTCCGGACATCGGCTTGAGGGTGCGTGTTGCACCTGTGCGCACCAG TGGCATGACTCCGTATGTGGTCCGCTACATCGAATAC >C3 ATGAAACGGCCCCGCCGTGGCTCTGTTTCGCGACCGACCGCACGGTTTGT GCGGCCGGCCATTCCGTCACTCGTGAGTGCGGCCCTACTGGTATCCCTCC CGGTGCTGGCGACCGCTGATCCAGATGGAGACAACTTAGGCACCTTGATT GCCGACGTCGCCAAGGTCAACCAGCGCCTAGAAGATCTCGGCGCGGCCAT CGAGACCGAAGAGCAAAGTGTCAACAAGGCGATGGTTAGTGTGGAGATGG CCCGGGACAACGCGGTAGCGGCCGAACACGATTGCGAGGTTAGCCAACAG TCGGTCAAGGACGCGAATACGGCCATCAATGCTGCTCAGCATCGGTTTGA TAGCTTCGCAGCAGCCACATATATGAATGGCCCGTCGGGCAGTTACCTGA CTGCGACCAGCCCGGATGACATTATTGCCACCGCGACCGCCGCCAGGACG CTCACTGCCAGTTCCCAGGCGGTGATGGCCAATCTGCAGCGGGCCCGGAC TGAGCAGGTGAACAAGGAGTCGGCTGCGCGGCTGGCCAAGCAAAAGGCCG ATAAGGCCGCTGACGATGCAAAGGCCAGCATGGATGCCGCGGTGGCGGCA CTCACCGCGTCCAAGCGCAAATTTGATGAGCAGCGGGACGAAGTTAATCG CCTGGCTGCTGAGCGTGACGAGGCTCAGGCCAGGCTCGAAGTGGCCCAAA TAGCGGCAGCAACGTGGGTGCCAGGGATGGGAGGGCATGGCACGCCACCG TTCGGTGACCGGTGGGAACCTGGTTCGCCAGCTTCAGCTGGCCCGGCCGG GGGCCGCAAATGGGACGGCTGGGATCCCACGCTGCCGCAGGTACCCAGCG CCAACGTCCCGGGAGACCCGATCGCAGTGATCAACCAGGTGTTGGGGTAC GCGGCGACTTCGACGCAGGTCACCGCCAGCATGGGGCGCAACTTCTTGCA GCAACTGGGCATCTTGAAACCGAACGACACTGGTATCACTAACGCCCCGA TTGGTTCGACGCAGGGACGTATTCCGCGGGTTTACGGGCGGCAGGCCTCC GAATACGTGATCCGTCGCGGGATATCGCAGATCGGCGTGCCCTACTCCTG GGGTGGTGGCAACGCAGCTGGCCCGAGTAGGGGAATAGACTCGGGTGCTG GGATTACCGGCTTCGACTGTTCGGGGCTAGTTTTGTATTCTTTCGCCGGG GTGGGCATCAGGCTGCCGCACTACTCGGGCTCGCAGTACAACCTGGGCCG CAAGATCCCGTCTGCTCAGATGCGCCGCGGCGACGTCATCTTCTACGGCC CGGGCGGCAGCCAGCACGTGACGATCTACCTCGGCCATGGCCAGATGCTC GAGGCTCCGGACATCGGCTTGAGGGTGCGTGTTGCACCTGTGCGCACCAG TGGCATGACTCCGTATGTGGTCCGCTACATCGAATAC >C4 ATGAAACGGCCCCGCCGTGGCTCTGTTTCGCGACCGACCGCACGGTTTGT GCGGCCGGCCATTCCGTCACTCGTGAGTGCGGCCCTACTGGTATCCCTCC CGGTGCTGGCGACCGCTGATCCAGATGGAGACAACTTAGGCACCTTGATT GCCGACGTCGCCAAGGTCAACCAGCGCCTAGAAGATCTCGGCGCGGCCAT CGAGACCGAAGAGCAAAGTGTCAACAAGGCGATGGTTAGTGTGGAGATGG CCCGGGACAACGCGGTAGCGGCCGAACACGATTGCGAGGTTAGCCAACAG TCGGTCAAGGACGCGAATACGGCCATCAATGCTGCTCAGCATCGGTTTGA TAGCTTCGCAGCAGCCACATATATGAATGGCCCGTCGGGCAGTTACCTGA CTGCGACCAGCCCGGATGACATTATTGCCACCGCGACCGCCGCCAGGACG CTCACTGCCAGTTCCCAGGCGGTGATGGCCAATCTGCAGCGGGCCCGGAC TGAGCAGGTGAACAAGGAGTCGGCTGCGCGGCTGGCCAAGCAAAAGGCCG ATAAGGCCGCTGACGATGCAAAGGCCAGCATGGATGCCGCGGTGGCGGCA CTCACCGCGTCCAAGCGCAAATTTGATGAGCAGCGGGACGAAGTTAATCG CCTGGCTGCTGAGCGTGACGAGGCTCAGGCCAGGCTCGAAGTGGCCCAAA TAGCGGCAGCAACGTGGGTGCCAGGGATGGGAGGGCATGGCACGCCACCG TTCGGTGACCGGTGGGAACCTGGTTCGCCAGCTTCAGCTGGCCCGGCCGG GGGCCGCAAATGGGACGGCTGGGATCCCACGCTGCCGCAGGTACCCAGCG CCAACGTCCCGGGAGACCCGATCGCAGTGATCAACCAGGTGTTGGGGTAC GCGGCGACTTCGACGCAGGTCACCGCCAGCATGGGGCGCAACTTCTTGCA GCAACTGGGCATCTTGAAACCGAACGACACTGGTATCACTAACGCCCCGA TTGGTTCGACGCAGGGACGTATTCCGCGGGTTTACGGGCGGCAGGCCTCC GAATACGTGATCCGTCGCGGGATATCGCAGATCGGCGTGCCCTACTCCTG GGGTGGTGGCAACGCAGCTGGCCCGAGTAGGGGAATAGACTCGGGTGCTG GGATTACCGGCTTCGACTGTTCGGGGCTAGTTTTGTATTCTTTCGCCGGG GTGGGCATCAGGCTGCCGCACTACTCGGGCTCGCAGTACAACCTGGGCCG CAAGATCCCGTCTGCTCAGATGCGCCGCGGCGACGTCATCTTCTACGGCC CGGGCGGCAGCCAGCACGTGACGATCTACCTCGGCCATGGCCAGATGCTC GAGGCTCCGGACATCGGCTTGAGGGTGCGTGTTGCACCTGTGCGCACCAG TGGCATGACTCCGTATGTGGTCCGCTACATCGAATAC >C5 ATGAAACGGCCCCGCCGTGGCTCTGTTTCGCGACCGACCGCACGGTTTGT GCGGCCGGCCATTCCGTCACTCGTGAGTGCGGCCCTACTGGTATCCCTCC CGGTGCTGGCGACCGCTGATCCAGATGGAGACAACTTAGGCACCTTGATT GCCGACGTCGCCAAGGTCAACCAGCGCCTAGAAGATCTCGGCGCGGCCAT CGAGACCGAAGAGCAAAGTGTCAACAAGGCGATGGTTAGTGTGGAGATGG CCCGGGACAACGCGGTAGCGGCCGAACACGATTGCGAGGTTAGCCAACAG TCGGTCAAGGACGCGAATACGGCCATCAATGCTGCTCAGCATCGGTTTGA TAGCTTCGCAGCAGCCACATATATGAATGGCCCGTCGGGCAGTTACCTGA CTGCGACCAGCCCGGATGACATTATTGCCACCGCGACCGCCGCCAGGACG CTCACTGCCAGTTCCCAGGCGGTGATGGCCAATCTGCAGCGGGCCCGGAC TGAGCAGGTGAACAAGGAGTCGGCTGCGCGGCTGGCCAAGCAAAAGGCCG ATAAGGCCGCTGACGATGCAAAGGCCAGCATGGATGCCGCGGTGGCGGCA CTCACCGCGTCCAAGCGCAAATTTGATGAGCAGCGGGACGAAGTTAATCG CCTGGCTGCTGAGCGTGACGAGGCTCAGGCCAGGCTCGAAGTGGCCCAAA TAGCGGCAGCAACGTGGGTGCCAGGGATGGGAGGGCATGGCACGCCACCG TTCGGTGACCGGTGGGAACCTGGTTCGCCAGCTTCAGCTGGCCCGGCCGG GGGCCGCAAATGGGACGGCTGGGATCCCACGCTGCCGCAGGTACCCAGCG CCAACGTCCCGGGAGACCCGATCGCAGTGATCAACCAGGTGTTGGGGTAC GCGGCGACTTCGACGCAGGTCACCGCCAGCATGGGGCGCAACTTCTTGCA GCAACTGGGCATCTTGAAACCGAACGACACTGGTATCACTAACGCCCCGA TTGGTTCGACGCAGGGACGTATTCCGCGGGTTTACGGGCGGCAGGCCTCC GAATACGTGATCCGTCGCGGGATATCGCAGATCGGCGTGCCCTACTCCTG GGGTGGTGGCAACGCAGCTGGCCCGAGTAGGGGAATAGACTCGGGTGCTG GGATTACCGGCTTCGACTGTTCGGGGCTAGTTTTGTATTCTTTCGCCGGG GTGGGCATCAGGCTGCCGCACTACTCGGGCTCGCAGTACAACCTGGGCCG CAAGATCCCGTCTGCTCAGATGCGCCGCGGCGACGTCATCTTCTACGGCC CGGGCGGCAGCCAGCACGTGACGATCTACCTCGGCCATGGCCAGATGCTC GAGGCTCCGGACATCGGCTTGAGGGTGCGTGTTGCACCTGTGCGCACCAG TGGCATGACTCCGTATGTGGTCCGCTACATCGAATAC >C6 ATGAAACGGCCCCGCCGTGGCTCTGTTTCGCGACCGACCGCACGGTTTGT GCGGCCGGCCATTCCGTCACTCGTGAGTGCGGCCCTACTGGTATCCCTCC CGGTGCTGGCGACCGCTGATCCAGATGGAGACAACTTAGGCACCTTGATT GCCGACGTCGCCAAGGTCAACCAGCGCCTAGAAGATCTCGGCGCGGCCAT CGAGACCGAAGAGCAAAGTGTCAACAAGGCGATGGTTAGTGTGGAGATGG CCCGGGACAACGCGGTAGCGGCCGAACACGATTGCGAGGTTAGCCAACAG TCGGTCAAGGACGCGAATACGGCCATCAATGCTGCTCAGCATCGGTTTGA TAGCTTCGCAGCAGCCACATATATGAATGGCCCGTCGGGCAGTTACCTGA CTGCGACCAGCCCGGATGACATTATTGCCACCGCGACCGCCGCCAGGACG CTCACTGCCAGTTCCCAGGCGGTGATGGCCAATCTGCAGCGGGCCCGGAC TGAGCAGGTGAACAAGGAGTCGGCTGCGCGGCTGGCCAAGCAAAAGGCCG ATAAGGCCGCTGACGATGCAAAGGCCAGCATGGATGCCGCGGTGGCGGCA CTCACCGCGTCCAAGCGCAAATTTGATGAGCAGCGGGACGAAGTTAATCG CCTGGCTGCTGAGCGTGACGAGGCTCAGGCCAGGCTCGAAGTGGCCCAAA TAGCGGCAGCAACGTGGGTGCCAGGGATGGGAGGGCATGGCACGCCACCG TTCGGTGACCGGTGGGAACCTGGTTCGCCAGCTTCAGCTGGCCCGGCCGG GGGCCGCAAATGGGACGGCTGGGATCCCACGCTGCCGCAGGTACCCAGCG CCAACGTCCCGGGAGACCCGATCGCAGTGATCAACCAGGTGTTGGGGTAC GCGGCGACTTCGACGCAGGTCACCGCCAGCATGGGGCGCAACTTCTTGCA GCAACTGGGCATCTTGAAACCGAACGACACTGGTATCACTAACGCCCCGA TTGGTTCGACGCAGGGACGTATTCCGCGGGTTTACGGGCGGCAGGCCTCC GAATACGTGATCCGTCGCGGGATATCGCAGATCGGCGTGCCCTACTCCTG GGGTGGTGGCAACGCAGCTGGCCCGAGTAGGGGAATAGACTCGGGTGCTG GGATTACCGGCTTCGACTGTTCGGGGCTAGTTTTGTATTCTTTCGCCGGG GTGGGCATCAGGCTGCCGCACTACTCGGGCTCGCAGTACAACCTGGGCCG CAAGATCCCGTCTGCTCAGATGCGCCGCGGCGACGTCATCTTCTACGGCC CGGGCGGCAGCCAGCACGTGACGATCTACCTCGGCCATGGCCAGATGCTC GAGGCTCCGGACATCGGCTTGAGGGTGCGTGTTGCACCTGTGCGCACCAG TGGCATGACTCCGTATGTGGTCCGCTACATCGAATAC >C1 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML EAPDIGLRVRVAPVRTSGMTPYVVRYIEY >C2 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML EAPDIGLRVRVAPVRTSGMTPYVVRYIEY >C3 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML EAPDIGLRVRVAPVRTSGMTPYVVRYIEY >C4 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML EAPDIGLRVRVAPVRTSGMTPYVVRYIEY >C5 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML EAPDIGLRVRVAPVRTSGMTPYVVRYIEY >C6 MKRPRRGSVSRPTARFVRPAIPSLVSAALLVSLPVLATADPDGDNLGTLI ADVAKVNQRLEDLGAAIETEEQSVNKAMVSVEMARDNAVAAEHDCEVSQQ SVKDANTAINAAQHRFDSFAAATYMNGPSGSYLTATSPDDIIATATAART LTASSQAVMANLQRARTEQVNKESAARLAKQKADKAADDAKASMDAAVAA LTASKRKFDEQRDEVNRLAAERDEAQARLEVAQIAAATWVPGMGGHGTPP FGDRWEPGSPASAGPAGGRKWDGWDPTLPQVPSANVPGDPIAVINQVLGY AATSTQVTASMGRNFLQQLGILKPNDTGITNAPIGSTQGRIPRVYGRQAS EYVIRRGISQIGVPYSWGGGNAAGPSRGIDSGAGITGFDCSGLVLYSFAG VGIRLPHYSGSQYNLGRKIPSAQMRRGDVIFYGPGGSQHVTIYLGHGQML EAPDIGLRVRVAPVRTSGMTPYVVRYIEY MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/7res/ML1812/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1437 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579859219 Setting output file names to "/data/7res/ML1812/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1910819952 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5212616315 Seed = 1812376352 Swapseed = 1579859219 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3216.074402 -- -24.965149 Chain 2 -- -3216.074892 -- -24.965149 Chain 3 -- -3216.074707 -- -24.965149 Chain 4 -- -3216.074707 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3216.074402 -- -24.965149 Chain 2 -- -3216.074892 -- -24.965149 Chain 3 -- -3216.074892 -- -24.965149 Chain 4 -- -3216.074892 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3216.074] (-3216.075) (-3216.075) (-3216.075) * [-3216.074] (-3216.075) (-3216.075) (-3216.075) 500 -- (-1999.289) [-1992.957] (-1978.791) (-1997.338) * (-1964.051) (-1991.560) [-1951.555] (-1955.062) -- 0:00:00 1000 -- (-1964.582) (-1991.660) [-1958.392] (-1969.577) * (-1959.747) (-1963.233) (-1962.324) [-1953.793] -- 0:00:00 1500 -- (-1960.416) (-1951.133) (-1956.747) [-1957.219] * (-1955.456) (-1954.036) (-1953.802) [-1950.987] -- 0:00:00 2000 -- (-1958.447) (-1955.101) (-1949.043) [-1951.629] * (-1949.211) (-1956.811) [-1952.989] (-1951.723) -- 0:00:00 2500 -- (-1951.778) (-1954.880) [-1952.262] (-1948.775) * (-1958.374) [-1954.348] (-1961.983) (-1955.119) -- 0:00:00 3000 -- (-1959.427) (-1953.688) [-1948.530] (-1954.495) * (-1958.367) (-1948.967) (-1958.215) [-1952.674] -- 0:00:00 3500 -- (-1950.620) [-1953.839] (-1952.395) (-1958.873) * (-1963.362) (-1955.560) [-1949.733] (-1951.556) -- 0:00:00 4000 -- (-1952.856) (-1949.967) (-1960.733) [-1957.639] * (-1951.106) [-1953.124] (-1962.160) (-1950.871) -- 0:00:00 4500 -- (-1951.582) [-1959.897] (-1950.740) (-1950.981) * (-1952.607) (-1956.991) (-1954.946) [-1952.755] -- 0:00:00 5000 -- (-1953.121) [-1950.675] (-1954.678) (-1954.724) * (-1960.124) (-1951.899) [-1948.412] (-1953.935) -- 0:00:00 Average standard deviation of split frequencies: 0.109994 5500 -- (-1947.904) (-1957.032) (-1954.907) [-1953.875] * (-1949.299) (-1954.542) (-1953.114) [-1951.575] -- 0:00:00 6000 -- (-1957.359) (-1953.401) (-1950.005) [-1949.411] * (-1955.923) (-1954.966) (-1957.740) [-1953.162] -- 0:00:00 6500 -- [-1954.632] (-1956.943) (-1968.226) (-1953.244) * (-1948.996) [-1953.296] (-1951.496) (-1955.671) -- 0:00:00 7000 -- (-1952.005) (-1961.073) (-1951.685) [-1950.834] * (-1950.407) (-1955.410) (-1954.539) [-1955.476] -- 0:00:00 7500 -- (-1949.162) (-1952.910) (-1950.347) [-1959.406] * (-1950.235) (-1949.985) [-1952.843] (-1957.459) -- 0:02:12 8000 -- (-1954.901) (-1960.385) [-1949.254] (-1954.175) * (-1954.410) [-1950.744] (-1955.282) (-1956.310) -- 0:02:04 8500 -- (-1963.632) (-1952.070) (-1957.924) [-1956.857] * (-1951.528) (-1951.168) (-1959.555) [-1950.350] -- 0:01:56 9000 -- (-1957.775) (-1956.791) (-1957.708) [-1957.672] * (-1955.828) (-1947.098) [-1951.624] (-1956.619) -- 0:01:50 9500 -- (-1961.376) (-1962.726) (-1956.795) [-1951.418] * (-1956.306) [-1953.298] (-1954.052) (-1956.976) -- 0:01:44 10000 -- (-1954.371) [-1947.160] (-1958.749) (-1959.038) * (-1956.810) (-1949.816) (-1958.278) [-1953.389] -- 0:01:39 Average standard deviation of split frequencies: 0.079550 10500 -- [-1950.016] (-1955.064) (-1951.514) (-1956.701) * (-1957.712) [-1957.164] (-1951.868) (-1959.163) -- 0:01:34 11000 -- (-1950.750) (-1960.245) (-1967.800) [-1949.155] * (-1949.380) (-1951.189) (-1957.220) [-1947.239] -- 0:01:29 11500 -- [-1946.909] (-1965.632) (-1961.695) (-1949.565) * (-1954.062) [-1955.987] (-1954.092) (-1952.285) -- 0:01:25 12000 -- [-1947.067] (-1951.625) (-1958.830) (-1948.031) * (-1955.712) (-1953.307) [-1955.797] (-1957.916) -- 0:01:22 12500 -- [-1944.431] (-1956.610) (-1955.171) (-1956.568) * (-1959.680) (-1955.921) (-1949.236) [-1953.174] -- 0:01:19 13000 -- (-1945.677) (-1969.116) [-1954.149] (-1959.814) * (-1951.477) (-1959.432) [-1957.028] (-1954.350) -- 0:01:15 13500 -- (-1944.326) (-1954.044) (-1956.343) [-1951.376] * (-1953.854) [-1952.295] (-1960.688) (-1953.496) -- 0:01:13 14000 -- (-1944.896) (-1955.893) (-1952.890) [-1956.005] * (-1955.921) (-1960.518) (-1957.345) [-1956.150] -- 0:01:10 14500 -- (-1952.140) (-1952.745) (-1956.688) [-1955.224] * (-1952.434) (-1954.686) (-1957.147) [-1946.675] -- 0:01:07 15000 -- (-1946.367) (-1959.640) [-1950.500] (-1957.437) * (-1955.561) [-1951.528] (-1962.812) (-1952.916) -- 0:01:05 Average standard deviation of split frequencies: 0.064818 15500 -- (-1947.412) [-1951.559] (-1956.031) (-1956.011) * (-1955.742) (-1953.014) [-1956.699] (-1953.865) -- 0:01:03 16000 -- (-1943.538) [-1951.459] (-1947.616) (-1950.472) * (-1960.970) (-1952.559) (-1956.508) [-1952.712] -- 0:01:01 16500 -- (-1943.538) (-1957.187) [-1951.764] (-1950.598) * [-1957.434] (-1955.389) (-1949.532) (-1965.315) -- 0:00:59 17000 -- [-1942.946] (-1951.510) (-1949.846) (-1955.081) * (-1956.754) [-1950.873] (-1962.524) (-1948.264) -- 0:00:57 17500 -- (-1943.383) (-1958.574) [-1955.094] (-1956.634) * [-1955.121] (-1949.628) (-1952.728) (-1952.980) -- 0:00:56 18000 -- (-1944.425) [-1957.022] (-1958.166) (-1953.425) * (-1955.673) (-1956.678) [-1950.159] (-1949.760) -- 0:00:54 18500 -- (-1944.247) [-1948.450] (-1961.611) (-1955.799) * (-1948.175) [-1947.993] (-1957.067) (-1953.494) -- 0:00:53 19000 -- (-1947.293) (-1956.899) (-1953.707) [-1954.195] * (-1948.008) (-1954.367) [-1948.381] (-1963.002) -- 0:00:51 19500 -- (-1946.899) (-1950.125) [-1952.966] (-1954.828) * (-1946.187) [-1950.060] (-1963.598) (-1949.973) -- 0:00:50 20000 -- [-1943.362] (-1948.705) (-1949.987) (-1949.083) * [-1945.721] (-1963.246) (-1956.840) (-1953.344) -- 0:00:49 Average standard deviation of split frequencies: 0.063063 20500 -- (-1943.416) [-1952.562] (-1946.938) (-1950.439) * (-1945.574) [-1955.112] (-1967.427) (-1955.888) -- 0:00:47 21000 -- (-1945.181) (-1955.315) (-1949.884) [-1953.405] * (-1943.635) [-1951.045] (-1948.615) (-1951.414) -- 0:01:33 21500 -- [-1948.298] (-1958.923) (-1951.087) (-1953.458) * (-1945.781) (-1955.788) (-1946.367) [-1949.617] -- 0:01:31 22000 -- [-1942.901] (-1961.515) (-1951.322) (-1955.936) * [-1945.344] (-1948.395) (-1946.106) (-1951.149) -- 0:01:28 22500 -- (-1944.542) (-1946.876) [-1947.329] (-1955.209) * (-1944.558) [-1952.993] (-1946.840) (-1953.440) -- 0:01:26 23000 -- [-1944.579] (-1949.878) (-1945.193) (-1951.093) * (-1944.098) [-1954.179] (-1947.978) (-1955.349) -- 0:01:24 23500 -- [-1946.006] (-1956.405) (-1943.978) (-1948.492) * (-1946.903) (-1953.096) (-1946.632) [-1952.206] -- 