--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:50:42 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1813/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -786.73 -790.05
2 -786.83 -790.91
--------------------------------------
TOTAL -786.78 -790.57
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894099 0.090495 0.345104 1.482300 0.862708 1232.65 1366.83 1.000
r(A<->C){all} 0.165365 0.018838 0.000004 0.458322 0.131201 224.72 226.45 1.001
r(A<->G){all} 0.180811 0.022424 0.000028 0.480672 0.143756 189.73 211.36 1.001
r(A<->T){all} 0.163228 0.018112 0.000085 0.431733 0.131895 166.20 243.91 1.000
r(C<->G){all} 0.168004 0.019690 0.000048 0.449079 0.132172 158.21 173.33 1.003
r(C<->T){all} 0.173016 0.020604 0.000258 0.467257 0.133306 160.01 220.28 1.003
r(G<->T){all} 0.149577 0.015585 0.000062 0.395052 0.117434 194.05 240.90 1.002
pi(A){all} 0.210923 0.000288 0.179892 0.244932 0.210499 1322.08 1338.43 1.000
pi(C){all} 0.285534 0.000352 0.249148 0.322775 0.285570 1186.86 1211.17 1.000
pi(G){all} 0.280703 0.000355 0.243465 0.315475 0.280325 1262.98 1285.98 1.000
pi(T){all} 0.222840 0.000315 0.188532 0.257229 0.222525 1213.61 1262.62 1.000
alpha{1,2} 0.411411 0.227608 0.000249 1.406530 0.242573 1316.78 1352.43 1.001
alpha{3} 0.456043 0.233509 0.000154 1.421922 0.304782 1171.61 1244.23 1.000
pinvar{all} 0.997119 0.000012 0.990698 0.999998 0.998190 865.64 1115.80 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -749.726351
Model 2: PositiveSelection -749.726351
Model 0: one-ratio -749.726597
Model 7: beta -749.726351
Model 8: beta&w>1 -749.726351
Model 0 vs 1 4.919999998946878E-4
Model 2 vs 1 0.0
Model 8 vs 7 0.0
>C1
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C2
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C3
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C4
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C5
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C6
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=190
C1 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C2 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C3 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C4 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C5 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C6 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
**************************************************
C1 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C2 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C3 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C4 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C5 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C6 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
**************************************************
C1 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C2 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C3 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C4 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C5 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C6 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
**************************************************
C1 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C2 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C3 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C4 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C5 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C6 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
****************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5700]--->[5700]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.478 Mb, Max= 30.731 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C2 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C3 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C4 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C5 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C6 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
**************************************************
C1 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C2 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C3 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C4 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C5 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C6 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
**************************************************
C1 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C2 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C3 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C4 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C5 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C6 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
**************************************************
C1 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C2 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C3 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C4 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C5 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C6 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