0:01:23 24000 -- (-1944.221) [-1950.562] (-1944.540) (-1955.125) * (-1947.352) [-1957.480] (-1946.265) (-1955.501) -- 0:01:21 24500 -- (-1944.785) (-1953.432) [-1943.338] (-1957.161) * (-1945.966) (-1957.354) [-1944.544] (-1951.477) -- 0:01:19 25000 -- [-1945.489] (-1954.549) (-1945.501) (-1952.458) * (-1949.080) (-1955.343) (-1948.779) [-1954.165] -- 0:01:18 Average standard deviation of split frequencies: 0.048047 25500 -- (-1944.996) (-1960.894) (-1943.810) [-1949.450] * (-1946.423) (-1963.918) [-1943.206] (-1956.620) -- 0:01:16 26000 -- (-1946.095) (-1952.915) [-1944.326] (-1955.857) * [-1947.413] (-1952.636) (-1945.131) (-1968.771) -- 0:01:14 26500 -- (-1945.520) (-1958.751) [-1944.603] (-1954.997) * (-1947.413) (-1950.240) [-1949.568] (-1965.805) -- 0:01:13 27000 -- (-1942.608) (-1949.614) (-1944.206) [-1952.484] * [-1947.779] (-1961.258) (-1947.947) (-1959.203) -- 0:01:12 27500 -- [-1943.261] (-1950.544) (-1945.734) (-1955.207) * [-1944.496] (-1958.487) (-1945.579) (-1950.360) -- 0:01:10 28000 -- (-1943.736) (-1950.099) (-1945.335) [-1950.466] * (-1947.980) (-1959.563) (-1946.086) [-1957.430] -- 0:01:09 28500 -- [-1943.267] (-1959.324) (-1945.370) (-1951.498) * (-1945.583) (-1955.229) [-1945.317] (-1949.783) -- 0:01:08 29000 -- (-1944.566) (-1950.540) (-1944.373) [-1954.780] * [-1948.962] (-1955.818) (-1945.767) (-1956.578) -- 0:01:06 29500 -- (-1946.192) [-1953.423] (-1945.590) (-1949.234) * (-1950.087) [-1946.729] (-1945.606) (-1962.728) -- 0:01:05 30000 -- (-1945.473) (-1954.501) (-1948.886) [-1950.360] * (-1954.606) (-1959.885) [-1943.866] (-1960.282) -- 0:01:04 Average standard deviation of split frequencies: 0.046116 30500 -- (-1945.876) [-1947.263] (-1945.841) (-1957.088) * (-1952.761) [-1952.438] (-1942.717) (-1953.561) -- 0:01:03 31000 -- (-1948.504) (-1966.509) (-1944.800) [-1949.817] * [-1945.601] (-1958.289) (-1945.237) (-1955.494) -- 0:01:02 31500 -- (-1952.599) (-1963.554) (-1943.698) [-1954.148] * (-1945.229) (-1957.744) (-1945.003) [-1955.886] -- 0:01:01 32000 -- [-1945.992] (-1956.206) (-1944.259) (-1951.898) * [-1944.962] (-1958.625) (-1944.458) (-1951.578) -- 0:01:00 32500 -- (-1944.106) (-1944.649) (-1946.976) [-1955.735] * (-1945.255) (-1951.823) (-1946.234) [-1951.259] -- 0:00:59 33000 -- (-1943.510) (-1944.304) [-1947.494] (-1959.242) * (-1946.494) [-1949.619] (-1943.334) (-1960.150) -- 0:00:58 33500 -- (-1944.721) (-1944.184) [-1947.367] (-1954.581) * [-1944.584] (-1957.062) (-1943.230) (-1955.767) -- 0:00:57 34000 -- (-1944.529) [-1943.995] (-1945.759) (-1953.266) * [-1944.063] (-1956.784) (-1942.981) (-1957.627) -- 0:00:56 34500 -- (-1946.469) (-1943.236) [-1946.719] (-1960.114) * (-1943.856) (-1957.370) [-1942.960] (-1959.140) -- 0:00:55 35000 -- (-1946.022) (-1944.717) [-1944.108] (-1956.474) * [-1943.413] (-1956.174) (-1942.929) (-1950.566) -- 0:01:22 Average standard deviation of split frequencies: 0.041665 35500 -- [-1944.607] (-1942.910) (-1944.827) (-1952.607) * (-1943.502) (-1956.315) (-1943.505) [-1957.304] -- 0:01:21 36000 -- (-1943.724) [-1943.776] (-1944.787) (-1954.341) * [-1943.026] (-1952.857) (-1945.772) (-1950.484) -- 0:01:20 36500 -- (-1943.390) (-1943.774) [-1946.258] (-1963.020) * (-1944.151) (-1955.521) [-1944.328] (-1946.488) -- 0:01:19 37000 -- [-1944.395] (-1946.110) (-1946.121) (-1954.471) * (-1944.981) [-1953.218] (-1943.886) (-1946.027) -- 0:01:18 37500 -- (-1945.107) [-1944.657] (-1946.244) (-1961.186) * (-1944.473) (-1946.425) [-1944.426] (-1944.273) -- 0:01:17 38000 -- (-1943.243) (-1945.335) (-1944.833) [-1951.702] * [-1943.920] (-1953.818) (-1947.547) (-1944.127) -- 0:01:15 38500 -- (-1943.148) (-1943.169) (-1944.833) [-1954.920] * [-1943.779] (-1966.867) (-1947.528) (-1943.822) -- 0:01:14 39000 -- [-1943.364] (-1943.402) (-1947.501) (-1953.253) * (-1944.061) [-1956.270] (-1948.966) (-1944.279) -- 0:01:13 39500 -- [-1943.106] (-1943.724) (-1943.150) (-1950.976) * (-1945.937) (-1961.471) (-1944.216) [-1944.016] -- 0:01:12 40000 -- [-1943.113] (-1945.592) (-1945.089) (-1954.032) * (-1949.047) (-1951.999) (-1943.364) [-1943.302] -- 0:01:12 Average standard deviation of split frequencies: 0.035935 40500 -- (-1945.399) [-1945.538] (-1944.437) (-1955.584) * (-1948.075) (-1950.861) (-1947.826) [-1946.286] -- 0:01:11 41000 -- (-1944.176) [-1945.530] (-1945.662) (-1955.112) * (-1947.531) [-1954.387] (-1943.214) (-1947.034) -- 0:01:10 41500 -- (-1945.192) [-1944.542] (-1949.450) (-1952.531) * (-1950.366) [-1951.183] (-1944.542) (-1947.833) -- 0:01:09 42000 -- (-1946.530) [-1944.917] (-1946.851) (-1949.848) * (-1946.924) (-1955.692) (-1944.337) [-1945.653] -- 0:01:08 42500 -- (-1947.661) [-1945.397] (-1947.512) (-1960.296) * (-1943.892) [-1961.810] (-1943.477) (-1944.969) -- 0:01:07 43000 -- [-1946.508] (-1944.780) (-1946.301) (-1953.482) * (-1943.470) [-1949.442] (-1944.674) (-1944.733) -- 0:01:06 43500 -- [-1946.251] (-1947.875) (-1946.004) (-1956.331) * (-1943.576) [-1951.861] (-1944.460) (-1944.038) -- 0:01:05 44000 -- [-1945.092] (-1948.906) (-1945.477) (-1957.734) * (-1943.519) (-1955.984) [-1943.796] (-1946.701) -- 0:01:05 44500 -- (-1945.220) (-1948.822) (-1944.940) [-1956.941] * [-1945.141] (-1952.505) (-1943.856) (-1947.228) -- 0:01:04 45000 -- (-1944.332) [-1944.168] (-1946.030) (-1952.396) * (-1946.974) (-1962.547) [-1944.485] (-1946.914) -- 0:01:03 Average standard deviation of split frequencies: 0.032281 45500 -- (-1944.380) [-1945.208] (-1947.773) (-1947.262) * (-1947.497) (-1954.976) [-1944.744] (-1944.934) -- 0:01:02 46000 -- (-1944.126) (-1945.781) (-1945.325) [-1951.695] * [-1945.790] (-1949.693) (-1946.957) (-1944.225) -- 0:01:02 46500 -- (-1943.674) (-1944.003) [-1944.456] (-1958.850) * (-1945.788) (-1949.483) [-1945.988] (-1944.278) -- 0:01:01 47000 -- (-1943.441) [-1944.026] (-1945.735) (-1954.635) * (-1947.736) (-1949.685) (-1945.990) [-1944.921] -- 0:01:00 47500 -- (-1944.463) (-1946.588) [-1943.655] (-1958.818) * (-1945.817) (-1948.315) (-1947.474) [-1944.525] -- 0:01:00 48000 -- (-1944.679) [-1945.004] (-1943.655) (-1953.008) * (-1943.988) [-1947.467] (-1947.472) (-1944.544) -- 0:00:59 48500 -- (-1943.197) (-1943.645) (-1943.926) [-1956.129] * (-1943.925) (-1948.176) (-1945.346) [-1944.023] -- 0:00:58 49000 -- (-1943.385) (-1948.420) (-1943.991) [-1948.237] * (-1945.067) (-1948.111) (-1943.410) [-1943.552] -- 0:00:58 49500 -- (-1946.092) [-1946.866] (-1944.204) (-1948.734) * (-1943.608) (-1947.874) [-1942.978] (-1943.014) -- 0:01:16 50000 -- (-1946.612) [-1944.344] (-1944.730) (-1949.255) * (-1942.728) (-1947.898) [-1948.424] (-1944.542) -- 0:01:16 Average standard deviation of split frequencies: 0.033299 50500 -- (-1944.239) (-1944.584) (-1944.268) [-1948.635] * (-1942.981) (-1950.477) (-1944.255) [-1943.704] -- 0:01:15 51000 -- (-1943.905) (-1945.320) (-1945.599) [-1953.187] * (-1945.200) [-1945.114] (-1944.874) (-1942.777) -- 0:01:14 51500 -- (-1945.031) (-1945.422) [-1945.826] (-1954.257) * (-1944.924) [-1945.681] (-1944.874) (-1943.283) -- 0:01:13 52000 -- (-1944.647) (-1944.365) (-1944.629) [-1946.506] * (-1944.401) (-1943.923) [-1944.873] (-1943.700) -- 0:01:12 52500 -- [-1944.426] (-1944.377) (-1942.602) (-1960.240) * (-1945.626) (-1945.452) [-1942.939] (-1943.691) -- 0:01:12 53000 -- (-1945.629) (-1944.017) (-1943.013) [-1956.347] * (-1944.295) (-1944.823) [-1943.372] (-1943.808) -- 0:01:11 53500 -- (-1948.146) [-1944.940] (-1943.024) (-1962.895) * [-1943.473] (-1944.149) (-1943.292) (-1943.813) -- 0:01:10 54000 -- (-1946.669) [-1943.737] (-1943.275) (-1963.723) * (-1950.720) (-1944.405) (-1943.621) [-1944.810] -- 0:01:10 54500 -- (-1944.663) (-1945.981) (-1947.152) [-1949.114] * (-1945.442) [-1943.078] (-1945.917) (-1944.289) -- 0:01:09 55000 -- (-1946.273) [-1943.442] (-1944.032) (-1954.486) * [-1944.955] (-1943.194) (-1944.505) (-1942.668) -- 0:01:08 Average standard deviation of split frequencies: 0.034093 55500 -- [-1944.183] (-1942.768) (-1943.805) (-1953.619) * (-1944.955) (-1943.087) [-1943.942] (-1944.787) -- 0:01:08 56000 -- (-1943.213) (-1943.230) (-1943.560) [-1955.917] * (-1944.375) (-1946.835) [-1946.213] (-1943.331) -- 0:01:07 56500 -- (-1942.634) (-1944.020) (-1947.247) [-1950.587] * (-1943.584) (-1945.513) [-1943.657] (-1943.293) -- 0:01:06 57000 -- (-1942.737) (-1943.661) (-1946.312) [-1951.373] * (-1945.729) [-1945.895] (-1943.925) (-1943.219) -- 0:01:06 57500 -- [-1943.217] (-1946.844) (-1946.137) (-1954.582) * (-1944.029) (-1944.105) [-1945.594] (-1944.672) -- 0:01:05 58000 -- (-1944.245) (-1945.097) (-1945.187) [-1949.377] * (-1944.088) [-1944.232] (-1949.531) (-1944.195) -- 0:01:04 58500 -- (-1944.407) (-1944.873) (-1943.654) [-1950.887] * [-1943.334] (-1945.242) (-1949.832) (-1946.791) -- 0:01:04 59000 -- (-1943.891) [-1946.074] (-1943.344) (-1964.199) * (-1943.334) (-1945.177) (-1946.485) [-1945.253] -- 0:01:03 59500 -- (-1944.616) [-1947.313] (-1944.725) (-1952.841) * (-1946.031) [-1945.037] (-1947.905) (-1948.101) -- 0:01:03 60000 -- (-1946.030) (-1944.664) (-1943.328) [-1948.095] * (-1946.010) [-1947.342] (-1948.942) (-1944.636) -- 0:01:02 Average standard deviation of split frequencies: 0.037298 60500 -- (-1951.749) (-1943.615) [-1943.367] (-1947.940) * (-1945.369) (-1946.884) (-1946.870) [-1946.727] -- 0:01:02 61000 -- (-1953.266) [-1943.649] (-1943.293) (-1946.816) * [-1945.774] (-1946.554) (-1948.123) (-1951.508) -- 0:01:01 61500 -- (-1947.287) (-1946.297) (-1943.079) [-1944.792] * (-1945.168) [-1944.897] (-1948.425) (-1944.129) -- 0:01:01 62000 -- (-1948.544) (-1943.688) [-1943.076] (-1945.801) * (-1945.117) [-1944.605] (-1947.574) (-1944.495) -- 0:01:00 62500 -- (-1948.358) [-1945.882] (-1943.932) (-1943.874) * [-1946.369] (-1945.493) (-1947.056) (-1944.507) -- 0:01:00 63000 -- (-1945.824) [-1944.059] (-1943.936) (-1943.680) * (-1945.806) (-1947.265) (-1945.091) [-1944.886] -- 0:00:59 63500 -- (-1951.698) (-1944.875) [-1943.722] (-1943.686) * [-1943.607] (-1948.367) (-1944.336) (-1944.954) -- 0:00:58 64000 -- [-1945.266] (-1943.866) (-1943.994) (-1945.726) * (-1943.909) (-1943.725) (-1944.336) [-1943.924] -- 0:00:58 64500 -- (-1947.046) (-1944.165) (-1943.932) [-1943.318] * (-1942.849) (-1950.253) (-1943.963) [-1945.740] -- 0:01:12 65000 -- (-1948.238) (-1943.468) [-1944.147] (-1944.264) * [-1946.033] (-1948.765) (-1946.443) (-1943.982) -- 0:01:11 Average standard deviation of split frequencies: 0.028910 65500 -- (-1948.057) (-1943.534) (-1945.246) [-1944.275] * (-1945.054) (-1945.858) (-1947.166) [-1942.743] -- 0:01:11 66000 -- [-1944.597] (-1944.667) (-1945.389) (-1944.526) * (-1943.450) (-1944.245) [-1946.092] (-1944.020) -- 0:01:10 66500 -- (-1944.987) (-1946.802) (-1946.762) [-1945.452] * (-1944.469) (-1943.225) (-1944.082) [-1944.528] -- 0:01:10 67000 -- (-1947.287) (-1944.423) [-1946.564] (-1945.717) * (-1944.386) (-1943.316) (-1943.721) [-1945.320] -- 0:01:09 67500 -- (-1946.723) (-1943.790) [-1947.143] (-1946.536) * (-1943.560) (-1943.353) (-1943.032) [-1944.654] -- 0:01:09 68000 -- (-1947.675) [-1943.383] (-1947.223) (-1946.876) * (-1944.036) (-1942.824) (-1944.126) [-1944.714] -- 0:01:08 68500 -- (-1948.656) (-1944.997) (-1943.400) [-1945.557] * (-1943.804) [-1945.527] (-1944.288) (-1948.522) -- 0:01:07 69000 -- (-1947.237) [-1945.405] (-1944.446) (-1945.095) * (-1946.307) [-1945.298] (-1946.600) (-1948.472) -- 0:01:07 69500 -- [-1943.698] (-1945.307) (-1944.187) (-1948.457) * (-1948.371) [-1945.254] (-1944.698) (-1945.589) -- 0:01:06 70000 -- [-1943.308] (-1949.627) (-1945.381) (-1947.594) * (-1946.594) (-1944.144) (-1946.581) [-1947.362] -- 0:01:06 Average standard deviation of split frequencies: 0.032020 70500 -- (-1943.226) [-1944.870] (-1944.240) (-1943.591) * (-1950.909) [-1947.042] (-1944.434) (-1945.647) -- 0:01:05 71000 -- (-1943.685) [-1943.821] (-1948.189) (-1943.699) * (-1950.565) (-1947.954) [-1948.520] (-1948.169) -- 0:01:05 71500 -- (-1943.696) [-1944.978] (-1947.917) (-1943.787) * (-1946.454) [-1948.598] (-1948.799) (-1944.543) -- 0:01:04 72000 -- (-1944.798) (-1945.744) [-1944.632] (-1943.760) * (-1943.762) (-1946.960) (-1945.334) [-1942.783] -- 0:01:04 72500 -- (-1947.416) (-1943.978) [-1944.743] (-1945.521) * (-1944.207) (-1949.024) [-1944.099] (-1944.869) -- 0:01:03 73000 -- [-1945.572] (-1946.236) (-1947.696) (-1943.868) * (-1944.046) (-1947.013) (-1943.570) [-1946.296] -- 0:01:03 73500 -- (-1944.171) [-1944.546] (-1946.276) (-1943.868) * (-1946.686) [-1948.080] (-1945.413) (-1945.115) -- 0:01:03 74000 -- [-1949.201] (-1945.805) (-1947.468) (-1945.116) * [-1947.840] (-1944.564) (-1943.837) (-1944.035) -- 0:01:02 74500 -- (-1944.204) (-1944.269) [-1945.511] (-1945.290) * [-1946.606] (-1946.246) (-1945.858) (-1943.717) -- 0:01:02 75000 -- (-1944.438) (-1943.890) (-1945.662) [-1945.374] * (-1945.900) [-1946.246] (-1946.839) (-1947.609) -- 0:01:01 Average standard deviation of split frequencies: 0.031358 75500 -- [-1945.836] (-1943.394) (-1945.025) (-1946.709) * (-1945.944) [-1944.643] (-1949.712) (-1946.881) -- 0:01:01 76000 -- (-1944.155) [-1944.238] (-1948.737) (-1944.855) * (-1943.946) [-1943.991] (-1944.384) (-1944.892) -- 0:01:00 76500 -- (-1946.083) [-1946.239] (-1947.936) (-1944.031) * (-1943.112) (-1944.049) (-1944.829) [-1945.750] -- 0:01:00 77000 -- (-1945.681) (-1945.408) (-1945.362) [-1943.042] * (-1943.068) (-1948.791) [-1947.733] (-1944.470) -- 0:00:59 77500 -- [-1943.465] (-1945.117) (-1943.904) (-1943.345) * [-1943.553] (-1945.945) (-1950.476) (-1947.036) -- 0:00:59 78000 -- (-1943.594) [-1945.990] (-1950.016) (-1944.138) * [-1942.787] (-1946.152) (-1944.233) (-1945.746) -- 0:00:59 78500 -- (-1944.943) [-1946.004] (-1945.428) (-1943.823) * (-1942.786) [-1944.552] (-1944.608) (-1948.561) -- 0:00:58 79000 -- (-1947.164) (-1945.336) (-1943.215) [-1945.040] * [-1942.966] (-1943.571) (-1944.989) (-1947.152) -- 0:00:58 79500 -- (-1945.574) (-1944.102) [-1943.705] (-1945.194) * (-1942.949) (-1944.438) [-1946.567] (-1947.649) -- 0:01:09 80000 -- [-1943.798] (-1947.591) (-1943.812) (-1947.187) * (-1944.136) (-1944.671) (-1949.228) [-1943.091] -- 0:01:09 Average standard deviation of split frequencies: 0.032603 80500 -- (-1944.828) (-1946.018) [-1943.577] (-1946.772) * (-1945.082) [-1944.741] (-1949.657) (-1948.167) -- 0:01:08 81000 -- [-1946.392] (-1945.321) (-1943.422) (-1946.114) * [-1946.233] (-1944.935) (-1948.707) (-1946.041) -- 0:01:08 81500 -- (-1946.935) (-1943.497) (-1946.608) [-1945.381] * (-1945.750) (-1945.008) [-1948.284] (-1943.390) -- 0:01:07 82000 -- (-1946.609) (-1945.615) [-1943.476] (-1946.662) * (-1944.298) (-1946.638) (-1952.849) [-1943.590] -- 0:01:07 82500 -- (-1946.948) [-1946.299] (-1943.503) (-1944.593) * (-1945.716) (-1948.646) (-1948.911) [-1943.907] -- 0:01:06 83000 -- (-1946.534) (-1945.643) [-1943.650] (-1944.653) * (-1944.635) [-1945.555] (-1953.912) (-1943.847) -- 0:01:06 83500 -- (-1943.476) [-1942.837] (-1944.152) (-1943.842) * [-1946.223] (-1948.212) (-1950.375) (-1943.441) -- 0:01:05 84000 -- (-1944.462) (-1943.120) (-1944.879) [-1945.356] * [-1943.200] (-1943.696) (-1943.366) (-1943.376) -- 0:01:05 84500 -- (-1944.478) [-1943.251] (-1944.313) (-1947.389) * (-1943.473) (-1944.435) (-1944.144) [-1943.208] -- 0:01:05 85000 -- (-1943.378) [-1944.020] (-1944.291) (-1948.365) * (-1943.166) (-1943.789) (-1949.031) [-1943.232] -- 0:01:04 Average standard deviation of split frequencies: 0.032889 85500 -- [-1943.378] (-1944.039) (-1943.816) (-1948.876) * [-1944.592] (-1947.731) (-1946.825) (-1943.186) -- 0:01:04 86000 -- (-1943.394) (-1948.060) [-1943.606] (-1943.936) * (-1944.468) (-1944.401) (-1946.734) [-1943.959] -- 0:01:03 86500 -- (-1944.445) (-1948.114) (-1947.019) [-1944.053] * (-1943.661) (-1944.280) (-1946.094) [-1945.087] -- 0:01:03 87000 -- (-1943.033) (-1944.648) [-1947.021] (-1942.871) * (-1943.481) [-1943.016] (-1949.075) (-1943.663) -- 0:01:02 87500 -- [-1942.616] (-1943.749) (-1943.130) (-1942.871) * (-1943.588) [-1943.680] (-1948.906) (-1943.524) -- 0:01:02 88000 -- (-1943.173) [-1943.261] (-1943.475) (-1943.499) * (-1951.328) [-1943.573] (-1949.983) (-1944.794) -- 0:01:02 88500 -- (-1945.786) (-1943.562) [-1945.753] (-1947.502) * (-1952.401) (-1943.970) (-1947.885) [-1944.976] -- 0:01:01 89000 -- (-1943.875) (-1944.665) [-1946.960] (-1948.521) * (-1944.592) (-1944.020) [-1946.924] (-1948.074) -- 0:01:01 89500 -- (-1944.364) [-1944.597] (-1945.061) (-1944.323) * [-1947.026] (-1945.268) (-1948.711) (-1946.945) -- 0:01:01 90000 -- [-1944.209] (-1946.607) (-1943.370) (-1945.898) * (-1947.287) [-1944.118] (-1947.955) (-1943.210) -- 0:01:00 Average standard deviation of split frequencies: 0.034575 90500 -- [-1943.089] (-1944.178) (-1945.524) (-1947.540) * (-1943.900) (-1946.477) (-1946.339) [-1944.399] -- 0:01:00 91000 -- [-1943.786] (-1943.248) (-1945.358) (-1945.439) * (-1943.892) (-1944.226) (-1946.869) [-1943.545] -- 0:00:59 91500 -- (-1943.056) [-1944.725] (-1947.504) (-1944.144) * (-1946.033) (-1944.804) (-1948.712) [-1944.087] -- 0:00:59 92000 -- (-1945.898) [-1944.079] (-1949.837) (-1946.699) * (-1944.758) [-1944.035] (-1945.299) (-1948.012) -- 0:00:59 92500 -- (-1946.835) [-1945.009] (-1952.738) (-1946.923) * (-1945.927) [-1945.239] (-1943.990) (-1946.033) -- 0:00:58 93000 -- (-1944.824) [-1945.555] (-1951.430) (-1945.740) * [-1945.390] (-1943.819) (-1944.964) (-1947.351) -- 0:00:58 93500 -- (-1945.460) (-1945.846) (-1946.078) [-1942.896] * [-1944.459] (-1943.926) (-1944.392) (-1944.570) -- 0:00:58 94000 -- [-1947.200] (-1945.275) (-1945.953) (-1942.896) * [-1946.710] (-1948.712) (-1943.876) (-1943.346) -- 0:00:57 94500 -- (-1945.843) [-1946.105] (-1946.924) (-1943.811) * (-1945.981) [-1944.410] (-1944.902) (-1943.429) -- 0:00:57 95000 -- (-1946.369) (-1943.075) [-1948.176] (-1944.529) * [-1945.160] (-1947.090) (-1943.549) (-1942.649) -- 0:01:06 Average standard deviation of split frequencies: 0.032900 95500 -- (-1944.637) [-1942.558] (-1947.025) (-1944.153) * [-1946.243] (-1943.811) (-1943.530) (-1942.603) -- 0:01:06 96000 -- (-1945.552) [-1942.519] (-1945.311) (-1946.096) * (-1944.687) (-1946.110) (-1945.742) [-1942.845] -- 0:01:05 96500 -- (-1943.244) (-1942.924) (-1944.387) [-1943.047] * (-1945.174) (-1944.576) (-1943.890) [-1944.496] -- 0:01:05 97000 -- [-1943.483] (-1942.972) (-1944.188) (-1943.172) * (-1943.241) (-1945.994) (-1945.391) [-1947.334] -- 0:01:05 97500 -- (-1943.563) [-1943.028] (-1944.257) (-1944.305) * (-1945.426) [-1943.984] (-1944.776) (-1946.879) -- 0:01:04 98000 -- (-1942.829) (-1944.403) [-1944.669] (-1944.063) * (-1944.991) (-1942.805) [-1943.879] (-1946.693) -- 0:01:04 98500 -- [-1942.583] (-1945.638) (-1944.106) (-1944.437) * (-1944.642) (-1943.135) (-1943.442) [-1947.596] -- 0:01:04 99000 -- [-1943.477] (-1945.052) (-1946.332) (-1943.259) * (-1946.757) (-1943.135) (-1944.360) [-1948.524] -- 0:01:03 99500 -- (-1948.698) (-1944.528) (-1947.250) [-1947.168] * [-1943.264] (-1943.567) (-1944.406) (-1951.836) -- 0:01:03 100000 -- (-1945.466) [-1945.315] (-1948.327) (-1943.924) * (-1943.720) [-1944.255] (-1944.535) (-1943.712) -- 0:01:02 Average standard deviation of split frequencies: 0.027395 100500 -- (-1943.354) (-1945.244) [-1945.075] (-1944.531) * (-1943.720) [-1944.798] (-1947.416) (-1944.591) -- 0:01:02 101000 -- (-1945.498) (-1948.566) (-1946.475) [-1944.956] * (-1943.796) (-1944.813) (-1944.211) [-1943.685] -- 0:01:02 101500 -- (-1946.224) (-1946.520) (-1947.655) [-1945.077] * [-1943.339] (-1943.458) (-1944.042) (-1943.236) -- 0:01:01 102000 -- (-1945.925) (-1946.103) [-1946.580] (-1944.509) * (-1944.009) (-1944.844) (-1944.278) [-1943.328] -- 0:01:01 102500 -- (-1945.761) (-1946.419) [-1944.694] (-1944.892) * [-1945.762] (-1945.904) (-1942.725) (-1943.347) -- 0:01:01 103000 -- (-1945.301) (-1946.062) (-1943.884) [-1943.321] * [-1944.700] (-1947.935) (-1945.162) (-1943.574) -- 0:01:00 103500 -- (-1946.238) (-1947.065) (-1943.204) [-1946.184] * (-1944.131) (-1945.320) [-1944.815] (-1943.069) -- 0:01:00 104000 -- (-1950.009) (-1943.501) (-1943.445) [-1947.706] * (-1943.087) (-1944.386) [-1944.565] (-1942.838) -- 0:01:00 104500 -- [-1948.103] (-1944.472) (-1946.190) (-1944.537) * (-1943.086) [-1943.775] (-1943.724) (-1943.445) -- 0:00:59 105000 -- (-1948.927) [-1944.594] (-1945.169) (-1943.878) * [-1946.941] (-1943.795) (-1944.415) (-1942.847) -- 0:00:59 Average standard deviation of split frequencies: 0.023793 105500 -- (-1947.188) (-1949.170) [-1945.531] (-1944.778) * [-1948.624] (-1943.620) (-1947.813) (-1945.157) -- 0:00:59 106000 -- (-1945.932) [-1948.272] (-1945.529) (-1943.792) * (-1943.798) (-1943.502) (-1945.783) [-1942.972] -- 0:00:59 106500 -- (-1944.227) [-1944.221] (-1948.799) (-1943.707) * (-1946.167) [-1944.134] (-1945.250) (-1942.977) -- 0:00:58 107000 -- (-1943.997) (-1943.144) (-1943.509) [-1944.989] * (-1948.627) (-1945.257) [-1944.652] (-1946.015) -- 0:00:58 107500 -- (-1949.799) (-1942.875) (-1945.388) [-1947.107] * (-1948.545) (-1943.565) (-1944.063) [-1943.569] -- 0:00:58 108000 -- [-1943.915] (-1943.590) (-1943.418) (-1944.693) * [-1946.515] (-1946.145) (-1945.222) (-1950.449) -- 0:00:57 108500 -- (-1943.765) (-1942.926) [-1942.992] (-1944.454) * (-1943.992) (-1946.308) (-1944.765) [-1944.103] -- 0:00:57 109000 -- (-1944.329) [-1943.909] (-1942.534) (-1943.147) * (-1944.316) (-1945.558) [-1943.326] (-1945.613) -- 0:00:57 109500 -- (-1945.083) (-1946.356) (-1946.316) [-1946.560] * (-1947.098) [-1945.358] (-1944.709) (-1946.640) -- 0:00:56 110000 -- (-1944.068) (-1944.219) (-1945.222) [-1944.656] * [-1945.746] (-1946.977) (-1944.577) (-1946.302) -- 0:00:56 Average standard deviation of split frequencies: 0.025558 110500 -- (-1944.505) (-1944.459) (-1946.429) [-1943.712] * [-1945.070] (-1946.520) (-1944.929) (-1943.938) -- 0:01:04 111000 -- (-1944.028) [-1943.830] (-1944.325) (-1945.157) * (-1945.955) [-1947.024] (-1943.817) (-1947.949) -- 0:01:04 111500 -- (-1943.913) (-1944.680) (-1944.724) [-1943.296] * (-1956.998) (-1943.497) [-1944.275] (-1947.573) -- 0:01:03 112000 -- [-1944.092] (-1946.431) (-1945.075) (-1948.290) * [-1946.264] (-1944.195) (-1946.080) (-1947.851) -- 0:01:03 112500 -- (-1944.363) (-1942.970) [-1943.771] (-1945.124) * (-1946.554) [-1943.674] (-1944.118) (-1948.045) -- 0:01:03 113000 -- (-1944.160) (-1945.641) [-1943.895] (-1945.417) * [-1946.829] (-1943.083) (-1943.745) (-1946.477) -- 0:01:02 113500 -- (-1946.704) (-1945.597) [-1943.847] (-1945.603) * (-1946.479) (-1944.323) (-1943.454) [-1950.712] -- 0:01:02 114000 -- (-1946.595) (-1944.880) (-1943.932) [-1946.147] * (-1946.855) (-1945.057) (-1943.990) [-1944.621] -- 0:01:02 114500 -- (-1945.372) (-1949.035) [-1947.215] (-1946.851) * (-1946.132) (-1946.648) (-1945.398) [-1946.287] -- 0:01:01 115000 -- (-1946.722) (-1946.579) (-1946.258) [-1945.477] * (-1942.491) (-1944.496) [-1943.722] (-1944.813) -- 0:01:01 Average standard deviation of split frequencies: 0.025738 115500 -- (-1947.590) [-1946.657] (-1944.454) (-1944.532) * [-1946.440] (-1944.208) (-1944.960) (-1947.328) -- 0:01:01 116000 -- [-1944.372] (-1948.678) (-1944.925) (-1946.834) * (-1946.505) (-1943.938) [-1945.744] (-1944.733) -- 0:01:00 116500 -- (-1944.771) [-1943.776] (-1948.244) (-1948.060) * (-1944.037) (-1946.306) [-1944.906] (-1946.492) -- 0:01:00 117000 -- (-1943.951) (-1943.577) [-1945.987] (-1950.156) * [-1943.381] (-1945.515) (-1948.562) (-1945.986) -- 0:01:00 117500 -- [-1943.850] (-1944.036) (-1946.143) (-1951.316) * (-1943.387) [-1947.744] (-1946.391) (-1949.859) -- 0:01:00 118000 -- [-1944.640] (-1943.913) (-1943.588) (-1950.509) * (-1946.414) [-1950.954] (-1946.251) (-1945.247) -- 0:00:59 118500 -- (-1945.871) [-1944.226] (-1944.042) (-1944.653) * (-1946.301) (-1948.451) (-1946.328) [-1945.500] -- 0:00:59 119000 -- (-1945.176) [-1946.424] (-1943.216) (-1944.480) * (-1948.672) (-1950.145) [-1946.806] (-1946.767) -- 0:00:59 119500 -- [-1944.443] (-1945.675) (-1945.140) (-1944.696) * [-1945.822] (-1946.280) (-1945.083) (-1943.407) -- 0:00:58 120000 -- (-1944.362) (-1945.393) (-1944.981) [-1945.354] * [-1946.648] (-1943.895) (-1945.642) (-1943.675) -- 0:00:58 Average standard deviation of split frequencies: 0.027347 120500 -- (-1944.546) [-1944.212] (-1945.347) (-1945.172) * [-1945.793] (-1943.517) (-1943.773) (-1945.909) -- 0:00:58 121000 -- (-1945.477) (-1944.650) (-1946.503) [-1945.105] * (-1944.696) (-1943.623) [-1944.060] (-1945.908) -- 0:00:58 121500 -- (-1945.324) (-1949.214) (-1945.594) [-1945.239] * (-1943.388) (-1943.900) (-1943.361) [-1942.953] -- 0:00:57 122000 -- (-1944.500) [-1948.914] (-1946.008) (-1943.649) * (-1943.195) (-1947.689) (-1943.783) [-1943.575] -- 0:00:57 122500 -- (-1944.143) (-1945.843) [-1949.058] (-1945.595) * (-1943.326) (-1944.476) [-1944.181] (-1948.904) -- 0:00:57 123000 -- (-1944.142) [-1944.705] (-1945.516) (-1944.166) * [-1945.737] (-1943.435) (-1944.918) (-1946.298) -- 0:00:57 123500 -- [-1944.320] (-1945.020) (-1944.465) (-1943.254) * (-1950.130) (-1944.106) (-1945.294) [-1947.190] -- 0:00:56 124000 -- (-1944.156) (-1944.893) (-1944.880) [-1945.577] * (-1947.612) (-1945.235) [-1943.614] (-1946.674) -- 0:00:56 124500 -- (-1944.378) [-1945.091] (-1949.535) (-1944.911) * (-1954.664) [-1944.085] (-1947.325) (-1945.281) -- 0:00:56 125000 -- (-1948.282) [-1944.908] (-1946.114) (-1944.010) * (-1947.665) [-1943.578] (-1943.941) (-1942.936) -- 0:00:56 Average standard deviation of split frequencies: 0.026189 125500 -- [-1944.424] (-1943.851) (-1949.538) (-1944.728) * (-1949.129) [-1942.832] (-1943.515) (-1945.223) -- 0:01:02 126000 -- [-1944.396] (-1943.718) (-1951.544) (-1943.889) * (-1947.412) (-1945.373) [-1944.190] (-1944.695) -- 0:01:02 126500 -- [-1945.509] (-1948.127) (-1947.540) (-1942.803) * (-1946.934) (-1945.207) [-1944.243] (-1948.357) -- 0:01:02 127000 -- (-1944.477) (-1954.785) (-1944.141) [-1943.769] * [-1946.799] (-1946.570) (-1943.412) (-1943.443) -- 0:01:01 127500 -- [-1943.245] (-1946.398) (-1944.162) (-1945.077) * (-1947.584) (-1945.607) [-1942.596] (-1943.702) -- 0:01:01 128000 -- (-1948.368) [-1945.590] (-1943.761) (-1947.179) * (-1946.583) (-1945.142) [-1943.075] (-1948.393) -- 0:01:01 128500 -- (-1943.713) [-1944.622] (-1943.067) (-1945.352) * (-1946.016) [-1945.139] (-1943.580) (-1943.099) -- 0:01:01 129000 -- (-1943.801) (-1946.149) (-1942.673) [-1945.195] * (-1947.616) (-1945.078) (-1943.078) [-1945.525] -- 0:01:00 129500 -- (-1943.886) (-1946.173) [-1945.708] (-1945.461) * (-1949.633) [-1947.530] (-1942.718) (-1949.639) -- 0:01:00 130000 -- (-1943.846) [-1945.652] (-1943.974) (-1946.866) * (-1944.745) [-1945.010] (-1942.833) (-1943.202) -- 0:01:00 Average standard deviation of split frequencies: 0.023089 130500 -- (-1943.832) [-1945.573] (-1945.001) (-1949.523) * (-1945.051) [-1945.154] (-1944.989) (-1944.172) -- 0:00:59 131000 -- (-1944.018) (-1944.459) [-1943.964] (-1945.957) * (-1943.197) (-1947.679) (-1947.056) [-1946.597] -- 0:00:59 131500 -- (-1945.292) [-1944.126] (-1944.977) (-1946.369) * [-1943.785] (-1944.615) (-1943.682) (-1945.378) -- 0:00:59 132000 -- [-1944.332] (-1944.160) (-1945.233) (-1945.674) * [-1943.751] (-1949.674) (-1946.934) (-1945.083) -- 0:00:59 132500 -- (-1944.054) [-1943.326] (-1944.069) (-1948.930) * (-1945.025) (-1945.740) [-1942.833] (-1943.649) -- 0:00:58 133000 -- [-1944.948] (-1945.531) (-1947.446) (-1947.590) * (-1943.567) [-1944.477] (-1943.131) (-1943.650) -- 0:00:58 133500 -- (-1945.171) (-1947.285) [-1943.698] (-1944.301) * (-1944.128) (-1944.477) [-1943.130] (-1943.268) -- 0:00:58 134000 -- (-1943.101) [-1945.268] (-1944.615) (-1945.218) * (-1947.374) [-1943.572] (-1943.904) (-1944.858) -- 0:00:58 134500 -- (-1945.140) [-1943.667] (-1944.545) (-1942.634) * (-1945.686) [-1943.571] (-1943.026) (-1944.858) -- 0:00:57 135000 -- (-1943.444) (-1943.584) (-1944.506) [-1942.636] * (-1943.496) [-1943.571] (-1944.050) (-1944.048) -- 0:00:57 Average standard deviation of split frequencies: 0.024090 135500 -- (-1945.301) (-1945.040) [-1944.194] (-1944.368) * [-1945.226] (-1947.284) (-1944.262) (-1943.574) -- 0:00:57 136000 -- (-1945.166) (-1945.175) (-1944.999) [-1945.380] * (-1945.574) [-1947.134] (-1944.883) (-1943.738) -- 0:00:57 136500 -- [-1946.007] (-1945.804) (-1945.636) (-1943.796) * (-1944.581) (-1945.018) [-1943.368] (-1945.974) -- 0:00:56 137000 -- (-1944.873) (-1946.175) (-1944.257) [-1943.796] * (-1944.481) [-1944.197] (-1943.370) (-1946.754) -- 0:00:56 137500 -- (-1947.189) [-1944.140] (-1946.175) (-1943.231) * [-1945.379] (-1944.978) (-1946.467) (-1945.619) -- 0:00:56 138000 -- (-1945.915) (-1942.653) [-1946.455] (-1943.064) * [-1944.861] (-1943.474) (-1946.098) (-1945.590) -- 0:00:56 138500 -- (-1945.369) [-1942.685] (-1945.637) (-1943.068) * [-1947.051] (-1944.252) (-1943.875) (-1946.436) -- 0:00:55 139000 -- (-1945.646) [-1942.828] (-1943.552) (-1944.493) * (-1947.450) [-1944.070] (-1947.907) (-1948.801) -- 0:00:55 139500 -- (-1946.047) (-1944.007) (-1945.632) [-1944.493] * (-1945.036) [-1943.936] (-1948.285) (-1945.243) -- 0:00:55 140000 -- (-1945.831) [-1945.866] (-1948.935) (-1945.059) * (-1945.779) (-1944.321) (-1950.529) [-1945.783] -- 0:00:55 Average standard deviation of split frequencies: 0.022577 140500 -- (-1945.559) [-1944.125] (-1944.982) (-1945.626) * [-1946.115] (-1945.134) (-1949.820) (-1947.084) -- 0:00:55 141000 -- [-1945.642] (-1945.791) (-1945.071) (-1945.983) * (-1952.121) (-1945.617) (-1947.734) [-1951.556] -- 0:01:00 141500 -- (-1945.077) (-1947.531) (-1943.646) [-1945.983] * [-1946.040] (-1946.181) (-1945.437) (-1950.215) -- 0:01:00 142000 -- (-1944.230) [-1947.798] (-1943.927) (-1942.593) * (-1946.557) (-1944.743) [-1946.664] (-1947.280) -- 0:01:00 142500 -- [-1945.044] (-1946.044) (-1946.189) (-1942.686) * (-1948.340) [-1944.579] (-1946.197) (-1943.829) -- 0:01:00 143000 -- [-1945.446] (-1946.302) (-1947.170) (-1945.087) * (-1945.669) (-1943.456) [-1945.636] (-1944.187) -- 0:00:59 143500 -- (-1945.052) (-1945.679) (-1945.203) [-1944.148] * (-1946.853) (-1946.592) [-1945.336] (-1946.196) -- 0:00:59 144000 -- (-1948.143) (-1948.383) [-1944.618] (-1945.162) * [-1944.444] (-1946.952) (-1945.336) (-1946.191) -- 0:00:59 144500 -- (-1951.143) (-1949.116) (-1944.386) [-1943.733] * [-1945.770] (-1943.729) (-1946.708) (-1943.172) -- 0:00:59 145000 -- (-1946.585) (-1948.793) [-1945.765] (-1943.982) * (-1945.548) (-1943.737) (-1945.098) [-1945.767] -- 0:00:58 Average standard deviation of split frequencies: 0.021582 145500 -- (-1945.292) (-1947.771) (-1945.934) [-1943.969] * (-1946.355) (-1946.432) (-1943.857) [-1946.370] -- 0:00:58 146000 -- [-1946.285] (-1946.967) (-1944.905) (-1943.882) * [-1945.079] (-1947.805) (-1944.847) (-1943.717) -- 0:00:58 146500 -- (-1947.554) [-1944.625] (-1945.303) (-1943.782) * (-1945.430) [-1947.680] (-1944.920) (-1944.023) -- 0:00:58 147000 -- (-1947.964) (-1944.783) [-1944.887] (-1943.647) * [-1944.376] (-1943.586) (-1946.969) (-1944.826) -- 0:00:58 147500 -- (-1944.020) [-1945.114] (-1946.547) (-1942.617) * [-1944.485] (-1942.975) (-1947.211) (-1944.030) -- 0:00:57 148000 -- (-1953.114) [-1943.062] (-1947.386) (-1942.717) * (-1950.919) (-1943.072) [-1944.439] (-1943.701) -- 0:00:57 148500 -- (-1945.646) (-1943.099) (-1946.885) [-1942.906] * (-1948.981) [-1944.068] (-1945.192) (-1945.435) -- 0:00:57 149000 -- (-1944.716) (-1943.123) [-1946.157] (-1943.851) * [-1943.737] (-1944.042) (-1944.583) (-1945.178) -- 0:00:57 149500 -- (-1944.346) (-1943.339) (-1945.312) [-1943.706] * (-1946.151) [-1944.500] (-1947.296) (-1943.869) -- 0:00:56 150000 -- (-1945.281) (-1943.485) (-1945.747) [-1944.153] * (-1948.110) [-1943.455] (-1945.397) (-1943.776) -- 0:00:56 Average standard deviation of split frequencies: 0.018773 150500 -- (-1944.659) (-1942.612) (-1947.781) [-1945.246] * (-1943.827) (-1944.302) (-1946.868) [-1943.775] -- 0:00:56 151000 -- (-1944.219) (-1942.841) (-1944.858) [-1947.466] * (-1944.132) [-1943.933] (-1947.253) (-1943.773) -- 0:00:56 151500 -- [-1945.898] (-1943.955) (-1944.991) (-1945.094) * (-1950.345) (-1945.058) (-1944.874) [-1943.565] -- 0:00:56 152000 -- (-1946.476) (-1947.637) (-1943.790) [-1943.678] * (-1945.331) [-1943.403] (-1944.520) (-1943.010) -- 0:00:55 152500 -- (-1951.041) (-1944.790) [-1943.365] (-1943.999) * [-1945.884] (-1944.165) (-1946.312) (-1945.666) -- 0:00:55 153000 -- (-1946.585) [-1944.772] (-1943.457) (-1944.382) * (-1944.076) [-1943.299] (-1946.528) (-1948.966) -- 0:00:55 153500 -- [-1944.111] (-1945.451) (-1949.003) (-1945.104) * (-1943.661) (-1942.891) (-1944.222) [-1945.957] -- 0:00:55 154000 -- [-1944.637] (-1943.021) (-1945.432) (-1947.699) * (-1949.288) (-1944.307) [-1945.437] (-1948.883) -- 0:00:54 154500 -- (-1943.808) [-1943.383] (-1945.979) (-1946.979) * (-1946.058) (-1947.576) (-1945.339) [-1949.016] -- 0:00:54 155000 -- [-1943.644] (-1944.629) (-1943.966) (-1945.394) * (-1944.602) [-1943.865] (-1945.934) (-1947.108) -- 0:00:54 Average standard deviation of split frequencies: 0.018608 155500 -- [-1944.120] (-1946.829) (-1944.571) (-1946.608) * [-1945.311] (-1943.148) (-1945.348) (-1948.555) -- 0:00:54 156000 -- (-1944.610) (-1944.465) (-1945.636) [-1945.483] * (-1946.762) [-1942.837] (-1944.295) (-1944.862) -- 0:00:54 156500 -- (-1945.781) (-1950.468) (-1944.287) [-1947.410] * (-1949.093) (-1942.836) [-1944.067] (-1943.807) -- 0:00:59 157000 -- [-1943.394] (-1945.697) (-1944.579) (-1948.844) * (-1944.377) [-1944.114] (-1944.920) (-1947.686) -- 0:00:59 157500 -- (-1945.051) (-1945.949) (-1943.554) [-1946.885] * (-1944.558) [-1946.651] (-1944.548) (-1949.040) -- 0:00:58 158000 -- (-1945.046) [-1945.307] (-1943.410) (-1946.668) * [-1942.913] (-1942.831) (-1949.876) (-1944.083) -- 0:00:58 158500 -- (-1944.514) [-1947.605] (-1946.026) (-1949.344) * (-1942.918) (-1943.104) (-1949.541) [-1944.808] -- 0:00:58 159000 -- (-1943.565) [-1950.191] (-1944.311) (-1945.437) * (-1948.765) [-1944.639] (-1948.153) (-1945.003) -- 0:00:58 159500 -- [-1944.405] (-1946.196) (-1945.934) (-1945.810) * (-1947.011) (-1944.639) (-1944.154) [-1945.057] -- 0:00:57 160000 -- [-1945.496] (-1944.759) (-1947.097) (-1945.369) * (-1944.868) [-1943.888] (-1946.589) (-1946.567) -- 0:00:57 Average standard deviation of split frequencies: 0.016987 160500 -- (-1944.098) (-1944.892) (-1944.414) [-1950.851] * (-1944.435) [-1943.963] (-1943.547) (-1947.464) -- 0:00:57 161000 -- (-1944.054) [-1944.008] (-1945.151) (-1950.199) * (-1945.629) (-1943.596) [-1945.652] (-1945.533) -- 0:00:57 161500 -- [-1944.065] (-1947.142) (-1947.036) (-1945.380) * (-1943.402) (-1947.032) (-1945.642) [-1945.395] -- 0:00:57 162000 -- (-1943.920) [-1943.530] (-1950.399) (-1946.233) * (-1943.269) [-1946.300] (-1943.951) (-1945.853) -- 0:00:56 162500 -- (-1944.942) (-1943.271) [-1948.081] (-1946.428) * [-1944.385] (-1944.286) (-1943.029) (-1943.886) -- 0:00:56 163000 -- (-1943.313) (-1943.271) (-1948.546) [-1944.581] * (-1943.553) (-1942.888) [-1943.519] (-1944.887) -- 0:00:56 163500 -- [-1943.879] (-1943.338) (-1947.931) (-1945.712) * (-1947.988) [-1943.278] (-1944.679) (-1948.366) -- 0:00:56 164000 -- (-1943.859) (-1944.769) (-1945.145) [-1944.549] * [-1944.485] (-1948.601) (-1943.058) (-1944.061) -- 0:00:56 164500 -- [-1945.026] (-1943.306) (-1944.172) (-1944.219) * (-1943.631) (-1946.747) [-1943.489] (-1944.095) -- 0:00:55 165000 -- (-1943.669) [-1943.377] (-1942.942) (-1952.810) * (-1943.667) [-1944.838] (-1943.763) (-1945.963) -- 0:00:55 Average standard deviation of split frequencies: 0.017338 165500 -- (-1943.623) (-1942.863) (-1946.638) [-1945.632] * (-1944.056) (-1945.334) (-1944.503) [-1945.883] -- 0:00:55 166000 -- (-1945.435) [-1942.863] (-1948.451) (-1949.575) * (-1943.469) (-1946.133) [-1945.354] (-1952.898) -- 0:00:55 166500 -- [-1944.511] (-1944.480) (-1948.606) (-1944.747) * [-1944.583] (-1945.950) (-1945.100) (-1952.439) -- 0:00:55 167000 -- [-1944.412] (-1943.707) (-1944.102) (-1944.782) * [-1946.894] (-1947.732) (-1946.275) (-1948.395) -- 0:00:54 167500 -- (-1944.274) (-1943.705) (-1943.873) [-1942.984] * (-1946.215) (-1945.063) (-1945.017) [-1947.268] -- 0:00:54 168000 -- (-1944.554) (-1945.041) [-1943.484] (-1944.971) * (-1943.248) (-1945.886) [-1945.246] (-1944.563) -- 0:00:54 168500 -- (-1944.768) (-1945.114) [-1943.503] (-1944.491) * [-1944.383] (-1946.723) (-1944.332) (-1945.770) -- 0:00:54 169000 -- [-1943.742] (-1943.563) (-1944.755) (-1944.099) * (-1944.779) (-1946.949) (-1943.675) [-1945.126] -- 0:00:54 169500 -- (-1944.056) [-1942.732] (-1944.798) (-1943.555) * (-1944.438) (-1952.129) [-1943.321] (-1943.757) -- 0:00:53 170000 -- (-1944.056) [-1945.890] (-1944.427) (-1943.658) * [-1944.653] (-1952.829) (-1945.222) (-1946.155) -- 0:00:53 Average standard deviation of split frequencies: 0.017954 170500 -- (-1943.334) [-1945.037] (-1944.022) (-1943.026) * [-1945.510] (-1948.417) (-1944.705) (-1945.877) -- 0:00:53 171000 -- (-1946.279) (-1943.107) (-1943.535) [-1943.312] * (-1945.305) (-1948.044) (-1947.241) [-1946.319] -- 0:00:53 171500 -- (-1944.937) (-1944.838) (-1944.946) [-1944.661] * (-1945.228) (-1945.850) (-1947.559) [-1944.599] -- 0:00:53 172000 -- [-1944.422] (-1943.346) (-1944.193) (-1942.980) * (-1944.455) (-1947.244) (-1945.554) [-1943.305] -- 0:00:57 172500 -- (-1944.499) [-1943.291] (-1944.367) (-1943.600) * (-1945.920) (-1949.225) [-1944.881] (-1946.480) -- 0:00:57 173000 -- (-1944.784) (-1945.130) [-1944.967] (-1943.202) * (-1946.829) (-1942.687) [-1943.447] (-1944.137) -- 0:00:57 173500 -- [-1943.094] (-1947.970) (-1944.261) (-1944.190) * (-1947.283) (-1944.613) [-1945.256] (-1944.756) -- 0:00:57 174000 -- (-1943.029) [-1943.632] (-1947.738) (-1944.625) * (-1947.677) (-1945.104) (-1948.404) [-1947.446] -- 0:00:56 174500 -- (-1943.024) (-1943.687) (-1947.525) [-1943.153] * (-1946.332) (-1944.530) [-1946.060] (-1948.137) -- 0:00:56 175000 -- (-1944.025) [-1943.599] (-1945.712) (-1943.119) * (-1945.019) (-1945.900) (-1945.869) [-1945.126] -- 0:00:56 Average standard deviation of split frequencies: 0.016353 175500 -- (-1943.462) [-1943.372] (-1949.941) (-1943.070) * (-1944.485) [-1946.264] (-1946.290) (-1944.245) -- 0:00:56 176000 -- (-1944.499) [-1943.367] (-1944.830) (-1945.224) * [-1944.358] (-1948.459) (-1944.833) (-1944.686) -- 0:00:56 176500 -- (-1943.591) (-1948.649) [-1946.439] (-1947.474) * (-1943.173) [-1947.613] (-1945.885) (-1945.927) -- 0:00:55 177000 -- [-1943.481] (-1948.330) (-1947.584) (-1944.488) * (-1942.970) (-1948.845) [-1944.615] (-1944.863) -- 0:00:55 177500 -- (-1942.748) [-1943.269] (-1946.476) (-1947.983) * (-1943.974) (-1947.731) [-1944.877] (-1945.103) -- 0:00:55 178000 -- (-1943.945) (-1943.269) [-1945.319] (-1945.627) * (-1943.067) (-1946.306) (-1944.298) [-1943.948] -- 0:00:55 178500 -- (-1945.660) (-1944.214) [-1945.466] (-1944.356) * [-1943.039] (-1945.046) (-1944.437) (-1944.706) -- 0:00:55 179000 -- (-1949.101) (-1944.519) (-1947.447) [-1942.986] * [-1944.215] (-1946.154) (-1944.168) (-1944.546) -- 0:00:55 179500 -- (-1947.182) [-1944.059] (-1950.664) (-1950.005) * (-1945.158) (-1945.752) [-1944.131] (-1944.178) -- 0:00:54 180000 -- (-1946.714) [-1944.183] (-1952.291) (-1944.686) * [-1945.139] (-1945.715) (-1945.309) (-1944.180) -- 0:00:54 Average standard deviation of split frequencies: 0.015916 180500 -- (-1947.559) [-1943.677] (-1944.076) (-1943.446) * [-1946.212] (-1944.917) (-1946.677) (-1944.065) -- 0:00:54 181000 -- (-1949.234) (-1943.827) [-1944.212] (-1944.664) * [-1945.549] (-1947.829) (-1947.482) (-1943.654) -- 0:00:54 181500 -- (-1952.951) (-1943.826) (-1944.255) [-1946.284] * (-1944.216) (-1943.457) [-1948.571] (-1943.318) -- 0:00:54 182000 -- (-1943.930) (-1943.963) [-1944.308] (-1946.355) * (-1943.722) (-1944.535) [-1945.949] (-1943.241) -- 0:00:53 182500 -- (-1943.375) (-1946.088) (-1942.809) [-1945.422] * [-1943.661] (-1947.862) (-1950.748) (-1943.120) -- 0:00:53 183000 -- (-1943.420) (-1946.084) [-1943.865] (-1946.869) * [-1942.478] (-1944.868) (-1947.818) (-1947.056) -- 0:00:53 183500 -- (-1947.701) [-1944.574] (-1943.394) (-1945.806) * (-1942.461) [-1946.572] (-1945.363) (-1944.374) -- 0:00:53 184000 -- [-1947.105] (-1945.507) (-1942.644) (-1946.806) * [-1944.227] (-1943.793) (-1945.919) (-1942.812) -- 0:00:53 184500 -- [-1946.557] (-1944.645) (-1947.272) (-1947.995) * [-1944.393] (-1943.854) (-1945.916) (-1943.414) -- 0:00:53 185000 -- (-1942.740) (-1945.909) [-1947.380] (-1945.787) * (-1944.404) (-1945.120) [-1943.096] (-1944.597) -- 0:00:52 Average standard deviation of split frequencies: 0.016674 185500 -- (-1943.350) [-1945.854] (-1946.055) (-1943.237) * (-1946.648) (-1945.044) (-1944.116) [-1943.240] -- 0:00:52 186000 -- (-1945.544) (-1945.942) [-1942.833] (-1943.775) * (-1952.187) (-1942.815) [-1943.609] (-1943.025) -- 0:00:52 186500 -- (-1946.579) (-1945.742) (-1945.075) [-1943.481] * (-1948.787) (-1943.297) [-1948.156] (-1951.057) -- 0:00:52 187000 -- [-1943.813] (-1946.755) (-1944.422) (-1946.336) * (-1946.070) [-1944.626] (-1944.948) (-1948.949) -- 