****************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
C2 ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
C3 ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
C4 ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
C5 ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
C6 ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
**************************************************
C1 ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
C2 ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
C3 ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
C4 ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
C5 ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
C6 ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
**************************************************
C1 TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
C2 TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
C3 TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
C4 TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
C5 TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
C6 TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
**************************************************
C1 GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
C2 GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
C3 GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
C4 GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
C5 GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
C6 GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
**************************************************
C1 GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
C2 GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
C3 GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
C4 GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
C5 GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
C6 GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
**************************************************
C1 TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
C2 TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
C3 TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
C4 TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
C5 TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
C6 TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
**************************************************
C1 TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
C2 TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
C3 TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
C4 TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
C5 TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
C6 TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
**************************************************
C1 GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
C2 GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
C3 GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
C4 GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
C5 GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
C6 GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
**************************************************
C1 TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
C2 TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
C3 TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
C4 TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
C5 TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
C6 TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
**************************************************
C1 TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
C2 TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
C3 TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
C4 TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
C5 TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
C6 TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
**************************************************
C1 GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
C2 GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
C3 GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
C4 GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
C5 GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
C6 GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
**************************************************
C1 AAGACGTTAATCGGGCTGAT
C2 AAGACGTTAATCGGGCTGAT
C3 AAGACGTTAATCGGGCTGAT
C4 AAGACGTTAATCGGGCTGAT
C5 AAGACGTTAATCGGGCTGAT
C6 AAGACGTTAATCGGGCTGAT
********************
>C1
ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
AAGACGTTAATCGGGCTGAT
>C2
ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
AAGACGTTAATCGGGCTGAT
>C3
ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
AAGACGTTAATCGGGCTGAT
>C4
ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
AAGACGTTAATCGGGCTGAT
>C5
ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
AAGACGTTAATCGGGCTGAT
>C6
ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
AAGACGTTAATCGGGCTGAT
>C1
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C2
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C3
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C4
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C5
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C6
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 570 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579859352
Setting output file names to "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1369769605
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5762428659
Seed = 772022519
Swapseed = 1579859352
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1275.687132 -- -24.965149
Chain 2 -- -1275.687327 -- -24.965149
Chain 3 -- -1275.687327 -- -24.965149
Chain 4 -- -1275.687253 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1275.687132 -- -24.965149
Chain 2 -- -1275.687327 -- -24.965149
Chain 3 -- -1275.687327 -- -24.965149
Chain 4 -- -1275.687327 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1275.687] (-1275.687) (-1275.687) (-1275.687) * [-1275.687] (-1275.687) (-1275.687) (-1275.687)
500 -- (-799.345) (-800.288) [-796.644] (-797.560) * (-804.019) (-801.742) (-808.539) [-799.991] -- 0:00:00
1000 -- (-794.446) (-802.688) [-793.580] (-798.951) * (-801.461) (-792.554) (-795.616) [-792.307] -- 0:00:00
1500 -- (-791.182) (-799.205) [-793.569] (-799.085) * (-797.867) [-796.900] (-797.575) (-804.901) -- 0:00:00
2000 -- (-801.538) (-792.886) [-795.801] (-799.459) * (-791.937) [-798.992] (-796.432) (-800.104) -- 0:00:00
2500 -- (-804.867) (-794.809) (-802.738) [-797.191] * (-801.130) (-793.805) (-793.275) [-798.076] -- 0:00:00
3000 -- [-790.029] (-800.438) (-793.262) (-795.494) * (-806.315) (-804.155) (-796.637) [-798.766] -- 0:00:00
3500 -- [-792.993] (-796.939) (-799.628) (-798.902) * [-792.397] (-793.753) (-795.750) (-793.929) -- 0:00:00
4000 -- (-803.239) (-799.357) [-792.099] (-803.007) * [-790.772] (-794.257) (-796.832) (-799.428) -- 0:00:00
4500 -- [-806.404] (-796.477) (-801.678) (-799.462) * (-792.728) [-797.064] (-800.126) (-798.270) -- 0:00:00
5000 -- (-801.088) (-801.682) (-795.344) [-799.297] * (-797.202) (-798.820) (-797.314) [-802.877] -- 0:00:00
Average standard deviation of split frequencies: 0.102138
5500 -- (-800.084) (-792.575) (-794.518) [-793.745] * [-797.254] (-804.311) (-798.386) (-795.268) -- 0:00:00
6000 -- (-801.406) (-790.125) [-803.453] (-792.159) * [-795.829] (-793.980) (-795.627) (-793.781) -- 0:00:00
6500 -- [-785.670] (-802.128) (-797.157) (-797.395) * (-791.784) (-798.126) [-794.710] (-798.768) -- 0:00:00
7000 -- (-787.047) [-792.200] (-791.563) (-801.271) * [-797.978] (-798.308) (-795.648) (-793.630) -- 0:00:00
7500 -- (-786.162) (-798.470) (-800.432) [-795.514] * [-798.372] (-809.231) (-803.314) (-805.546) -- 0:00:00
8000 -- [-787.053] (-800.554) (-796.308) (-804.156) * (-803.761) (-803.026) (-799.335) [-794.351] -- 0:00:00
8500 -- (-786.243) [-797.524] (-800.070) (-795.895) * (-801.359) (-802.558) [-792.593] (-798.820) -- 0:00:00
9000 -- (-786.407) (-806.093) (-791.984) [-802.042] * (-796.307) (-801.326) [-791.681] (-797.315) -- 0:00:00
9500 -- (-787.942) [-793.512] (-795.037) (-792.736) * (-800.462) (-795.042) (-797.869) [-803.501] -- 0:00:00
10000 -- (-785.619) [-793.340] (-808.219) (-804.528) * (-792.864) (-792.600) [-797.858] (-793.378) -- 0:00:00
Average standard deviation of split frequencies: 0.068746
10500 -- (-786.294) [-794.577] (-796.755) (-799.566) * (-791.566) (-797.619) [-794.952] (-801.053) -- 0:01:34
11000 -- (-787.840) (-794.902) [-795.935] (-798.032) * (-810.448) [-803.082] (-797.967) (-798.010) -- 0:01:29
11500 -- (-787.032) [-795.643] (-797.410) (-792.355) * (-796.637) (-793.206) [-800.694] (-795.838) -- 0:01:25
12000 -- (-787.956) (-797.964) [-792.671] (-791.860) * (-794.537) [-795.561] (-798.509) (-798.008) -- 0:01:22
12500 -- (-790.183) [-793.204] (-797.507) (-795.489) * [-796.581] (-791.725) (-800.731) (-793.090) -- 0:01:19
13000 -- (-790.620) [-790.712] (-792.536) (-795.468) * (-796.847) (-789.549) (-795.294) [-798.583] -- 0:01:15
13500 -- (-787.698) [-793.533] (-803.123) (-792.772) * (-800.936) (-792.567) [-800.349] (-802.835) -- 0:01:13
14000 -- (-787.682) (-791.529) [-792.566] (-799.201) * (-791.936) (-793.891) [-791.751] (-797.346) -- 0:01:10
14500 -- (-787.220) (-799.228) (-797.520) [-799.787] * (-794.036) [-795.303] (-795.606) (-797.853) -- 0:01:07
15000 -- (-786.768) (-796.752) [-800.963] (-799.368) * (-802.785) [-796.831] (-795.373) (-798.095) -- 0:01:05
Average standard deviation of split frequencies: 0.073657
15500 -- (-791.194) [-793.876] (-801.979) (-797.145) * (-792.738) (-803.665) (-803.036) [-795.897] -- 0:01:03
16000 -- (-790.103) (-795.057) [-801.303] (-795.063) * (-800.901) [-792.223] (-795.365) (-798.297) -- 0:01:01
16500 -- (-790.672) [-794.818] (-795.417) (-790.456) * (-808.014) (-792.906) [-798.185] (-804.588) -- 0:00:59
17000 -- (-787.392) [-799.085] (-801.610) (-801.296) * (-790.371) (-805.804) [-789.605] (-795.536) -- 0:00:57
17500 -- (-787.991) (-794.191) [-800.453] (-789.228) * [-786.250] (-795.385) (-789.067) (-793.565) -- 0:00:56