0:00:56 187500 -- [-1944.868] (-1946.748) (-1943.389) (-1943.987) * (-1948.373) (-1946.483) [-1945.421] (-1944.844) -- 0:00:56 188000 -- (-1952.205) [-1944.193] (-1946.574) (-1944.304) * (-1944.473) (-1947.429) (-1943.915) [-1944.646] -- 0:00:56 188500 -- (-1951.566) (-1945.439) (-1946.808) [-1943.853] * [-1943.845] (-1946.535) (-1944.327) (-1946.777) -- 0:00:55 189000 -- [-1944.337] (-1944.017) (-1945.206) (-1943.765) * [-1944.670] (-1944.801) (-1944.270) (-1944.864) -- 0:00:55 189500 -- (-1944.489) (-1944.850) [-1947.801] (-1943.086) * [-1943.443] (-1944.002) (-1945.218) (-1946.045) -- 0:00:55 190000 -- (-1945.463) [-1944.298] (-1947.119) (-1943.528) * (-1947.120) [-1948.388] (-1945.202) (-1948.323) -- 0:00:55 Average standard deviation of split frequencies: 0.014958 190500 -- [-1943.218] (-1943.595) (-1943.089) (-1944.228) * (-1947.989) (-1947.027) [-1944.864] (-1944.100) -- 0:00:55 191000 -- (-1943.384) (-1943.606) (-1944.147) [-1947.222] * (-1946.211) (-1946.243) (-1945.610) [-1943.663] -- 0:00:55 191500 -- (-1943.112) [-1943.494] (-1943.709) (-1951.357) * (-1946.969) [-1945.799] (-1944.831) (-1944.565) -- 0:00:54 192000 -- [-1943.111] (-1946.699) (-1945.659) (-1943.952) * [-1947.173] (-1942.613) (-1948.688) (-1943.972) -- 0:00:54 192500 -- (-1946.459) (-1943.293) (-1946.922) [-1943.891] * (-1945.419) [-1942.982] (-1943.423) (-1943.440) -- 0:00:54 193000 -- [-1944.514] (-1944.330) (-1948.883) (-1944.235) * [-1947.025] (-1944.188) (-1946.363) (-1942.776) -- 0:00:54 193500 -- (-1945.474) (-1944.459) (-1943.231) [-1945.468] * (-1946.649) (-1946.829) [-1945.763] (-1943.095) -- 0:00:54 194000 -- [-1944.500] (-1945.105) (-1943.204) (-1944.960) * (-1943.280) (-1945.139) [-1946.081] (-1946.051) -- 0:00:54 194500 -- (-1944.354) (-1944.943) [-1943.132] (-1947.430) * (-1944.067) (-1950.356) [-1943.362] (-1946.881) -- 0:00:53 195000 -- [-1946.207] (-1944.783) (-1944.196) (-1944.878) * (-1943.743) [-1946.228] (-1943.552) (-1946.474) -- 0:00:53 Average standard deviation of split frequencies: 0.015190 195500 -- [-1944.151] (-1943.473) (-1946.657) (-1947.801) * (-1944.648) [-1946.146] (-1943.656) (-1945.021) -- 0:00:53 196000 -- [-1945.094] (-1945.188) (-1946.515) (-1943.947) * (-1945.392) (-1946.131) [-1944.980] (-1944.480) -- 0:00:53 196500 -- (-1947.528) (-1945.262) [-1943.475] (-1943.884) * (-1945.809) (-1946.770) (-1950.614) [-1943.618] -- 0:00:53 197000 -- [-1943.066] (-1947.372) (-1943.176) (-1944.081) * [-1943.747] (-1944.477) (-1946.079) (-1944.535) -- 0:00:52 197500 -- [-1942.730] (-1945.335) (-1943.136) (-1944.911) * (-1943.577) (-1947.456) [-1946.563] (-1942.878) -- 0:00:52 198000 -- (-1944.669) [-1944.875] (-1944.193) (-1944.554) * (-1943.369) (-1945.864) (-1945.138) [-1942.879] -- 0:00:52 198500 -- (-1945.898) [-1944.688] (-1943.259) (-1944.983) * [-1943.017] (-1946.273) (-1944.335) (-1943.898) -- 0:00:52 199000 -- (-1947.645) (-1944.528) [-1944.171] (-1947.808) * (-1944.612) [-1945.745] (-1944.620) (-1943.506) -- 0:00:52 199500 -- (-1950.521) [-1944.138] (-1943.277) (-1943.882) * (-1944.018) (-1943.865) (-1947.433) [-1945.000] -- 0:00:52 200000 -- (-1947.615) (-1943.054) [-1944.945] (-1949.754) * [-1944.416] (-1943.966) (-1944.566) (-1943.288) -- 0:00:51 Average standard deviation of split frequencies: 0.015826 200500 -- [-1946.052] (-1942.877) (-1944.784) (-1945.929) * (-1944.641) [-1943.499] (-1943.981) (-1943.782) -- 0:00:51 201000 -- (-1946.457) [-1943.910] (-1944.694) (-1949.341) * (-1944.240) (-1946.490) (-1946.889) [-1943.657] -- 0:00:51 201500 -- (-1944.496) [-1946.377] (-1944.578) (-1947.509) * [-1944.101] (-1945.765) (-1945.234) (-1944.539) -- 0:00:51 202000 -- (-1944.375) (-1945.636) (-1944.699) [-1945.770] * (-1944.360) (-1945.656) (-1945.635) [-1944.088] -- 0:00:55 202500 -- (-1945.409) [-1945.631] (-1944.596) (-1946.223) * (-1945.049) [-1944.974] (-1946.361) (-1943.778) -- 0:00:55 203000 -- (-1943.236) (-1944.290) [-1944.370] (-1944.960) * (-1944.068) (-1945.336) (-1944.938) [-1943.109] -- 0:00:54 203500 -- [-1943.457] (-1945.157) (-1945.026) (-1944.833) * (-1943.659) (-1945.078) (-1945.653) [-1943.868] -- 0:00:54 204000 -- [-1943.575] (-1944.281) (-1944.583) (-1945.587) * (-1945.787) [-1945.333] (-1944.934) (-1944.529) -- 0:00:54 204500 -- (-1944.711) [-1942.928] (-1949.224) (-1944.131) * (-1944.300) (-1944.294) (-1943.785) [-1946.967] -- 0:00:54 205000 -- (-1944.144) (-1943.396) [-1945.577] (-1943.839) * (-1944.575) (-1944.376) (-1947.426) [-1943.848] -- 0:00:54 Average standard deviation of split frequencies: 0.014646 205500 -- (-1943.465) (-1944.099) [-1946.519] (-1944.673) * (-1944.371) (-1944.064) [-1945.709] (-1942.926) -- 0:00:54 206000 -- (-1943.452) (-1944.887) (-1942.856) [-1945.448] * (-1944.296) [-1943.184] (-1946.299) (-1944.047) -- 0:00:53 206500 -- (-1944.021) (-1944.617) [-1944.117] (-1944.472) * (-1944.331) [-1943.579] (-1947.916) (-1943.939) -- 0:00:53 207000 -- (-1945.148) [-1945.583] (-1950.866) (-1945.130) * (-1946.491) (-1946.253) [-1942.961] (-1943.794) -- 0:00:53 207500 -- (-1944.775) (-1944.657) (-1949.950) [-1945.463] * [-1945.446] (-1945.557) (-1945.106) (-1944.740) -- 0:00:53 208000 -- (-1946.193) (-1945.474) (-1948.775) [-1945.917] * [-1945.492] (-1947.633) (-1945.106) (-1943.901) -- 0:00:53 208500 -- [-1943.893] (-1943.765) (-1945.897) (-1948.030) * [-1945.845] (-1943.937) (-1946.249) (-1944.628) -- 0:00:53 209000 -- (-1945.425) (-1944.384) (-1945.169) [-1944.583] * (-1948.790) (-1942.773) (-1944.773) [-1944.904] -- 0:00:52 209500 -- [-1942.614] (-1945.951) (-1944.095) (-1943.774) * (-1947.660) (-1944.098) (-1942.873) [-1944.903] -- 0:00:52 210000 -- [-1943.572] (-1944.991) (-1944.151) (-1943.737) * [-1943.683] (-1945.641) (-1943.111) (-1944.490) -- 0:00:52 Average standard deviation of split frequencies: 0.013779 210500 -- (-1943.623) (-1943.056) [-1944.093] (-1943.737) * (-1943.593) (-1945.444) (-1945.178) [-1945.214] -- 0:00:52 211000 -- (-1943.209) [-1944.079] (-1943.661) (-1945.163) * (-1943.901) [-1945.818] (-1944.811) (-1947.449) -- 0:00:52 211500 -- (-1944.545) (-1944.723) (-1943.795) [-1943.786] * (-1945.001) [-1945.746] (-1947.038) (-1945.718) -- 0:00:52 212000 -- [-1948.132] (-1943.701) (-1944.295) (-1943.767) * [-1944.168] (-1944.618) (-1946.892) (-1944.047) -- 0:00:52 212500 -- (-1944.632) (-1945.019) [-1944.653] (-1948.338) * (-1943.200) (-1944.388) [-1947.312] (-1947.163) -- 0:00:51 213000 -- (-1945.677) [-1943.878] (-1945.076) (-1948.006) * [-1943.369] (-1944.283) (-1947.369) (-1945.707) -- 0:00:51 213500 -- (-1945.354) (-1947.087) (-1947.173) [-1944.259] * (-1943.192) (-1943.822) (-1944.630) [-1951.422] -- 0:00:51 214000 -- (-1949.006) (-1944.112) [-1946.133] (-1945.311) * [-1944.150] (-1944.914) (-1944.676) (-1946.561) -- 0:00:51 214500 -- (-1947.209) (-1944.995) [-1944.592] (-1942.942) * (-1943.122) (-1944.473) (-1943.296) [-1945.135] -- 0:00:51 215000 -- (-1945.403) [-1943.954] (-1943.180) (-1944.368) * (-1945.991) (-1946.233) (-1943.411) [-1944.736] -- 0:00:51 Average standard deviation of split frequencies: 0.012061 215500 -- (-1945.404) [-1943.250] (-1943.173) (-1944.994) * (-1944.783) (-1943.961) (-1942.920) [-1943.237] -- 0:00:50 216000 -- (-1946.562) [-1943.296] (-1948.999) (-1943.305) * [-1946.198] (-1950.421) (-1943.798) (-1943.214) -- 0:00:50 216500 -- (-1944.903) [-1943.670] (-1944.726) (-1944.343) * (-1945.606) (-1943.497) [-1944.049] (-1943.986) -- 0:00:50 217000 -- (-1944.903) (-1944.535) (-1945.837) [-1944.169] * (-1942.929) [-1943.244] (-1942.717) (-1944.132) -- 0:00:50 217500 -- (-1945.849) (-1945.205) (-1944.654) [-1944.501] * (-1946.708) (-1943.649) (-1943.174) [-1943.721] -- 0:00:53 218000 -- (-1945.198) (-1942.613) [-1944.300] (-1942.576) * (-1946.827) (-1943.490) (-1950.011) [-1944.433] -- 0:00:53 218500 -- (-1945.110) (-1945.791) (-1946.107) [-1945.738] * (-1946.598) (-1943.678) (-1950.817) [-1946.994] -- 0:00:53 219000 -- (-1945.472) (-1946.947) [-1945.584] (-1945.777) * (-1945.368) (-1945.185) (-1954.147) [-1946.868] -- 0:00:53 219500 -- (-1945.094) [-1945.568] (-1942.759) (-1945.788) * (-1942.948) (-1946.051) (-1950.908) [-1946.225] -- 0:00:53 220000 -- (-1946.680) (-1946.612) [-1944.965] (-1943.781) * [-1943.980] (-1947.313) (-1947.350) (-1945.410) -- 0:00:53 Average standard deviation of split frequencies: 0.013886 220500 -- [-1943.050] (-1945.931) (-1943.883) (-1945.132) * (-1945.733) (-1948.659) [-1947.010] (-1947.250) -- 0:00:53 221000 -- (-1943.762) (-1944.193) [-1946.412] (-1944.348) * (-1944.050) (-1947.903) [-1949.105] (-1944.756) -- 0:00:52 221500 -- (-1947.486) [-1946.086] (-1948.176) (-1945.559) * (-1950.578) (-1944.870) (-1945.821) [-1944.628] -- 0:00:52 222000 -- (-1950.363) (-1944.698) (-1944.752) [-1944.814] * [-1944.799] (-1945.843) (-1944.706) (-1945.116) -- 0:00:52 222500 -- (-1949.281) (-1944.741) [-1943.000] (-1943.846) * (-1945.918) [-1948.057] (-1944.963) (-1945.168) -- 0:00:52 223000 -- (-1945.584) (-1943.379) [-1943.393] (-1946.814) * (-1945.803) [-1946.984] (-1945.850) (-1943.740) -- 0:00:52 223500 -- (-1944.939) (-1943.350) (-1943.350) [-1947.379] * (-1943.915) (-1943.561) (-1945.009) [-1943.594] -- 0:00:52 224000 -- (-1944.424) (-1944.219) [-1943.365] (-1946.214) * [-1946.176] (-1943.312) (-1944.239) (-1943.489) -- 0:00:51 224500 -- (-1944.723) (-1946.454) (-1944.260) [-1944.298] * (-1943.733) [-1942.912] (-1945.860) (-1944.914) -- 0:00:51 225000 -- (-1945.853) (-1946.528) [-1944.813] (-1944.072) * (-1943.596) [-1943.249] (-1946.550) (-1947.044) -- 0:00:51 Average standard deviation of split frequencies: 0.013833 225500 -- (-1945.852) [-1943.174] (-1943.104) (-1946.501) * [-1942.949] (-1942.797) (-1943.421) (-1945.681) -- 0:00:51 226000 -- (-1946.490) [-1944.246] (-1943.104) (-1947.961) * (-1944.167) (-1943.267) (-1942.932) [-1945.142] -- 0:00:51 226500 -- (-1948.638) (-1943.008) [-1942.985] (-1945.312) * (-1944.120) (-1942.792) [-1943.520] (-1943.552) -- 0:00:51 227000 -- (-1944.703) [-1942.976] (-1943.499) (-1944.471) * (-1945.125) [-1942.704] (-1944.907) (-1948.151) -- 0:00:51 227500 -- (-1945.467) [-1944.022] (-1945.170) (-1944.321) * (-1946.252) (-1947.140) [-1944.630] (-1947.664) -- 0:00:50 228000 -- (-1948.287) (-1945.548) (-1944.217) [-1943.943] * (-1946.148) (-1945.828) (-1944.175) [-1943.708] -- 0:00:50 228500 -- (-1948.065) (-1952.631) [-1945.203] (-1945.117) * (-1944.558) (-1945.962) [-1943.821] (-1947.707) -- 0:00:50 229000 -- (-1946.405) (-1945.061) (-1945.748) [-1944.940] * (-1943.525) (-1945.651) [-1942.862] (-1947.320) -- 0:00:50 229500 -- [-1944.407] (-1950.036) (-1947.131) (-1944.893) * (-1943.538) (-1944.890) (-1943.243) [-1945.329] -- 0:00:50 230000 -- (-1945.707) [-1945.404] (-1943.691) (-1944.515) * (-1943.261) (-1946.706) [-1947.087] (-1945.065) -- 0:00:50 Average standard deviation of split frequencies: 0.012489 230500 -- (-1946.240) [-1945.953] (-1943.897) (-1944.522) * [-1943.399] (-1945.001) (-1946.687) (-1943.387) -- 0:00:50 231000 -- (-1944.314) (-1952.296) (-1946.827) [-1948.744] * (-1943.765) (-1948.778) [-1944.798] (-1944.182) -- 0:00:49 231500 -- (-1942.883) [-1947.092] (-1948.637) (-1948.869) * (-1948.619) [-1949.450] (-1944.781) (-1943.569) -- 0:00:49 232000 -- (-1945.162) (-1946.402) (-1947.615) [-1946.515] * [-1944.359] (-1942.653) (-1943.780) (-1943.272) -- 0:00:52 232500 -- (-1948.550) [-1946.395] (-1951.543) (-1948.601) * [-1944.128] (-1946.893) (-1944.672) (-1945.290) -- 0:00:52 233000 -- [-1943.732] (-1943.549) (-1947.291) (-1951.025) * (-1943.774) [-1945.954] (-1944.674) (-1947.836) -- 0:00:52 233500 -- (-1943.739) (-1943.657) [-1945.228] (-1946.062) * (-1943.774) (-1944.373) (-1944.635) [-1942.999] -- 0:00:52 234000 -- (-1943.658) [-1944.230] (-1947.162) (-1944.275) * (-1945.105) (-1945.100) [-1944.222] (-1943.572) -- 0:00:52 234500 -- (-1945.003) (-1944.649) [-1944.767] (-1943.587) * (-1946.992) [-1943.366] (-1944.271) (-1945.526) -- 0:00:52 235000 -- [-1945.406] (-1948.129) (-1944.625) (-1943.888) * (-1945.078) [-1943.024] (-1944.905) (-1944.896) -- 0:00:52 Average standard deviation of split frequencies: 0.011985 235500 -- (-1943.089) (-1947.394) (-1944.571) [-1945.788] * (-1945.247) (-1943.879) (-1943.308) [-1943.536] -- 0:00:51 236000 -- (-1943.601) (-1947.608) [-1944.337] (-1945.260) * [-1947.183] (-1945.062) (-1943.269) (-1943.900) -- 0:00:51 236500 -- (-1946.869) (-1944.060) [-1944.340] (-1945.738) * (-1944.530) [-1943.387] (-1945.328) (-1944.029) -- 0:00:51 237000 -- (-1944.127) (-1944.061) (-1945.349) [-1944.937] * (-1946.798) [-1946.088] (-1946.446) (-1944.220) -- 0:00:51 237500 -- [-1943.981] (-1945.955) (-1944.606) (-1944.641) * (-1943.531) [-1944.112] (-1946.063) (-1943.399) -- 0:00:51 238000 -- (-1943.616) (-1944.720) [-1943.716] (-1943.475) * (-1944.687) (-1946.194) (-1945.262) [-1945.575] -- 0:00:51 238500 -- (-1943.965) (-1944.073) (-1944.602) [-1943.762] * (-1946.640) (-1945.880) [-1945.328] (-1945.584) -- 0:00:51 239000 -- [-1943.983] (-1951.088) (-1956.246) (-1946.329) * (-1945.290) (-1946.835) (-1945.326) [-1944.918] -- 0:00:50 239500 -- (-1944.093) (-1944.327) (-1944.597) [-1943.342] * (-1949.627) (-1945.103) [-1943.647] (-1946.230) -- 0:00:50 240000 -- (-1943.822) (-1945.240) [-1944.265] (-1943.174) * (-1948.271) (-1949.784) [-1945.701] (-1945.659) -- 0:00:50 Average standard deviation of split frequencies: 0.012340 240500 -- (-1943.835) (-1943.905) (-1944.178) [-1943.164] * (-1948.406) [-1947.933] (-1943.476) (-1946.206) -- 0:00:50 241000 -- (-1944.499) (-1944.588) (-1945.900) [-1943.977] * (-1945.218) (-1946.938) [-1945.203] (-1947.724) -- 0:00:50 241500 -- [-1944.048] (-1947.543) (-1949.995) (-1943.966) * (-1946.494) [-1944.649] (-1948.025) (-1947.355) -- 0:00:50 242000 -- [-1943.467] (-1945.915) (-1948.478) (-1947.299) * (-1950.214) (-1945.091) [-1944.159] (-1944.046) -- 0:00:50 242500 -- [-1945.880] (-1944.421) (-1950.584) (-1947.636) * (-1944.256) (-1944.716) [-1944.399] (-1944.547) -- 0:00:49 243000 -- [-1944.359] (-1947.851) (-1947.248) (-1944.450) * (-1947.101) (-1944.761) [-1944.614] (-1946.555) -- 0:00:49 243500 -- (-1944.535) (-1944.328) (-1946.836) [-1945.260] * [-1945.789] (-1949.115) (-1945.555) (-1946.840) -- 0:00:49 244000 -- (-1946.985) [-1943.713] (-1945.170) (-1943.298) * [-1945.467] (-1945.745) (-1944.136) (-1945.613) -- 0:00:49 244500 -- (-1952.187) [-1946.049] (-1946.195) (-1945.247) * (-1944.864) (-1943.647) [-1944.269] (-1945.190) -- 0:00:49 245000 -- (-1945.883) [-1947.015] (-1947.015) (-1945.251) * [-1943.819] (-1943.939) (-1944.698) (-1948.018) -- 0:00:49 Average standard deviation of split frequencies: 0.012775 245500 -- (-1946.239) [-1945.037] (-1944.813) (-1947.037) * (-1943.874) (-1947.904) (-1943.890) [-1943.875] -- 0:00:49 246000 -- (-1942.687) (-1945.375) [-1946.950] (-1945.348) * (-1944.780) (-1945.653) [-1943.825] (-1943.055) -- 0:00:49 246500 -- (-1944.568) [-1944.843] (-1943.798) (-1946.189) * (-1944.361) [-1945.627] (-1944.400) (-1943.551) -- 0:00:51 247000 -- (-1944.938) [-1944.572] (-1947.782) (-1950.733) * (-1948.192) (-1946.676) [-1944.222] (-1944.116) -- 0:00:51 247500 -- (-1945.177) (-1944.959) (-1946.507) [-1943.735] * (-1950.287) [-1946.833] (-1943.809) (-1949.101) -- 0:00:51 248000 -- (-1943.672) [-1945.941] (-1945.062) (-1949.270) * [-1946.109] (-1949.140) (-1945.598) (-1946.338) -- 0:00:51 248500 -- (-1945.476) (-1947.261) (-1945.140) [-1948.484] * (-1946.804) (-1943.883) (-1945.063) [-1946.567] -- 0:00:51 249000 -- (-1943.969) (-1949.187) [-1944.413] (-1943.174) * (-1945.186) [-1944.505] (-1946.159) (-1946.568) -- 0:00:51 249500 -- [-1945.477] (-1946.644) (-1943.725) (-1944.897) * [-1942.787] (-1944.394) (-1945.510) (-1945.915) -- 0:00:51 250000 -- (-1945.305) (-1945.804) [-1944.561] (-1943.575) * (-1944.283) (-1944.774) [-1946.253] (-1945.207) -- 0:00:51 Average standard deviation of split frequencies: 0.011754 250500 -- [-1944.755] (-1944.326) (-1945.081) (-1945.759) * [-1946.621] (-1943.667) (-1944.933) (-1945.657) -- 0:00:50 251000 -- (-1943.488) [-1943.109] (-1946.495) (-1944.376) * (-1943.128) (-1944.174) (-1943.159) [-1944.594] -- 0:00:50 251500 -- (-1947.147) (-1943.498) (-1946.250) [-1943.776] * [-1947.629] (-1944.758) (-1943.013) (-1947.436) -- 0:00:50 252000 -- [-1946.605] (-1944.042) (-1946.395) (-1944.394) * (-1946.357) [-1945.091] (-1943.766) (-1942.872) -- 0:00:50 252500 -- (-1944.066) [-1944.246] (-1946.241) (-1943.215) * (-1947.738) (-1945.732) [-1944.335] (-1944.043) -- 0:00:50 253000 -- (-1947.750) (-1947.373) (-1945.511) [-1946.078] * (-1947.918) [-1944.946] (-1944.331) (-1948.408) -- 0:00:50 253500 -- (-1947.998) (-1945.720) (-1948.077) [-1943.365] * [-1945.645] (-1944.124) (-1944.058) (-1947.591) -- 0:00:50 254000 -- (-1947.641) (-1944.141) [-1945.629] (-1947.379) * (-1944.366) [-1945.023] (-1944.540) (-1943.010) -- 0:00:49 254500 -- (-1946.559) (-1944.529) (-1947.102) [-1947.378] * (-1945.615) (-1944.662) [-1944.955] (-1947.541) -- 0:00:49 255000 -- (-1944.073) [-1945.583] (-1943.960) (-1945.346) * (-1949.341) [-1942.555] (-1944.445) (-1947.169) -- 0:00:49 Average standard deviation of split frequencies: 0.011921 255500 -- (-1945.431) (-1946.691) [-1944.240] (-1945.486) * (-1949.780) (-1942.895) [-1945.370] (-1944.558) -- 0:00:49 256000 -- (-1945.431) (-1945.643) (-1944.880) [-1945.694] * (-1948.736) [-1944.591] (-1948.055) (-1944.657) -- 0:00:49 256500 -- (-1945.869) (-1945.158) (-1944.160) [-1944.284] * [-1947.543] (-1943.996) (-1946.793) (-1946.502) -- 0:00:49 257000 -- (-1945.105) [-1946.417] (-1942.923) (-1943.931) * (-1946.721) [-1947.745] (-1946.283) (-1946.239) -- 0:00:49 257500 -- (-1946.607) (-1945.954) [-1947.507] (-1945.968) * [-1946.611] (-1945.186) (-1950.495) (-1946.144) -- 0:00:49 258000 -- (-1947.498) (-1944.417) [-1943.860] (-1948.374) * (-1944.807) [-1949.162] (-1946.486) (-1946.209) -- 0:00:48 258500 -- (-1945.175) (-1943.907) [-1943.437] (-1945.096) * [-1943.668] (-1948.716) (-1945.883) (-1944.592) -- 0:00:48 259000 -- (-1943.953) (-1944.016) (-1946.444) [-1943.014] * (-1943.975) [-1943.270] (-1944.596) (-1944.987) -- 0:00:48 259500 -- (-1944.966) [-1943.050] (-1945.975) (-1944.382) * [-1943.685] (-1943.522) (-1946.027) (-1944.003) -- 0:00:48 260000 -- (-1945.186) [-1943.391] (-1946.306) (-1943.603) * [-1944.150] (-1945.185) (-1945.592) (-1943.167) -- 0:00:48 Average standard deviation of split frequencies: 0.011803 260500 -- [-1943.609] (-1946.471) (-1946.928) (-1944.510) * (-1945.627) (-1943.625) (-1943.611) [-1947.284] -- 0:00:48 261000 -- (-1945.213) [-1944.735] (-1947.022) (-1944.885) * (-1944.735) [-1943.226] (-1944.953) (-1948.239) -- 0:00:50 261500 -- (-1945.677) [-1943.389] (-1945.043) (-1943.476) * (-1944.734) [-1945.891] (-1946.995) (-1944.139) -- 0:00:50 262000 -- [-1945.836] (-1943.612) (-1943.482) (-1944.364) * (-1944.007) (-1946.335) [-1946.193] (-1947.657) -- 0:00:50 262500 -- (-1943.824) [-1944.749] (-1944.494) (-1943.667) * (-1943.429) [-1943.990] (-1946.125) (-1949.507) -- 0:00:50 263000 -- (-1944.533) [-1945.097] (-1944.380) (-1943.511) * (-1944.785) (-1944.068) [-1948.971] (-1948.128) -- 0:00:50 263500 -- (-1943.561) [-1944.243] (-1943.596) (-1944.141) * (-1943.761) [-1948.053] (-1950.061) (-1946.771) -- 0:00:50 264000 -- (-1943.800) (-1946.857) (-1943.282) [-1943.824] * (-1948.417) (-1943.911) (-1943.954) [-1944.852] -- 0:00:50 264500 -- (-1944.039) (-1945.083) (-1943.839) [-1944.315] * [-1945.751] (-1942.915) (-1943.954) (-1944.026) -- 0:00:50 265000 -- (-1946.008) [-1946.419] (-1946.022) (-1946.043) * (-1948.891) (-1942.900) [-1943.867] (-1945.318) -- 0:00:49 Average standard deviation of split frequencies: 0.011697 265500 -- (-1946.194) (-1943.769) (-1944.266) [-1946.416] * (-1946.494) (-1946.132) (-1944.299) [-1945.218] -- 0:00:49 266000 -- (-1945.511) (-1944.519) (-1944.522) [-1942.967] * (-1943.550) (-1946.149) (-1944.737) [-1946.142] -- 0:00:49 266500 -- (-1944.302) (-1946.243) [-1943.385] (-1945.394) * (-1943.882) (-1943.657) [-1944.934] (-1947.356) -- 0:00:49 267000 -- (-1943.998) (-1946.161) [-1946.381] (-1944.577) * (-1945.252) [-1944.698] (-1945.167) (-1944.662) -- 0:00:49 267500 -- (-1945.284) (-1943.770) (-1945.165) [-1943.556] * (-1945.344) (-1943.650) (-1945.158) [-1945.795] -- 0:00:49 268000 -- (-1944.729) (-1945.982) (-1946.922) [-1943.154] * (-1944.320) [-1944.680] (-1943.429) (-1945.806) -- 0:00:49 268500 -- (-1944.729) (-1946.774) [-1946.009] (-1943.280) * [-1944.172] (-1944.115) (-1943.216) (-1950.776) -- 0:00:49 269000 -- (-1947.069) (-1944.399) (-1946.509) [-1943.243] * (-1948.076) (-1943.739) [-1943.614] (-1947.567) -- 0:00:48 269500 -- [-1947.141] (-1944.315) (-1946.191) (-1943.714) * [-1945.545] (-1943.680) (-1943.199) (-1947.265) -- 0:00:48 270000 -- (-1947.222) [-1944.028] (-1944.457) (-1944.248) * (-1945.534) (-1944.257) (-1944.289) [-1946.324] -- 0:00:48 Average standard deviation of split frequencies: 0.010908 270500 -- (-1944.134) [-1943.635] (-1943.307) (-1943.287) * (-1943.086) [-1943.459] (-1943.558) (-1943.424) -- 0:00:48 271000 -- (-1943.508) (-1947.003) [-1944.013] (-1943.094) * (-1945.703) (-1945.871) [-1943.941] (-1943.209) -- 0:00:48 271500 -- (-1944.063) (-1949.457) (-1946.187) [-1945.082] * (-1944.534) (-1944.445) [-1944.047] (-1943.178) -- 0:00:48 272000 -- (-1944.148) (-1943.355) [-1946.704] (-1943.480) * [-1944.126] (-1942.697) (-1944.300) (-1943.239) -- 0:00:48 272500 -- (-1944.886) [-1945.353] (-1943.918) (-1945.003) * (-1944.186) [-1942.651] (-1943.647) (-1944.145) -- 0:00:48 273000 -- [-1944.968] (-1948.956) (-1945.594) (-1946.021) * (-1943.768) (-1942.971) [-1944.481] (-1943.702) -- 0:00:47 273500 -- (-1944.765) (-1944.283) [-1943.732] (-1944.903) * (-1944.870) [-1947.723] (-1946.464) (-1944.887) -- 0:00:47 274000 -- (-1944.689) [-1943.501] (-1943.953) (-1944.389) * (-1947.853) (-1946.929) (-1946.867) [-1943.990] -- 0:00:47 274500 -- (-1944.603) (-1943.682) [-1943.591] (-1945.450) * (-1944.176) [-1943.168] (-1949.555) (-1943.573) -- 0:00:47 275000 -- (-1944.656) (-1945.633) [-1942.688] (-1944.700) * (-1943.397) (-1944.622) (-1950.220) [-1944.970] -- 0:00:47 Average standard deviation of split frequencies: 0.009978 275500 -- [-1944.956] (-1945.634) (-1943.328) (-1943.102) * (-1942.692) (-1942.976) [-1946.786] (-1944.705) -- 0:00:47 276000 -- (-1947.179) (-1945.594) [-1942.596] (-1943.544) * (-1943.809) (-1944.674) [-1944.624] (-1943.411) -- 0:00:49 276500 -- (-1948.386) (-1946.693) [-1942.599] (-1944.506) * (-1945.114) [-1943.816] (-1944.235) (-1943.459) -- 0:00:49 277000 -- (-1951.471) [-1945.189] (-1943.347) (-1947.634) * (-1945.862) [-1942.631] (-1944.130) (-1943.925) -- 0:00:49 277500 -- (-1945.321) (-1945.494) [-1943.471] (-1944.463) * (-1944.982) (-1949.410) [-1948.796] (-1945.559) -- 0:00:49 278000 -- (-1947.052) (-1945.544) (-1942.993) [-1948.698] * [-1945.178] (-1949.367) (-1943.243) (-1944.848) -- 0:00:49 278500 -- [-1943.807] (-1944.522) (-1944.094) (-1947.612) * (-1945.896) (-1947.095) (-1944.957) [-1944.091] -- 0:00:49 279000 -- (-1943.519) (-1943.953) (-1945.419) [-1947.343] * [-1947.766] (-1946.481) (-1945.372) (-1943.746) -- 0:00:49 279500 -- (-1944.110) [-1944.381] (-1946.135) (-1945.350) * (-1948.762) (-1945.959) [-1946.211] (-1943.029) -- 0:00:48 280000 -- [-1945.209] (-1948.197) (-1944.613) (-1944.553) * (-1951.212) [-1948.565] (-1944.366) (-1944.856) -- 0:00:48 Average standard deviation of split frequencies: 0.008305 280500 -- (-1944.716) (-1944.226) (-1946.291) [-1943.608] * [-1945.752] (-1949.051) (-1945.625) (-1944.883) -- 0:00:48 281000 -- (-1944.660) [-1943.874] (-1945.132) (-1943.476) * (-1945.297) (-1950.591) [-1946.364] (-1944.138) -- 0:00:48 281500 -- (-1944.321) (-1943.769) [-1945.904] (-1944.095) * (-1944.706) [-1944.572] (-1943.908) (-1945.383) -- 0:00:48 282000 -- (-1943.321) [-1944.472] (-1944.187) (-1944.452) * (-1944.861) (-1946.820) (-1944.196) [-1943.853] -- 0:00:48 282500 -- (-1944.373) (-1944.731) [-1945.564] (-1950.003) * (-1948.556) (-1946.832) [-1943.899] (-1947.104) -- 0:00:48 283000 -- [-1943.270] (-1945.057) (-1945.697) (-1946.156) * [-1946.530] (-1944.281) (-1943.818) (-1946.100) -- 0:00:48 283500 -- (-1946.012) (-1946.061) (-1947.021) [-1946.487] * [-1945.411] (-1947.749) (-1943.349) (-1944.000) -- 0:00:48 284000 -- (-1945.896) (-1945.557) (-1942.806) [-1948.173] * (-1943.720) [-1945.102] (-1943.627) (-1949.267) -- 0:00:47 284500 -- (-1944.889) [-1944.662] (-1943.522) (-1944.911) * [-1943.811] (-1949.833) (-1946.113) (-1945.776) -- 0:00:47 285000 -- (-1944.273) (-1944.822) [-1943.473] (-1949.181) * (-1943.630) (-1945.068) [-1942.786] (-1948.054) -- 0:00:47 Average standard deviation of split frequencies: 0.007051 285500 -- (-1945.698) (-1945.895) (-1945.506) [-1944.629] * [-1946.110] (-1944.270) (-1949.964) (-1943.940) -- 0:00:47 286000 -- [-1944.920] (-1943.728) (-1947.623) (-1946.004) * [-1944.668] (-1945.087) (-1943.969) (-1945.333) -- 0:00:47 286500 -- [-1944.157] (-1945.061) (-1947.555) (-1944.680) * (-1947.483) (-1946.691) [-1945.002] (-1944.813) -- 0:00:47 287000 -- (-1946.113) (-1951.119) (-1946.857) [-1946.265] * (-1944.259) (-1946.692) (-1945.712) [-1945.844] -- 0:00:47 287500 -- [-1945.224] (-1950.988) (-1944.445) (-1946.319) * (-1943.256) [-1943.093] (-1944.116) (-1945.925) -- 0:00:47 288000 -- (-1944.209) (-1948.048) [-1944.013] (-1946.057) * (-1944.154) [-1943.279] (-1947.449) (-1944.110) -- 0:00:46 288500 -- (-1949.666) (-1943.283) (-1944.784) [-1944.870] * (-1945.915) (-1947.927) (-1945.154) [-1943.704] -- 0:00:46 289000 -- (-1947.938) [-1943.226] (-1944.824) (-1944.069) * (-1943.946) (-1946.408) [-1943.298] (-1943.553) -- 0:00:46 289500 -- (-1947.458) [-1945.539] (-1943.550) (-1943.774) * [-1946.273] (-1948.128) (-1944.410) (-1946.186) -- 0:00:46 290000 -- (-1954.502) (-1946.546) (-1943.364) [-1945.610] * (-1945.844) (-1943.952) [-1944.191] (-1946.549) -- 0:00:48 Average standard deviation of split frequencies: 0.008109 290500 -- (-1946.523) (-1948.878) (-1944.219) [-1946.624] * (-1946.491) (-1944.378) (-1947.185) [-1945.944] -- 0:00:48 291000 -- [-1943.996] (-1943.009) (-1947.895) (-1944.667) * (-1946.479) [-1943.187] (-1948.050) (-1947.725) -- 0:00:48 291500 -- [-1944.997] (-1945.044) (-1946.175) (-1947.423) * (-1947.027) (-1943.626) (-1943.813) [-1948.412] -- 0:00:48 292000 -- (-1949.987) [-1945.583] (-1949.717) (-1946.538) * [-1945.609] (-1942.707) (-1944.285) (-1947.172) -- 0:00:48 292500 -- (-1952.608) (-1944.356) (-1946.824) [-1943.503] * (-1945.460) [-1948.940] (-1947.155) (-1944.120) -- 0:00:48 293000 -- (-1954.318) [-1949.582] (-1947.713) (-1946.665) * (-1944.423) (-1944.010) (-1945.319) [-1944.118] -- 0:00:48 293500 -- [-1953.651] (-1953.067) (-1945.637) (-1942.655) * [-1943.162] (-1944.275) (-1944.073) (-1944.329) -- 0:00:48 294000 -- (-1943.989) (-1947.868) [-1944.956] (-1942.654) * (-1946.078) [-1943.205] (-1942.893) (-1943.568) -- 0:00:48 294500 -- (-1943.339) (-1946.340) [-1944.604] (-1943.750) * (-1945.707) (-1944.481) (-1944.799) [-1943.115] -- 0:00:47 295000 -- (-1943.493) (-1950.951) (-1946.900) [-1945.507] * (-1944.516) (-1948.230) (-1943.913) [-1942.520] -- 0:00:47 Average standard deviation of split frequencies: 0.008671 295500 -- (-1944.752) [-1946.610] (-1944.425) (-1945.571) * (-1944.906) (-1947.978) [-1944.415] (-1942.768) -- 0:00:47 296000 -- [-1944.244] (-1945.443) (-1945.399) (-1944.170) * (-1944.150) (-1945.923) [-1942.775] (-1942.656) -- 0:00:47 296500 -- (-1944.246) (-1945.739) [-1948.463] (-1947.530) * (-1944.144) [-1943.160] (-1942.856) (-1943.842) -- 0:00:47 297000 -- (-1946.045) (-1942.697) [-1943.136] (-1947.884) * (-1943.246) [-1943.151] (-1942.993) (-1944.604) -- 0:00:47 297500 -- (-1944.283) [-1945.827] (-1943.220) (-1947.508) * (-1943.035) (-1945.564) [-1944.591] (-1943.161) -- 0:00:47 298000 -- (-1943.473) (-1948.614) (-1945.120) [-1947.689] * [-1942.900] (-1943.792) (-1944.127) (-1946.180) -- 0:00:47 298500 -- [-1943.691] (-1945.572) (-1944.502) (-1947.875) * [-1942.865] (-1946.403) (-1946.202) (-1942.719) -- 0:00:47 299000 -- (-1943.602) (-1944.595) (-1945.456) [-1945.082] * (-1944.933) (-1945.263) [-1946.324] (-1944.896) -- 0:00:46 299500 -- (-1946.856) [-1942.741] (-1945.614) (-1944.343) * (-1947.154) [-1945.407] (-1943.012) (-1945.078) -- 0:00:46 300000 -- [-1948.692] (-1944.305) (-1947.776) (-1943.128) * [-1948.935] (-1944.723) (-1944.303) (-1945.199) -- 0:00:46 Average standard deviation of split frequencies: 0.008536 300500 -- (-1947.343) (-1948.496) (-1949.134) [-1942.693] * (-1944.100) (-1943.764) [-1943.729] (-1945.340) -- 0:00:46 301000 -- (-1947.722) (-1945.005) (-1950.442) [-1942.452] * (-1951.764) [-1944.806] (-1947.120) (-1947.030) -- 0:00:46 301500 -- (-1945.344) [-1943.543] (-1951.231) (-1942.656) * [-1947.826] (-1944.910) (-1944.225) (-1945.634) -- 0:00:46 302000 -- (-1945.382) [-1944.177] (-1950.704) (-1943.029) * (-1948.603) (-1943.756) (-1945.108) [-1945.363] -- 0:00:46 302500 -- (-1944.135) (-1943.485) (-1952.702) [-1944.887] * (-1953.828) (-1947.090) (-1943.660) [-1943.898] -- 0:00:46 303000 -- (-1946.324) [-1943.148] (-1947.614) (-1944.886) * (-1950.051) (-1944.797) [-1943.652] (-1943.258) -- 0:00:46 303500 -- (-1946.786) [-1942.641] (-1944.995) (-1943.047) * (-1949.347) (-1944.140) [-1944.227] (-1944.685) -- 0:00:45 304000 -- (-1951.417) [-1943.413] (-1946.239) (-1943.049) * (-1946.280) [-1944.249] (-1945.059) (-1943.958) -- 0:00:45 304500 -- (-1943.176) (-1944.270) (-1945.814) [-1945.806] * [-1945.429] (-1944.175) (-1943.590) (-1943.573) -- 0:00:45 305000 -- (-1943.639) (-1945.416) [-1943.537] (-1945.398) * (-1947.594) [-1947.683] (-1944.795) (-1945.928) -- 0:00:45 Average standard deviation of split frequencies: 0.009243 305500 -- (-1944.989) [-1945.332] (-1943.553) (-1944.012) * [-1944.178] (-1949.068) (-1946.726) (-1948.918) -- 0:00:47 306000 -- (-1948.779) (-1947.309) (-1944.147) [-1944.100] * (-1943.844) (-1944.860) (-1945.106) [-1943.733] -- 0:00:47 306500 -- (-1943.106) (-1947.481) (-1943.168) [-1944.831] * [-1944.274] (-1944.469) (-1942.997) (-1945.230) -- 0:00:47 307000 -- (-1949.103) (-1950.113) [-1944.109] (-1945.333) * (-1944.274) [-1944.703] (-1943.485) (-1943.104) -- 0:00:47 307500 -- (-1946.342) [-1945.996] (-1944.109) (-1945.433) * [-1944.892] (-1944.962) (-1944.273) (-1944.227) -- 0:00:47 308000 -- (-1945.564) (-1945.156) (-1945.522) [-1944.203] * (-1944.845) (-1946.308) [-1942.811] (-1950.239) -- 0:00:47 308500 -- (-1945.434) (-1945.410) (-1944.971) [-1945.018] * (-1945.853) (-1944.063) [-1942.813] (-1951.316) -- 0:00:47 309000 -- (-1944.810) (-1943.547) (-1947.020) [-1944.938] * [-1942.858] (-1947.317) (-1942.813) (-1947.455) -- 0:00:46 309500 -- (-1944.074) (-1943.432) (-1943.988) [-1944.655] * (-1943.100) (-1945.640) [-1943.137] (-1947.036) -- 0:00:46 310000 -- (-1943.857) (-1943.578) [-1944.007] (-1945.277) * (-1943.983) [-1945.742] (-1943.498) (-1944.145) -- 0:00:46 Average standard deviation of split frequencies: 0.010453 310500 -- (-1944.536) (-1943.431) [-1944.393] (-1945.598) * [-1945.024] (-1945.308) (-1949.677) (-1942.790) -- 0:00:46 311000 -- [-1948.447] (-1944.743) (-1946.208) (-1952.474) * (-1944.467) (-1944.928) (-1945.134) [-1943.601] -- 0:00:46 311500 -- [-1945.421] (-1944.775) (-1946.268) (-1945.864) * (-1945.641) [-1943.169] (-1942.788) (-1943.851) -- 0:00:46 312000 -- (-1945.361) [-1943.798] (-1944.941) (-1943.594) * [-1943.356] (-1945.496) (-1942.927) (-1944.197) -- 0:00:46 312500 -- [-1949.955] (-1947.559) (-1945.457) (-1943.253) * (-1943.189) [-1944.002] (-1943.977) (-1945.263) -- 0:00:46 313000 -- (-1948.381) (-1944.955) (-1945.776) [-1942.747] * (-1943.739) (-1944.859) [-1943.807] (-1949.162) -- 0:00:46 313500 -- (-1944.859) (-1943.473) [-1945.555] (-1945.062) * (-1944.677) (-1947.903) [-1944.223] (-1950.566) -- 0:00:45 314000 -- (-1949.417) (-1945.145) (-1946.596) [-1942.765] * (-1944.794) (-1949.390) [-1943.826] (-1947.164) -- 0:00:45 314500 -- (-1943.389) [-1947.880] (-1947.241) (-1947.741) * (-1944.608) (-1942.658) (-1949.673) [-1947.742] -- 0:00:45 315000 -- [-1944.405] (-1945.588) (-1947.146) (-1946.752) * (-1943.418) (-1944.433) (-1947.584) [-1944.109] -- 0:00:45 Average standard deviation of split frequencies: 0.010277 315500 -- (-1943.757) (-1943.934) (-1943.903) [-1943.599] * (-1943.123) [-1946.014] (-1943.217) (-1945.046) -- 0:00:45 316000 -- [-1944.205] (-1947.990) (-1944.678) (-1944.832) * (-1943.284) [-1943.804] (-1943.775) (-1943.547) -- 0:00:45 316500 -- [-1943.536] (-1948.020) (-1946.103) (-1944.288) * [-1943.115] (-1946.361) (-1944.276) (-1944.739) -- 0:00:45 317000 -- [-1945.649] (-1947.682) (-1944.337) (-1944.679) * (-1944.915) [-1947.898] (-1943.931) (-1944.316) -- 0:00:45 317500 -- [-1943.286] (-1946.382) (-1945.040) (-1950.739) * (-1944.931) (-1947.567) (-1946.195) [-1943.740] -- 0:00:45 318000 -- [-1943.344] (-1947.005) (-1944.351) (-1943.912) * (-1946.549) [-1947.158] (-1949.176) (-1944.106) -- 0:00:45 318500 -- (-1943.126) (-1944.898) [-1947.326] (-1945.667) * (-1944.455) (-1943.359) [-1952.644] (-1942.828) -- 0:00:44 319000 -- (-1943.081) (-1947.184) [-1945.921] (-1947.279) * [-1943.348] (-1944.544) (-1946.063) (-1942.773) -- 0:00:44 319500 -- [-1945.797] (-1945.572) (-1943.804) (-1945.882) * (-1942.979) (-1945.101) (-1948.611) [-1945.412] -- 0:00:46 320000 -- (-1945.893) (-1945.249) (-1946.193) [-1943.903] * [-1943.296] (-1946.223) (-1944.225) (-1946.337) -- 0:00:46 Average standard deviation of split frequencies: 0.011597 320500 -- (-1944.435) (-1945.440) (-1944.270) [-1943.802] * [-1944.359] (-1944.357) (-1948.217) (-1945.309) -- 0:00:46 321000 -- (-1947.376) (-1946.495) (-1945.584) [-1945.044] * (-1943.361) [-1943.449] (-1948.746) (-1943.774) -- 0:00:46 321500 -- (-1946.289) [-1950.099] (-1945.334) (-1946.032) * (-1943.147) (-1943.686) [-1944.245] (-1945.436) -- 0:00:46 322000 -- (-1949.049) (-1946.386) (-1945.379) [-1943.191] * [-1943.119] (-1946.124) (-1947.564) (-1946.555) -- 0:00:46 322500 -- (-1946.452) [-1945.978] (-1944.651) (-1946.730) * (-1943.170) [-1946.491] (-1945.864) (-1944.427) -- 0:00:46 323000 -- [-1946.172] (-1943.215) (-1943.810) (-1944.581) * (-1943.125) (-1950.574) [-1948.071] (-1943.230) -- 0:00:46 323500 -- [-1947.237] (-1944.484) (-1946.976) (-1944.130) * (-1946.366) (-1948.144) (-1950.495) [-1942.944] -- 0:00:46 324000 -- (-1948.861) (-1943.673) (-1945.084) [-1946.431] * (-1943.346) [-1947.145] (-1944.552) (-1943.213) -- 0:00:45 324500 -- (-1948.020) [-1944.780] (-1947.308) (-1943.676) * (-1943.654) (-1946.892) (-1944.235) [-1943.631] -- 0:00:45 325000 -- [-1945.087] (-1943.228) (-1944.829) (-1943.463) * (-1945.452) [-1944.763] (-1948.168) (-1948.449) -- 0:00:45 Average standard deviation of split frequencies: 0.012693 325500 -- (-1944.873) (-1944.677) (-1944.928) [-1943.223] * [-1942.861] (-1943.102) (-1945.731) (-1951.581) -- 0:00:45 326000 -- (-1944.249) (-1943.545) (-1944.148) [-1944.260] * (-1942.931) (-1943.523) [-1943.675] (-1944.505) -- 0:00:45 326500 -- [-1945.656] (-1944.933) (-1945.771) (-1945.687) * (-1943.542) (-1944.952) [-1946.477] (-1949.114) -- 0:00:45 327000 -- (-1946.312) (-1944.169) (-1947.050) [-1945.199] * [-1943.614] (-1948.149) (-1945.757) (-1945.552) -- 0:00:45 327500 -- (-1944.375) (-1945.178) [-1946.451] (-1945.500) * (-1947.073) (-1944.165) [-1944.578] (-1944.553) -- 0:00:45 328000 -- (-1945.380) (-1945.063) (-1945.771) [-1942.828] * (-1943.810) [-1945.150] (-1944.940) (-1944.112) -- 0:00:45 328500 -- (-1945.113) [-1943.691] (-1947.833) (-1946.908) * (-1944.650) (-1944.760) (-1947.357) [-1943.937] -- 0:00:44 329000 -- (-1946.055) (-1943.991) [-1946.709] (-1943.025) * [-1943.073] (-1944.062) (-1945.210) (-1947.074) -- 0:00:44 329500 -- [-1949.670] (-1943.991) (-1944.583) (-1945.617) * [-1943.126] (-1943.549) (-1947.712) (-1945.342) -- 0:00:44 330000 -- (-1948.072) (-1942.505) (-1945.916) [-1945.240] * [-1943.445] (-1944.152) (-1945.433) (-1945.824) -- 0:00:44 Average standard deviation of split frequencies: 0.012751 330500 -- (-1944.924) (-1943.472) [-1945.688] (-1944.270) * [-1943.109] (-1945.050) (-1945.101) (-1944.578) -- 0:00:44 331000 -- (-1945.039) [-1945.378] (-1947.145) (-1942.397) * (-1943.109) (-1943.518) (-1944.381) [-1945.204] -- 0:00:44 331500 -- [-1945.217] (-1944.508) (-1946.515) (-1944.308) * (-1943.442) (-1943.518) (-1942.736) [-1949.187] -- 0:00:44 332000 -- (-1945.272) (-1945.234) (-1946.751) [-1944.198] * (-1943.484) [-1942.856] (-1942.736) (-1945.340) -- 0:00:44 332500 -- [-1946.113] (-1944.622) (-1954.106) (-1942.669) * (-1943.486) (-1942.925) (-1943.383) [-1945.585] -- 0:00:44 333000 -- [-1947.959] (-1944.866) (-1945.286) (-1943.441) * [-1942.575] (-1944.430) (-1944.208) (-1945.973) -- 0:00:44 333500 -- (-1945.404) (-1944.095) [-1945.431] (-1943.580) * (-1942.946) (-1944.126) (-1943.730) [-1944.022] -- 0:00:43 334000 -- (-1944.236) [-1946.139] (-1947.817) (-1943.101) * (-1943.342) (-1944.192) [-1942.923] (-1944.675) -- 0:00:45 334500 -- [-1944.656] (-1946.226) (-1947.141) (-1943.977) * (-1943.241) (-1946.914) [-1946.137] (-1943.565) -- 0:00:45 335000 -- (-1944.791) [-1943.749] (-1944.314) (-1943.426) * [-1944.748] (-1945.356) (-1945.425) (-1943.803) -- 0:00:45 Average standard deviation of split frequencies: 0.013370 335500 -- [-1944.455] (-1944.807) (-1944.699) (-1943.082) * (-1945.610) (-1943.930) (-1945.654) [-1942.812] -- 0:00:45 336000 -- (-1948.042) (-1945.161) (-1945.836) [-1943.144] * [-1944.272] (-1945.552) (-1944.829) (-1943.266) -- 0:00:45 336500 -- (-1944.531) [-1943.853] (-1944.716) (-1944.666) * [-1945.646] (-1945.056) (-1947.271) (-1944.738) -- 0:00:45 337000 -- (-1944.417) [-1945.199] (-1944.338) (-1946.389) * [-1946.234] (-1942.933) (-1944.776) (-1942.644) -- 0:00:45 337500 -- [-1944.758] (-1943.165) (-1944.170) (-1945.056) * [-1947.317] (-1943.735) (-1944.229) (-1943.123) -- 0:00:45 338000 -- [-1945.326] (-1943.397) (-1945.550) (-1943.906) * (-1948.758) (-1942.775) (-1944.911) [-1946.445] -- 0:00:45 338500 -- (-1948.067) [-1944.328] (-1945.639) (-1944.877) * (-1947.143) (-1942.772) [-1952.496] (-1945.312) -- 0:00:44 339000 -- (-1946.460) [-1947.796] (-1945.075) (-1946.917) * [-1945.235] (-1946.710) (-1943.361) (-1945.295) -- 0:00:44 339500 -- (-1943.768) (-1948.816) [-1945.546] (-1942.621) * (-1949.857) (-1946.158) (-1945.217) [-1944.649] -- 0:00:44 340000 -- [-1943.655] (-1950.165) (-1946.118) (-1945.318) * [-1944.680] (-1944.888) (-1945.712) (-1945.531) -- 0:00:44 Average standard deviation of split frequencies: 0.012861 340500 -- [-1944.073] (-1944.566) (-1948.673) (-1942.698) * (-1948.139) (-1945.538) (-1948.669) [-1944.341] -- 0:00:44 341000 -- [-1944.555] (-1945.927) (-1947.596) (-1944.105) * (-1947.257) [-1944.137] (-1944.126) (-1943.828) -- 0:00:44 341500 -- (-1945.251) [-1947.768] (-1946.801) (-1943.642) * (-1944.642) (-1947.229) [-1944.145] (-1944.508) -- 0:00:44 342000 -- [-1945.425] (-1943.826) (-1953.770) (-1943.387) * (-1942.986) (-1944.222) [-1943.735] (-1951.392) -- 0:00:44 342500 -- (-1945.271) (-1946.108) [-1944.377] (-1945.141) * (-1943.295) (-1951.092) (-1946.120) [-1945.009] -- 0:00:44 343000 -- [-1945.747] (-1944.201) (-1944.732) (-1947.743) * (-1943.490) (-1945.031) [-1943.636] (-1942.902) -- 0:00:44 343500 -- (-1946.024) (-1942.961) [-1944.892] (-1949.156) * (-1946.164) (-1944.117) [-1943.637] (-1944.504) -- 0:00:43 344000 -- (-1945.578) [-1943.239] (-1949.118) (-1950.115) * (-1944.123) [-1943.899] (-1943.488) (-1943.075) -- 0:00:43 344500 -- (-1945.163) (-1943.449) [-1945.577] (-1947.349) * [-1945.900] (-1943.866) (-1944.227) (-1943.116) -- 0:00:43 345000 -- (-1944.786) (-1942.915) (-1945.247) [-1946.624] * (-1946.917) (-1943.617) (-1948.037) [-1942.884] -- 0:00:43 Average standard deviation of split frequencies: 0.012035 345500 -- (-1947.993) [-1943.150] (-1947.142) (-1943.638) * [-1944.014] (-1943.376) (-1944.716) (-1942.870) -- 0:00:43 346000 -- (-1943.665) [-1943.010] (-1945.081) (-1946.064) * (-1944.255) [-1942.920] (-1943.395) (-1944.541) -- 0:00:43 346500 -- (-1944.940) [-1942.998] (-1943.449) (-1944.761) * (-1946.274) (-1944.984) [-1943.268] (-1944.414) -- 0:00:43 347000 -- (-1943.983) (-1946.461) [-1943.311] (-1945.306) * (-1945.838) (-1945.450) [-1945.687] (-1945.535) -- 0:00:43 347500 -- (-1943.770) (-1944.842) [-1947.304] (-1945.328) * (-1945.322) (-1945.981) [-1945.316] (-1951.162) -- 0:00:43 348000 -- (-1946.560) (-1944.636) [-1942.811] (-1945.157) * [-1945.325] (-1949.808) (-1944.073) (-1945.006) -- 0:00:44 348500 -- (-1945.016) [-1943.343] (-1943.404) (-1945.717) * (-1945.027) (-1949.496) [-1944.925] (-1943.260) -- 0:00:44 349000 -- (-1946.628) [-1946.536] (-1943.158) (-1946.721) * [-1944.864] (-1947.142) (-1945.876) (-1943.665) -- 0:00:44 349500 -- (-1946.666) [-1943.576] (-1945.997) (-1946.270) * [-1947.617] (-1943.487) (-1944.167) (-1943.936) -- 0:00:44 350000 -- [-1945.246] (-1943.398) (-1946.181) (-1943.443) * (-1947.326) (-1943.001) (-1944.959) [-1946.843] -- 