18000 -- (-786.078) (-800.569) [-800.000] (-790.479) * (-786.736) (-797.037) [-786.095] (-804.456) -- 0:00:54
18500 -- (-785.759) (-805.365) [-790.997] (-793.675) * (-787.628) (-801.639) [-785.780] (-794.540) -- 0:00:53
19000 -- [-785.759] (-793.562) (-797.933) (-790.090) * (-796.365) [-794.883] (-785.543) (-795.283) -- 0:00:51
19500 -- (-792.040) (-795.076) [-798.523] (-789.813) * (-792.745) (-795.766) [-785.313] (-795.624) -- 0:00:50
20000 -- [-790.890] (-797.805) (-793.568) (-788.719) * (-790.742) [-795.236] (-787.334) (-795.692) -- 0:00:49
Average standard deviation of split frequencies: 0.062727
20500 -- (-785.735) (-798.330) (-795.943) [-788.029] * (-786.449) [-796.988] (-787.528) (-796.221) -- 0:00:47
21000 -- [-787.514] (-794.762) (-799.770) (-788.708) * [-787.438] (-791.430) (-786.703) (-797.612) -- 0:00:46
21500 -- (-786.588) [-805.107] (-804.097) (-786.090) * (-787.906) (-793.240) [-786.611] (-795.905) -- 0:00:45
22000 -- [-788.042] (-802.662) (-796.463) (-786.226) * [-787.143] (-797.064) (-786.684) (-805.019) -- 0:01:28
22500 -- (-789.048) (-795.314) [-795.918] (-787.409) * [-788.921] (-794.289) (-786.090) (-802.957) -- 0:01:26
23000 -- (-788.228) [-795.687] (-799.388) (-786.902) * [-785.869] (-796.356) (-787.476) (-803.357) -- 0:01:24
23500 -- (-786.495) (-792.424) (-797.861) [-787.669] * [-787.205] (-798.757) (-785.656) (-796.616) -- 0:01:23
24000 -- [-787.937] (-789.574) (-797.292) (-788.697) * [-788.567] (-801.858) (-789.261) (-794.687) -- 0:01:21
24500 -- (-785.740) (-794.556) [-795.869] (-785.832) * (-789.638) (-807.942) [-789.532] (-793.978) -- 0:01:19
25000 -- (-786.017) (-798.042) [-795.690] (-789.261) * (-788.720) (-804.620) (-788.750) [-797.019] -- 0:01:18
Average standard deviation of split frequencies: 0.050939
25500 -- (-786.334) [-794.748] (-804.683) (-787.155) * [-788.519] (-801.263) (-787.616) (-796.939) -- 0:01:16
26000 -- [-786.396] (-796.309) (-799.693) (-787.187) * (-789.104) (-796.321) (-785.063) [-798.486] -- 0:01:14
26500 -- [-786.503] (-796.921) (-800.198) (-786.257) * (-789.848) (-801.169) (-787.750) [-796.794] -- 0:01:13
27000 -- (-788.220) (-798.903) [-797.072] (-787.820) * (-785.885) (-791.214) (-787.935) [-797.968] -- 0:01:12
27500 -- [-788.230] (-790.980) (-817.435) (-786.563) * [-786.235] (-799.292) (-788.344) (-802.759) -- 0:01:10
28000 -- [-787.743] (-796.042) (-791.900) (-792.124) * [-789.254] (-801.556) (-787.337) (-798.238) -- 0:01:09
28500 -- (-786.457) (-802.247) (-785.459) [-788.100] * [-786.510] (-801.387) (-786.881) (-797.775) -- 0:01:08
29000 -- (-785.739) (-795.962) [-786.161] (-788.105) * (-787.376) [-797.999] (-787.235) (-802.797) -- 0:01:06
29500 -- (-788.457) (-795.122) (-786.942) [-788.426] * (-791.509) (-795.025) (-788.761) [-793.589] -- 0:01:05
30000 -- (-788.268) [-797.128] (-786.412) (-787.036) * (-788.090) [-797.368] (-787.180) (-794.573) -- 0:01:04
Average standard deviation of split frequencies: 0.040526
30500 -- (-787.689) (-791.877) (-788.832) [-786.164] * (-787.502) (-799.371) (-792.546) [-794.777] -- 0:01:03
31000 -- (-787.242) (-797.000) [-791.050] (-788.634) * (-786.975) (-809.171) [-786.889] (-796.756) -- 0:01:02
31500 -- (-787.412) [-790.854] (-788.731) (-787.284) * (-786.732) (-796.187) (-786.483) [-790.105] -- 0:01:01
32000 -- [-787.467] (-792.704) (-792.599) (-789.263) * (-788.875) (-795.148) [-788.728] (-799.471) -- 0:01:00
32500 -- (-787.813) [-794.598] (-791.125) (-786.279) * (-789.266) (-792.189) (-788.707) [-797.751] -- 0:00:59
33000 -- [-785.851] (-801.962) (-787.158) (-791.374) * [-791.036] (-799.449) (-792.844) (-793.359) -- 0:00:58
33500 -- (-789.452) (-794.010) [-787.131] (-787.860) * [-788.040] (-797.692) (-787.057) (-791.482) -- 0:00:57
34000 -- (-787.411) [-804.576] (-789.267) (-787.313) * (-788.418) (-796.798) (-788.046) [-795.906] -- 0:00:56
34500 -- (-787.145) (-796.531) [-786.971] (-790.959) * [-787.051] (-801.916) (-787.566) (-790.615) -- 0:00:55
35000 -- (-786.621) (-802.610) (-786.882) [-788.815] * (-793.428) (-792.574) [-786.999] (-794.618) -- 0:00:55
Average standard deviation of split frequencies: 0.038629
35500 -- (-786.894) (-798.974) (-789.879) [-788.004] * (-789.931) (-798.056) (-786.129) [-790.554] -- 0:00:54
36000 -- (-788.200) (-803.577) (-789.347) [-788.596] * (-787.218) (-793.163) [-787.106] (-797.810) -- 0:01:20
36500 -- (-789.490) (-792.393) (-789.746) [-786.969] * [-789.108] (-793.014) (-790.497) (-795.931) -- 0:01:19
37000 -- [-792.763] (-792.481) (-788.730) (-787.476) * (-785.626) (-794.698) [-785.705] (-797.413) -- 0:01:18
37500 -- (-787.317) [-795.471] (-786.195) (-787.804) * (-789.030) [-795.169] (-787.838) (-808.668) -- 0:01:17
38000 -- (-787.836) [-797.513] (-785.546) (-787.428) * (-785.551) [-797.530] (-788.505) (-796.980) -- 0:01:15
38500 -- [-787.176] (-798.224) (-786.441) (-785.704) * (-786.174) (-794.797) (-792.550) [-793.854] -- 0:01:14
39000 -- (-788.121) (-802.252) (-791.299) [-787.161] * (-785.971) (-793.303) (-789.045) [-797.167] -- 0:01:13
39500 -- (-786.935) [-799.885] (-785.888) (-788.413) * (-786.615) (-795.311) (-788.088) [-794.169] -- 0:01:12
40000 -- [-788.134] (-801.751) (-788.457) (-786.625) * [-786.006] (-795.563) (-786.625) (-798.026) -- 0:01:12
Average standard deviation of split frequencies: 0.033037
40500 -- (-789.983) [-794.542] (-787.285) (-786.496) * (-786.891) (-791.904) [-785.916] (-799.835) -- 0:01:11
41000 -- [-787.104] (-800.048) (-794.072) (-787.182) * [-789.148] (-794.974) (-788.986) (-796.454) -- 0:01:10
41500 -- (-787.362) (-793.572) (-793.011) [-787.181] * (-790.213) (-798.792) (-787.828) [-801.309] -- 0:01:09
42000 -- (-787.984) (-797.558) (-787.922) [-786.205] * (-788.233) (-802.775) (-791.923) [-796.091] -- 0:01:08
42500 -- (-787.013) (-797.137) (-787.592) [-786.618] * [-792.151] (-797.324) (-788.386) (-793.801) -- 0:01:07
43000 -- (-789.294) [-793.849] (-789.262) (-789.114) * (-795.877) (-793.372) (-788.692) [-800.919] -- 0:01:06
43500 -- (-791.093) [-797.874] (-789.969) (-790.251) * (-792.120) (-801.259) (-790.345) [-794.603] -- 0:01:05
44000 -- [-788.218] (-797.229) (-789.268) (-789.172) * (-786.934) (-812.897) (-787.358) [-800.615] -- 0:01:05
44500 -- [-786.993] (-803.521) (-787.033) (-791.118) * (-789.864) (-788.754) [-787.033] (-792.464) -- 0:01:04
45000 -- [-790.367] (-793.881) (-792.220) (-791.877) * (-786.495) [-785.920] (-793.278) (-796.025) -- 0:01:03
Average standard deviation of split frequencies: 0.035868
45500 -- (-787.065) [-791.288] (-790.133) (-788.886) * (-787.751) [-790.347] (-791.474) (-799.823) -- 0:01:02
46000 -- (-791.033) (-797.230) (-789.716) [-788.693] * (-788.060) [-788.196] (-786.553) (-793.647) -- 0:01:02
46500 -- (-786.184) (-799.162) (-790.802) [-786.960] * (-786.136) [-788.016] (-786.547) (-794.992) -- 0:01:01
47000 -- (-791.132) (-799.017) [-789.186] (-786.974) * (-790.757) (-787.668) [-788.456] (-790.588) -- 0:01:00
47500 -- (-788.946) [-801.256] (-787.629) (-786.049) * (-786.024) [-785.710] (-785.858) (-819.807) -- 0:01:00
48000 -- [-789.957] (-803.866) (-786.917) (-787.888) * [-787.245] (-787.509) (-789.222) (-788.392) -- 0:00:59
48500 -- (-785.386) (-789.946) [-788.649] (-790.557) * [-788.116] (-787.466) (-788.111) (-789.902) -- 0:00:58
49000 -- (-785.452) [-793.777] (-786.573) (-786.638) * (-786.223) (-788.247) [-791.496] (-785.846) -- 0:00:58
49500 -- (-786.898) [-804.876] (-786.926) (-786.371) * [-787.484] (-785.852) (-789.013) (-786.054) -- 0:00:57
50000 -- (-790.525) (-799.305) [-788.316] (-785.238) * [-787.734] (-786.767) (-790.468) (-787.625) -- 0:00:57
Average standard deviation of split frequencies: 0.036370
50500 -- (-789.524) [-793.027] (-785.956) (-791.039) * (-790.991) (-787.303) (-789.981) [-788.842] -- 0:00:56
51000 -- (-789.048) (-793.880) (-785.554) [-786.876] * [-786.833] (-786.830) (-787.981) (-787.582) -- 0:00:55
51500 -- (-789.777) (-798.803) (-785.590) [-785.667] * (-787.970) (-786.779) (-787.721) [-786.200] -- 0:00:55
52000 -- [-785.608] (-797.186) (-788.755) (-785.565) * (-786.230) (-791.535) (-788.497) [-786.518] -- 0:01:12
52500 -- [-790.629] (-798.522) (-787.825) (-786.592) * (-788.933) (-791.788) (-786.905) [-785.938] -- 0:01:12
53000 -- [-787.297] (-801.394) (-786.981) (-788.006) * (-786.940) (-788.106) (-786.794) [-785.901] -- 0:01:11
53500 -- (-786.478) (-806.743) [-789.660] (-787.671) * (-790.869) [-785.970] (-789.367) (-791.265) -- 0:01:10
54000 -- [-786.976] (-790.537) (-789.212) (-787.668) * (-791.114) [-788.010] (-789.367) (-791.871) -- 0:01:10
54500 -- (-789.016) (-804.641) [-785.567] (-787.286) * [-787.969] (-790.239) (-789.019) (-788.978) -- 0:01:09
55000 -- (-790.020) (-800.350) [-790.902] (-789.026) * (-787.566) (-789.548) (-789.642) [-786.863] -- 0:01:08
Average standard deviation of split frequencies: 0.034473
55500 -- (-787.571) [-794.980] (-786.557) (-785.744) * (-788.684) (-787.924) (-790.147) [-786.077] -- 0:01:08
56000 -- (-787.536) (-792.287) [-787.038] (-785.725) * [-786.427] (-788.836) (-786.692) (-786.887) -- 0:01:07
56500 -- (-789.846) (-800.640) [-789.157] (-786.217) * (-785.937) [-788.163] (-787.665) (-787.126) -- 0:01:06
57000 -- (-789.395) (-808.753) (-788.843) [-787.251] * (-786.037) (-787.404) (-786.646) [-787.764] -- 0:01:06
57500 -- [-792.423] (-795.035) (-789.392) (-787.322) * (-789.378) (-786.420) [-787.546] (-787.274) -- 0:01:05
58000 -- (-785.980) (-799.581) (-788.263) [-789.077] * (-786.728) (-787.839) [-785.345] (-789.896) -- 0:01:04
58500 -- (-785.533) (-803.870) (-788.198) [-787.426] * [-788.584] (-789.908) (-785.569) (-789.888) -- 0:01:04
59000 -- [-791.596] (-791.392) (-786.118) (-786.582) * (-785.594) (-789.132) (-786.949) [-790.083] -- 0:01:03
59500 -- (-786.131) [-787.435] (-789.866) (-786.306) * (-787.745) [-787.530] (-790.189) (-793.488) -- 0:01:03
60000 -- (-785.919) (-788.405) [-790.493] (-790.539) * (-785.890) (-789.714) (-789.029) [-786.131] -- 0:01:02
Average standard deviation of split frequencies: 0.032636
60500 -- (-785.694) (-786.946) (-791.165) [-787.593] * (-786.804) (-789.495) (-787.824) [-787.028] -- 0:01:02
61000 -- (-785.993) (-789.287) [-787.048] (-790.955) * (-787.179) (-789.513) (-788.009) [-788.328] -- 0:01:01