0:00:44 Average standard deviation of split frequencies: 0.012696 350500 -- [-1946.543] (-1943.273) (-1945.273) (-1944.979) * [-1948.376] (-1943.628) (-1947.305) (-1945.052) -- 0:00:44 351000 -- (-1945.523) [-1943.096] (-1943.564) (-1944.588) * (-1944.782) (-1947.005) (-1944.758) [-1944.697] -- 0:00:44 351500 -- (-1945.139) [-1946.289] (-1945.247) (-1943.515) * (-1945.686) [-1947.838] (-1945.812) (-1947.106) -- 0:00:44 352000 -- (-1944.550) (-1944.914) (-1945.831) [-1944.204] * (-1943.097) (-1946.808) [-1945.584] (-1945.243) -- 0:00:44 352500 -- (-1948.464) (-1946.988) (-1946.139) [-1944.204] * [-1943.095] (-1944.503) (-1945.381) (-1946.363) -- 0:00:44 353000 -- (-1944.231) [-1945.405] (-1956.017) (-1943.499) * (-1943.303) (-1948.487) [-1946.289] (-1946.697) -- 0:00:43 353500 -- [-1945.656] (-1944.130) (-1947.060) (-1944.049) * [-1944.024] (-1948.697) (-1948.482) (-1948.384) -- 0:00:43 354000 -- (-1947.482) (-1949.807) [-1949.265] (-1942.711) * (-1947.412) (-1949.177) [-1944.740] (-1944.165) -- 0:00:43 354500 -- (-1946.384) [-1947.619] (-1944.228) (-1942.683) * (-1946.263) (-1944.964) [-1944.014] (-1949.833) -- 0:00:43 355000 -- (-1944.967) (-1946.734) (-1945.303) [-1946.608] * (-1942.820) [-1944.964] (-1943.201) (-1949.440) -- 0:00:43 Average standard deviation of split frequencies: 0.011918 355500 -- (-1945.156) (-1945.906) (-1945.742) [-1945.732] * [-1944.291] (-1944.351) (-1944.198) (-1944.597) -- 0:00:43 356000 -- [-1945.533] (-1945.490) (-1945.840) (-1947.503) * (-1944.026) (-1943.162) [-1943.923] (-1943.028) -- 0:00:43 356500 -- (-1943.610) (-1945.862) [-1942.632] (-1943.839) * (-1943.485) (-1944.523) (-1943.307) [-1944.961] -- 0:00:43 357000 -- (-1944.195) (-1945.586) (-1945.653) [-1946.015] * (-1942.998) (-1942.942) [-1943.380] (-1944.890) -- 0:00:43 357500 -- (-1947.088) (-1944.804) (-1944.421) [-1944.885] * (-1944.350) [-1945.137] (-1943.818) (-1943.981) -- 0:00:43 358000 -- (-1946.088) (-1944.789) [-1945.467] (-1944.387) * (-1951.555) (-1944.818) (-1943.977) [-1944.466] -- 0:00:43 358500 -- (-1943.287) [-1944.611] (-1945.620) (-1948.174) * [-1946.372] (-1944.129) (-1945.479) (-1947.921) -- 0:00:42 359000 -- (-1944.760) (-1946.010) (-1944.627) [-1944.361] * [-1946.311] (-1943.233) (-1945.787) (-1950.391) -- 0:00:42 359500 -- [-1943.870] (-1943.892) (-1944.876) (-1944.419) * [-1944.245] (-1943.847) (-1946.311) (-1945.819) -- 0:00:42 360000 -- (-1944.104) (-1943.249) [-1944.559] (-1943.047) * (-1943.958) (-1943.963) [-1945.421] (-1946.353) -- 0:00:42 Average standard deviation of split frequencies: 0.011302 360500 -- [-1944.198] (-1944.202) (-1945.406) (-1943.123) * (-1945.374) (-1943.743) (-1948.891) [-1943.906] -- 0:00:42 361000 -- (-1944.716) (-1946.122) [-1943.755] (-1945.630) * (-1946.000) (-1944.195) [-1945.457] (-1945.697) -- 0:00:42 361500 -- (-1943.983) (-1945.251) [-1944.698] (-1943.290) * (-1950.092) (-1942.839) [-1944.452] (-1944.482) -- 0:00:42 362000 -- (-1944.609) [-1943.512] (-1944.941) (-1942.755) * (-1946.774) (-1943.017) (-1943.753) [-1945.634] -- 0:00:42 362500 -- (-1944.594) [-1943.102] (-1943.804) (-1943.392) * (-1945.851) [-1943.017] (-1944.822) (-1946.018) -- 0:00:43 363000 -- (-1943.552) [-1943.536] (-1949.863) (-1944.698) * [-1945.622] (-1943.206) (-1945.533) (-1944.964) -- 0:00:43 363500 -- (-1944.751) [-1943.917] (-1948.397) (-1944.577) * [-1945.673] (-1944.923) (-1946.755) (-1945.367) -- 0:00:43 364000 -- [-1944.490] (-1943.725) (-1945.245) (-1942.691) * (-1945.673) (-1944.902) (-1943.986) [-1944.686] -- 0:00:43 364500 -- [-1945.586] (-1944.692) (-1947.150) (-1946.583) * (-1944.198) [-1943.906] (-1945.398) (-1950.942) -- 0:00:43 365000 -- (-1945.468) (-1944.371) [-1945.416] (-1947.588) * (-1942.777) (-1949.286) [-1944.268] (-1949.562) -- 0:00:43 Average standard deviation of split frequencies: 0.011163 365500 -- (-1943.860) (-1947.986) [-1947.067] (-1945.005) * [-1945.578] (-1942.676) (-1942.888) (-1948.191) -- 0:00:43 366000 -- (-1943.518) (-1947.088) (-1944.817) [-1945.101] * (-1949.971) (-1945.751) (-1942.915) [-1947.999] -- 0:00:43 366500 -- (-1945.359) (-1946.247) (-1945.066) [-1943.535] * (-1944.539) [-1946.270] (-1946.835) (-1944.648) -- 0:00:43 367000 -- [-1945.313] (-1945.662) (-1945.309) (-1943.983) * (-1945.640) [-1944.380] (-1945.786) (-1947.015) -- 0:00:43 367500 -- (-1943.597) [-1943.962] (-1943.339) (-1944.018) * [-1943.649] (-1945.357) (-1944.576) (-1945.695) -- 0:00:43 368000 -- (-1943.857) (-1943.414) [-1944.044] (-1944.401) * (-1943.566) (-1944.648) [-1949.236] (-1944.659) -- 0:00:42 368500 -- [-1945.139] (-1946.708) (-1945.206) (-1944.422) * (-1944.488) [-1948.481] (-1950.745) (-1947.271) -- 0:00:42 369000 -- (-1944.606) [-1945.589] (-1946.408) (-1942.745) * [-1944.072] (-1946.726) (-1944.269) (-1948.533) -- 0:00:42 369500 -- (-1945.286) (-1945.057) (-1945.529) [-1942.803] * (-1944.684) (-1945.800) (-1946.477) [-1949.348] -- 0:00:42 370000 -- (-1944.949) (-1949.172) (-1944.553) [-1945.024] * [-1944.733] (-1944.224) (-1945.396) (-1945.514) -- 0:00:42 Average standard deviation of split frequencies: 0.011147 370500 -- [-1943.843] (-1948.510) (-1943.720) (-1945.647) * [-1943.570] (-1945.868) (-1942.996) (-1946.378) -- 0:00:42 371000 -- (-1945.476) (-1944.769) [-1946.670] (-1943.660) * (-1943.591) (-1944.599) (-1942.676) [-1945.384] -- 0:00:42 371500 -- (-1944.822) (-1944.655) [-1944.203] (-1945.949) * (-1946.256) [-1943.668] (-1942.575) (-1945.286) -- 0:00:42 372000 -- (-1945.452) (-1950.500) [-1943.395] (-1945.538) * (-1946.281) (-1946.209) (-1942.575) [-1944.725] -- 0:00:42 372500 -- (-1947.401) (-1946.088) (-1944.221) [-1944.297] * (-1944.877) [-1947.905] (-1943.081) (-1944.614) -- 0:00:42 373000 -- [-1944.676] (-1945.553) (-1943.867) (-1945.449) * (-1945.158) (-1945.107) (-1943.397) [-1945.669] -- 0:00:42 373500 -- [-1945.064] (-1945.434) (-1947.420) (-1944.420) * (-1948.960) [-1944.206] (-1948.361) (-1945.840) -- 0:00:41 374000 -- (-1948.119) (-1946.190) [-1942.963] (-1945.842) * (-1944.223) (-1944.834) [-1947.135] (-1945.480) -- 0:00:41 374500 -- (-1944.555) (-1944.337) (-1944.022) [-1947.502] * (-1943.447) (-1943.961) (-1946.606) [-1945.810] -- 0:00:41 375000 -- (-1946.380) (-1948.502) [-1943.385] (-1945.715) * [-1944.104] (-1949.646) (-1950.262) (-1945.653) -- 0:00:41 Average standard deviation of split frequencies: 0.011136 375500 -- [-1944.853] (-1946.516) (-1944.412) (-1945.372) * (-1946.905) (-1946.699) [-1950.644] (-1946.247) -- 0:00:41 376000 -- (-1945.684) (-1946.705) (-1943.149) [-1945.933] * (-1946.550) (-1944.465) [-1952.818] (-1945.928) -- 0:00:41 376500 -- (-1948.499) (-1946.515) [-1943.149] (-1946.281) * (-1944.023) (-1947.657) (-1944.878) [-1945.803] -- 0:00:43 377000 -- (-1945.861) (-1945.576) [-1943.264] (-1946.637) * [-1943.646] (-1944.706) (-1945.411) (-1946.257) -- 0:00:42 377500 -- (-1946.147) (-1948.587) (-1942.813) [-1946.490] * (-1943.566) (-1944.349) (-1944.742) [-1942.734] -- 0:00:42 378000 -- [-1943.457] (-1947.534) (-1944.372) (-1943.963) * (-1944.507) [-1943.523] (-1944.053) (-1943.268) -- 0:00:42 378500 -- (-1948.266) (-1946.376) (-1945.110) [-1946.652] * (-1942.875) [-1944.441] (-1943.215) (-1942.712) -- 0:00:42 379000 -- (-1949.286) [-1944.823] (-1947.118) (-1944.500) * (-1945.547) (-1946.597) [-1942.779] (-1942.814) -- 0:00:42 379500 -- (-1951.934) (-1945.691) [-1944.931] (-1944.500) * (-1943.530) [-1945.429] (-1944.919) (-1943.059) -- 0:00:42 380000 -- [-1943.242] (-1948.185) (-1944.771) (-1944.697) * (-1943.623) (-1944.134) (-1945.884) [-1944.085] -- 0:00:42 Average standard deviation of split frequencies: 0.011532 380500 -- (-1943.055) (-1945.835) [-1949.757] (-1943.886) * (-1944.589) (-1944.166) (-1945.421) [-1945.284] -- 0:00:42 381000 -- (-1943.150) (-1944.349) (-1945.630) [-1943.242] * (-1945.995) [-1944.948] (-1944.693) (-1946.662) -- 0:00:42 381500 -- (-1944.109) [-1944.459] (-1946.383) (-1943.979) * (-1943.734) [-1944.341] (-1943.778) (-1947.137) -- 0:00:42 382000 -- (-1943.891) [-1944.218] (-1946.385) (-1944.489) * [-1943.648] (-1945.165) (-1945.339) (-1946.948) -- 0:00:42 382500 -- (-1949.198) (-1945.770) [-1946.033] (-1945.288) * (-1943.716) (-1944.094) (-1945.234) [-1946.542] -- 0:00:41 383000 -- (-1946.606) (-1943.464) (-1948.436) [-1945.191] * (-1943.363) (-1945.009) (-1945.900) [-1944.836] -- 0:00:41 383500 -- [-1945.871] (-1946.286) (-1947.048) (-1946.726) * [-1943.219] (-1947.104) (-1948.974) (-1944.670) -- 0:00:41 384000 -- (-1944.432) (-1943.153) [-1945.747] (-1946.358) * (-1947.789) (-1943.666) [-1945.453] (-1948.258) -- 0:00:41 384500 -- (-1947.347) (-1944.615) [-1947.513] (-1944.202) * (-1948.616) (-1944.120) (-1946.637) [-1944.245] -- 0:00:41 385000 -- (-1945.550) (-1948.874) [-1945.605] (-1947.620) * (-1949.184) (-1944.804) (-1944.909) [-1943.601] -- 0:00:41 Average standard deviation of split frequencies: 0.011297 385500 -- (-1946.788) (-1948.381) (-1948.425) [-1945.961] * (-1949.175) [-1944.580] (-1943.959) (-1946.291) -- 0:00:41 386000 -- [-1948.027] (-1943.298) (-1945.191) (-1948.281) * (-1945.239) (-1951.354) (-1944.425) [-1950.916] -- 0:00:41 386500 -- (-1944.873) [-1942.712] (-1945.533) (-1949.079) * (-1946.375) [-1944.441] (-1944.947) (-1956.909) -- 0:00:41 387000 -- (-1945.603) [-1944.183] (-1947.627) (-1947.406) * [-1944.449] (-1944.813) (-1945.157) (-1945.662) -- 0:00:41 387500 -- (-1942.814) (-1946.231) [-1943.961] (-1948.015) * [-1948.284] (-1944.175) (-1947.034) (-1946.067) -- 0:00:41 388000 -- (-1951.748) [-1945.508] (-1943.472) (-1943.838) * [-1945.448] (-1944.929) (-1948.229) (-1951.927) -- 0:00:41 388500 -- [-1945.206] (-1946.155) (-1943.253) (-1944.494) * (-1943.944) [-1945.464] (-1944.482) (-1944.611) -- 0:00:40 389000 -- (-1944.158) [-1942.725] (-1943.236) (-1944.831) * (-1943.524) (-1944.606) (-1943.623) [-1944.426] -- 0:00:40 389500 -- (-1943.422) (-1942.585) (-1942.967) [-1944.786] * (-1942.647) [-1942.780] (-1944.669) (-1943.912) -- 0:00:40 390000 -- (-1950.700) (-1944.194) [-1944.873] (-1946.782) * (-1945.335) (-1948.064) (-1945.669) [-1943.661] -- 0:00:40 Average standard deviation of split frequencies: 0.011237 390500 -- (-1948.056) [-1947.212] (-1943.248) (-1947.379) * (-1946.265) (-1943.644) [-1944.549] (-1944.668) -- 0:00:42 391000 -- (-1945.765) (-1945.710) (-1942.921) [-1947.947] * [-1946.650] (-1943.331) (-1946.401) (-1944.467) -- 0:00:42 391500 -- (-1950.120) [-1944.803] (-1943.475) (-1950.091) * (-1950.142) (-1943.343) [-1946.401] (-1944.347) -- 0:00:41 392000 -- (-1946.788) (-1944.328) [-1944.298] (-1945.536) * (-1946.659) (-1944.383) (-1946.225) [-1942.852] -- 0:00:41 392500 -- (-1951.610) [-1945.370] (-1943.831) (-1947.178) * [-1944.212] (-1945.897) (-1946.421) (-1943.465) -- 0:00:41 393000 -- (-1948.080) (-1945.226) [-1943.512] (-1946.333) * (-1943.027) [-1945.211] (-1945.249) (-1943.895) -- 0:00:41 393500 -- [-1950.153] (-1945.441) (-1946.905) (-1945.564) * (-1945.594) (-1949.612) [-1942.953] (-1943.133) -- 0:00:41 394000 -- (-1946.654) (-1943.809) (-1946.978) [-1947.347] * (-1943.093) [-1948.206] (-1949.687) (-1944.593) -- 0:00:41 394500 -- (-1946.253) (-1944.517) (-1944.887) [-1945.594] * (-1942.514) (-1946.470) [-1945.790] (-1946.830) -- 0:00:41 395000 -- (-1945.617) (-1943.892) (-1945.678) [-1946.964] * (-1944.965) (-1943.105) [-1943.700] (-1946.114) -- 0:00:41 Average standard deviation of split frequencies: 0.009449 395500 -- [-1943.511] (-1945.949) (-1946.141) (-1945.769) * (-1943.994) (-1942.999) [-1945.704] (-1946.554) -- 0:00:41 396000 -- [-1944.081] (-1944.827) (-1945.008) (-1945.389) * (-1944.333) [-1946.383] (-1946.610) (-1945.974) -- 0:00:41 396500 -- (-1946.224) [-1946.921] (-1951.004) (-1946.357) * (-1944.377) [-1945.962] (-1944.260) (-1944.668) -- 0:00:41 397000 -- (-1944.193) (-1946.959) (-1945.442) [-1945.618] * (-1945.348) (-1946.454) [-1946.248] (-1946.079) -- 0:00:41 397500 -- (-1945.588) (-1945.074) [-1943.831] (-1946.079) * (-1948.754) (-1946.895) [-1943.188] (-1946.437) -- 0:00:40 398000 -- (-1943.999) (-1943.894) (-1944.501) [-1944.259] * (-1945.544) (-1945.725) (-1943.466) [-1943.257] -- 0:00:40 398500 -- [-1943.913] (-1943.191) (-1945.557) (-1944.559) * (-1947.274) [-1945.630] (-1945.220) (-1943.306) -- 0:00:40 399000 -- (-1943.706) (-1945.478) (-1947.464) [-1945.800] * (-1944.349) [-1947.870] (-1944.690) (-1944.546) -- 0:00:40 399500 -- (-1945.007) (-1943.778) [-1944.748] (-1945.325) * (-1947.296) [-1947.250] (-1944.463) (-1943.935) -- 0:00:40 400000 -- [-1944.930] (-1944.770) (-1946.067) (-1945.643) * (-1942.564) (-1946.408) (-1943.373) [-1944.171] -- 0:00:40 Average standard deviation of split frequencies: 0.009707 400500 -- [-1946.948] (-1944.550) (-1945.723) (-1943.248) * [-1943.478] (-1945.324) (-1943.444) (-1943.970) -- 0:00:40 401000 -- (-1953.443) [-1944.331] (-1943.265) (-1944.460) * [-1944.367] (-1944.062) (-1944.332) (-1942.974) -- 0:00:40 401500 -- (-1943.526) (-1945.583) [-1944.758] (-1944.622) * (-1943.905) [-1944.879] (-1944.441) (-1943.803) -- 0:00:40 402000 -- [-1943.519] (-1945.607) (-1943.372) (-1944.895) * (-1943.502) [-1944.249] (-1944.433) (-1943.435) -- 0:00:40 402500 -- [-1942.722] (-1945.878) (-1944.970) (-1945.020) * (-1945.132) (-1942.722) [-1944.780] (-1943.293) -- 0:00:40 403000 -- (-1945.157) (-1945.808) [-1945.672] (-1946.100) * (-1944.779) [-1943.020] (-1946.913) (-1943.400) -- 0:00:39 403500 -- [-1945.966] (-1947.337) (-1946.611) (-1948.365) * (-1945.425) (-1944.865) (-1946.533) [-1944.769] -- 0:00:39 404000 -- (-1944.633) [-1945.628] (-1947.817) (-1946.399) * [-1945.713] (-1944.695) (-1945.438) (-1947.998) -- 0:00:39 404500 -- (-1946.683) [-1946.607] (-1945.489) (-