61500 -- (-785.827) [-789.632] (-789.088) (-786.896) * (-787.794) (-787.726) (-788.096) [-786.249] -- 0:01:01
62000 -- (-788.781) (-787.812) (-791.465) [-789.771] * [-785.738] (-787.306) (-786.769) (-788.410) -- 0:01:00
62500 -- (-788.407) [-787.782] (-788.897) (-787.199) * (-786.033) (-794.187) (-787.155) [-791.138] -- 0:01:00
63000 -- (-786.739) [-788.813] (-787.336) (-785.787) * (-786.772) (-786.125) [-790.525] (-788.805) -- 0:00:59
63500 -- (-786.753) (-787.832) (-785.704) [-785.989] * (-791.514) [-787.318] (-787.919) (-788.505) -- 0:00:58
64000 -- (-785.921) [-786.770] (-788.130) (-789.594) * (-785.754) (-787.395) [-786.827] (-786.215) -- 0:00:58
64500 -- (-786.650) (-785.895) [-785.933] (-787.761) * (-787.175) [-787.335] (-787.769) (-788.689) -- 0:00:58
65000 -- [-786.735] (-786.468) (-785.691) (-786.917) * (-787.182) (-786.677) (-787.635) [-785.938] -- 0:00:57
Average standard deviation of split frequencies: 0.032791
65500 -- (-787.982) (-786.277) [-786.530] (-790.780) * [-787.257] (-793.183) (-788.398) (-786.131) -- 0:00:57
66000 -- [-786.151] (-788.656) (-788.051) (-792.128) * [-786.091] (-786.499) (-786.469) (-786.361) -- 0:00:56
66500 -- (-786.582) (-786.927) [-785.855] (-786.832) * (-788.521) [-787.042] (-786.852) (-787.549) -- 0:00:56
67000 -- (-787.126) (-786.378) (-786.654) [-785.555] * (-787.233) (-795.862) [-788.721] (-786.656) -- 0:01:09
67500 -- (-788.639) (-787.714) (-788.586) [-785.729] * (-786.723) [-787.664] (-786.903) (-789.259) -- 0:01:09
68000 -- (-788.239) (-786.560) (-790.287) [-789.782] * [-786.856] (-787.984) (-786.418) (-790.341) -- 0:01:08
68500 -- (-787.682) (-789.753) [-793.798] (-786.208) * [-788.347] (-787.982) (-786.278) (-788.307) -- 0:01:07
69000 -- (-790.144) (-789.384) [-786.411] (-786.386) * (-786.609) (-786.976) (-787.485) [-785.528] -- 0:01:07
69500 -- (-790.076) (-787.327) [-788.156] (-788.023) * (-787.646) [-787.542] (-786.194) (-787.425) -- 0:01:06
70000 -- (-796.790) [-785.300] (-788.338) (-789.244) * (-786.209) (-787.835) [-790.343] (-787.190) -- 0:01:06
Average standard deviation of split frequencies: 0.030019
70500 -- (-788.248) (-786.160) (-785.820) [-790.715] * (-789.883) (-787.381) [-787.417] (-786.230) -- 0:01:05
71000 -- (-788.036) [-790.091] (-785.854) (-786.023) * (-788.092) [-785.824] (-787.707) (-788.632) -- 0:01:05
71500 -- (-787.067) (-787.215) (-789.411) [-786.514] * (-789.636) (-786.057) (-788.433) [-787.253] -- 0:01:04
72000 -- [-788.036] (-789.890) (-788.017) (-788.208) * (-789.184) (-787.310) (-787.411) [-789.505] -- 0:01:04
72500 -- (-786.321) [-789.863] (-787.485) (-788.030) * (-788.415) [-785.492] (-786.576) (-786.912) -- 0:01:03
73000 -- (-786.201) (-790.315) (-789.147) [-787.763] * (-787.782) (-789.606) (-785.973) [-789.691] -- 0:01:03
73500 -- (-788.125) [-787.618] (-788.294) (-785.616) * (-787.979) (-785.617) (-786.902) [-787.509] -- 0:01:03
74000 -- (-786.823) [-785.983] (-787.402) (-788.079) * (-787.025) [-789.695] (-787.208) (-788.503) -- 0:01:02
74500 -- (-787.770) (-789.449) [-786.868] (-786.355) * (-788.839) (-786.892) (-787.562) [-786.716] -- 0:01:02
75000 -- (-793.266) (-788.974) [-786.920] (-787.650) * (-787.944) (-787.258) (-788.732) [-788.198] -- 0:01:01
Average standard deviation of split frequencies: 0.026878
75500 -- (-785.944) (-791.390) [-786.424] (-787.493) * [-787.012] (-786.529) (-789.773) (-788.986) -- 0:01:01
76000 -- [-790.869] (-790.913) (-787.941) (-785.331) * (-788.519) (-787.885) (-785.599) [-786.652] -- 0:01:00
76500 -- (-790.355) (-789.127) [-786.611] (-786.767) * (-790.241) (-790.928) (-787.764) [-787.845] -- 0:01:00
77000 -- [-787.374] (-786.166) (-785.780) (-786.514) * (-790.388) [-790.395] (-786.715) (-786.461) -- 0:00:59
77500 -- (-786.549) [-786.184] (-785.851) (-786.745) * (-787.140) (-790.534) [-786.427] (-790.084) -- 0:00:59
78000 -- [-786.659] (-787.204) (-786.912) (-791.166) * (-787.780) (-785.807) [-785.777] (-787.122) -- 0:00:59
78500 -- (-790.086) (-786.490) (-787.883) [-788.916] * (-788.232) (-788.035) [-786.419] (-788.205) -- 0:00:58
79000 -- (-786.908) [-785.950] (-789.421) (-793.845) * (-786.766) (-788.056) [-792.606] (-792.771) -- 0:00:58
79500 -- [-786.795] (-788.929) (-786.625) (-788.882) * (-790.887) (-786.450) (-792.568) [-787.304] -- 0:00:57
80000 -- (-786.277) [-788.518] (-787.612) (-791.102) * (-788.438) (-788.200) (-789.632) [-785.925] -- 0:00:57
Average standard deviation of split frequencies: 0.028157
80500 -- (-788.106) (-789.773) [-791.261] (-786.003) * (-791.537) [-790.625] (-792.759) (-787.705) -- 0:00:57
81000 -- [-789.420] (-788.918) (-787.928) (-786.337) * (-792.663) (-787.048) [-793.373] (-785.612) -- 0:00:56
81500 -- (-791.673) [-789.176] (-791.992) (-785.393) * (-792.194) (-786.277) (-785.890) [-787.675] -- 0:00:56
82000 -- (-792.237) (-790.451) (-793.500) [-785.349] * [-787.480] (-788.965) (-786.519) (-789.744) -- 0:00:55
82500 -- (-786.263) (-789.454) [-787.058] (-789.133) * (-786.830) (-786.305) (-790.239) [-786.921] -- 0:00:55
83000 -- (-786.480) (-789.239) (-788.584) [-788.860] * (-787.624) (-789.898) [-785.993] (-787.840) -- 0:01:06
83500 -- (-786.488) (-789.074) [-786.411] (-788.137) * (-790.695) [-786.613] (-792.368) (-785.602) -- 0:01:05
84000 -- (-788.194) (-787.024) (-786.014) [-786.905] * [-787.997] (-788.946) (-786.938) (-786.488) -- 0:01:05
84500 -- (-789.196) [-788.681] (-788.154) (-787.012) * (-785.909) (-788.978) [-787.434] (-785.554) -- 0:01:05
85000 -- (-788.941) (-788.107) [-786.505] (-787.930) * (-787.968) (-786.656) (-791.206) [-788.650] -- 0:01:04
Average standard deviation of split frequencies: 0.028155
85500 -- [-788.192] (-786.772) (-788.494) (-787.379) * (-788.325) [-788.017] (-789.005) (-786.582) -- 0:01:04
86000 -- (-791.105) (-788.478) [-786.177] (-787.592) * (-786.140) (-787.695) (-789.441) [-787.196] -- 0:01:03
86500 -- (-790.279) (-788.192) [-785.393] (-786.227) * (-788.200) [-788.506] (-786.326) (-786.935) -- 0:01:03
87000 -- (-790.553) [-788.755] (-786.306) (-786.148) * (-788.699) [-787.751] (-787.509) (-786.786) -- 0:01:02
87500 -- (-786.893) (-792.195) (-785.778) [-789.517] * (-786.268) (-787.108) [-788.295] (-788.479) -- 0:01:02
88000 -- (-788.060) [-787.376] (-785.962) (-786.551) * [-785.925] (-785.566) (-787.570) (-788.405) -- 0:01:02
88500 -- (-785.883) (-792.442) [-785.600] (-786.720) * (-789.414) (-787.732) (-790.414) [-785.245] -- 0:01:01
89000 -- (-789.633) (-790.430) (-787.311) [-788.540] * [-786.581] (-786.880) (-793.303) (-786.560) -- 0:01:01
89500 -- (-785.185) (-790.400) (-786.577) [-787.148] * (-787.027) [-787.343] (-794.513) (-786.440) -- 0:01:01
90000 -- [-785.008] (-790.212) (-788.369) (-789.568) * (-786.257) [-786.348] (-793.547) (-785.938) -- 0:01:00
Average standard deviation of split frequencies: 0.027730
90500 -- (-787.436) (-786.937) [-793.421] (-786.480) * [-786.878] (-787.430) (-789.535) (-785.461) -- 0:01:00
91000 -- (-787.525) (-786.219) [-786.732] (-791.900) * [-785.778] (-787.012) (-790.012) (-790.466) -- 0:00:59
91500 -- (-787.825) (-786.212) (-787.404) [-785.411] * (-785.572) (-791.567) (-789.305) [-789.962] -- 0:00:59
92000 -- (-787.183) (-786.772) (-789.206) [-786.559] * (-787.549) (-789.629) (-788.485) [-790.242] -- 0:00:59
92500 -- [-787.225] (-785.617) (-785.741) (-788.042) * (-788.954) (-788.139) [-787.517] (-787.067) -- 0:00:58
93000 -- (-787.202) (-788.694) (-787.907) [-787.556] * (-787.470) [-788.290] (-785.742) (-787.986) -- 0:00:58
93500 -- (-787.231) [-787.238] (-787.945) (-786.468) * (-792.529) (-791.076) [-787.766] (-787.554) -- 0:00:58
94000 -- (-786.648) (-786.653) [-790.785] (-786.843) * (-789.333) (-789.898) [-786.321] (-789.300) -- 0:00:57
94500 -- [-786.804] (-786.408) (-788.189) (-790.308) * (-787.443) [-787.566] (-787.088) (-788.452) -- 0:00:57
95000 -- (-788.542) [-789.797] (-787.920) (-786.862) * (-789.031) (-786.113) (-787.537) [-786.804] -- 0:00:57
Average standard deviation of split frequencies: 0.025020
95500 -- (-787.693) (-787.621) [-787.173] (-792.998) * (-786.992) [-787.215] (-787.562) (-786.745) -- 0:00:56
96000 -- (-787.991) (-789.900) [-787.593] (-788.152) * (-786.942) (-787.569) (-788.197) [-788.480] -- 0:00:56
96500 -- (-787.867) (-796.053) (-789.294) [-790.642] * (-792.820) (-786.983) [-787.215] (-786.654) -- 0:00:56
97000 -- (-792.474) [-792.747] (-787.918) (-789.498) * [-788.981] (-791.449) (-788.897) (-786.423) -- 0:00:55
97500 -- [-790.446] (-786.210) (-786.443) (-786.509) * (-787.329) (-788.208) [-788.367] (-785.589) -- 0:00:55
98000 -- (-787.322) [-785.945] (-786.162) (-791.172) * (-785.990) (-792.779) [-786.304] (-791.612) -- 0:00:55
98500 -- (-786.246) [-788.991] (-786.768) (-790.698) * (-785.143) [-788.937] (-786.588) (-790.908) -- 0:00:54
99000 -- (-790.464) [-788.585] (-786.812) (-786.858) * (-786.027) [-788.273] (-788.991) (-788.585) -- 0:01:03
99500 -- (-787.100) [-789.022] (-785.705) (-787.618) * (-786.303) (-788.381) [-786.213] (-790.188) -- 0:01:03
100000 -- (-787.498) (-789.578) [-787.512] (-786.608) * (-787.342) (-787.394) (-785.908) [-787.656] -- 0:01:02
Average standard deviation of split frequencies: 0.024306
100500 -- (-788.073) (-787.741) [-787.075] (-787.637) * (-787.559) [-788.527] (-786.582) (-788.615) -- 0:01:02
101000 -- (-787.760) (-787.612) [-790.055] (-787.133) * (-787.291) (-787.120) [-786.000] (-786.950) -- 0:01:02
101500 -- [-789.142] (-787.717) (-789.059) (-788.348) * (-787.389) (-786.522) (-790.743) [-787.446] -- 0:01:01
102000 -- (-788.028) [-786.025] (-787.369) (-785.471) * (-790.803) (-785.343) [-787.468] (-787.360) -- 0:01:01
102500 -- (-786.154) (-792.167) [-787.006] (-787.250) * [-786.497] (-787.911) (-786.743) (-786.758) -- 0:01:01
103000 -- (-785.751) [-787.495] (-787.810) (-787.036) * (-786.503) [-791.911] (-786.036) (-787.635) -- 0:01:00
103500 -- (-785.903) (-786.885) (-789.372) [-787.332] * [-787.487] (-790.493) (-789.986) (-789.678) -- 0:01:00
104000 -- (-786.362) [-785.985] (-789.256) (-789.118) * (-787.831) [-788.001] (-794.074) (-789.206) -- 0:01:00
104500 -- (-788.353) (-787.199) (-786.491) [-787.669] * (-789.232) (-787.465) [-789.506] (-789.429) -- 0:00:59
105000 -- [-785.797] (-786.837) (-786.453) (-785.454) * (-786.753) [-785.839] (-787.985) (-787.849) -- 0:00:59
Average standard deviation of split frequencies: 0.021177
105500 -- (-787.283) [-791.023] (-790.415) (-788.019) * [-786.774] (-786.251) (-785.812) (-787.651) -- 0:00:59
106000 -- (-789.963) [-788.010] (-789.814) (-790.441) * (-786.081) (-785.785) [-786.041] (-788.297) -- 0:00:59
106500 -- (-788.363) [-786.993] (-787.955) (-788.488) * (-786.843) (-786.986) [-788.421] (-788.172) -- 0:00:58
107000 -- [-789.275] (-788.097) (-787.401) (-788.478) * [-787.601] (-787.317) (-788.136) (-788.417) -- 0:00:58
107500 -- [-788.525] (-786.921) (-786.315) (-789.427) * (-786.455) (-786.039) [-792.248] (-792.435) -- 0:00:58
108000 -- (-787.210) (-790.255) [-788.807] (-794.796) * (-787.560) [-787.054] (-787.413) (-787.706) -- 0:00:57
108500 -- (-787.603) [-787.267] (-787.671) (-789.075) * [-785.380] (-788.317) (-788.929) (-788.175) -- 0:00:57
109000 -- (-787.189) (-786.462) [-788.293] (-791.435) * [-787.364] (-787.551) (-788.745) (-789.142) -- 0:00:57
109500 -- (-787.152) [-786.444] (-788.473) (-786.709) * (-786.774) (-788.343) (-788.563) [-785.342] -- 0:00:56
110000 -- (-785.810) (-786.788) (-788.487) [-787.585] * (-787.674) (-788.030) (-786.547) [-786.309] -- 0:00:56
Average standard deviation of split frequencies: 0.020020
110500 -- [-785.473] (-785.567) (-789.606) (-786.809) * (-789.075) [-789.336] (-786.536) (-789.002) -- 0:00:56
111000 -- (-792.420) (-789.462) [-786.204] (-787.842) * (-787.353) [-787.727] (-788.325) (-785.632) -- 0:00:56
111500 -- [-786.529] (-786.810) (-790.302) (-789.085) * (-788.287) (-787.209) (-786.941) [-786.437] -- 0:00:55
112000 -- [-789.047] (-789.106) (-787.216) (-788.573) * (-789.165) [-788.838] (-790.008) (-785.552) -- 0:00:55
112500 -- (-787.844) (-787.872) (-790.149) [-791.324] * (-788.129) (-790.045) [-790.612] (-786.719) -- 0:00:55
113000 -- (-787.622) (-786.176) (-791.964) [-789.568] * (-788.082) (-789.845) (-788.132) [-786.840] -- 0:00:54
113500 -- (-786.603) (-788.616) (-792.753) [-787.533] * (-787.429) (-788.777) [-786.368] (-786.978) -- 0:00:54
114000 -- (-789.253) [-790.293] (-788.393) (-787.011) * (-787.060) [-787.891] (-786.840) (-787.158) -- 0:00:54
114500 -- (-790.398) [-787.527] (-789.427) (-791.578) * (-789.292) (-788.696) [-787.548] (-786.513) -- 0:00:54
115000 -- (-788.238) (-787.746) (-786.581) [-789.371] * (-789.094) [-786.924] (-785.508) (-786.045) -- 0:01:01
Average standard deviation of split frequencies: 0.021335
115500 -- [-787.470] (-787.894) (-786.861) (-787.373) * (-787.710) [-787.647] (-791.898) (-786.506) -- 0:01:01
116000 -- (-787.588) [-788.485] (-788.840) (-788.990) * (-788.396) (-790.171) (-796.343) [-785.954] -- 0:01:00
116500 -- (-787.200) [-788.114] (-794.191) (-786.955) * (-787.373) (-791.182) [-786.413] (-788.631) -- 0:01:00
117000 -- (-791.260) [-788.575] (-791.255) (-788.935) * (-787.287) (-788.498) (-788.197) [-789.861] -- 0:01:00
117500 -- (-790.860) (-788.813) (-786.807) [-786.887] * (-789.175) (-790.178) [-789.445] (-788.595) -- 0:01:00
118000 -- (-786.895) [-788.736] (-789.055) (-786.896) * (-786.937) [-788.065] (-786.621) (-785.711) -- 0:00:59
118500 -- (-787.030) (-786.690) [-789.344] (-786.932) * (-786.692) [-789.250] (-786.336) (-786.633) -- 0:00:59
119000 -- (-786.846) (-787.186) (-788.366) [-788.506] * [-786.745] (-788.034) (-786.411) (-791.008) -- 0:00:59
119500 -- [-786.912] (-787.034) (-788.570) (-788.007) * (-788.224) (-789.937) (-786.999) [-788.034] -- 0:00:58
120000 -- (-789.257) (-786.982) (-787.244) [-786.679] * [-787.702] (-790.704) (-786.198) (-786.427) -- 0:00:58
Average standard deviation of split frequencies: 0.020561
120500 -- (-793.554) (-787.952) (-790.660) [-785.574] * [-786.186] (-786.260) (-785.758) (-786.056) -- 0:00:58
121000 -- (-792.309) (-789.753) (-789.430) [-785.571] * [-788.641] (-786.127) (-790.796) (-785.862) -- 0:00:58
121500 -- [-788.686] (-786.518) (-788.370) (-787.117) * (-789.336) (-790.204) [-786.244] (-787.284) -- 0:00:57
122000 -- (-786.766) (-786.785) [-786.354] (-786.083) * [-785.813] (-790.459) (-787.239) (-787.467) -- 0:00:57
122500 -- (-785.165) (-793.308) [-787.446] (-786.070) * [-786.083] (-788.162) (-787.165) (-789.836) -- 0:00:57
123000 -- [-785.852] (-789.161) (-788.255) (-786.946) * [-786.465] (-788.180) (-787.475) (-787.702) -- 0:00:57
123500 -- (-785.502) (-790.410) (-787.217) [-789.195] * (-785.965) (-787.556) [-787.032] (-786.694) -- 0:00:56
124000 -- (-785.186) (-790.981) [-787.183] (-792.341) * (-788.671) (-787.316) [-790.378] (-787.077) -- 0:00:56
124500 -- (-785.542) (-787.128) [-789.024] (-792.000) * (-789.267) (-787.602) [-787.323] (-788.883) -- 0:00:56
125000 -- (-785.464) (-787.974) (-787.813) [-786.259] * (-788.060) [-786.469] (-786.078) (-788.573) -- 0:00:56
Average standard deviation of split frequencies: 0.021379
125500 -- (-787.143) (-787.203) (-787.507) [-788.132] * (-789.057) (-789.244) [-786.420] (-788.319) -- 0:00:55
126000 -- (-786.666) (-791.850) (-787.207) [-787.922] * [-785.625] (-787.384) (-788.027) (-788.914) -- 0:00:55
126500 -- (-786.244) [-786.518] (-786.621) (-787.184) * (-786.131) [-786.007] (-790.980) (-789.911) -- 0:00:55
127000 -- (-785.322) (-790.495) (-788.400) [-785.930] * (-787.711) [-787.361] (-786.155) (-787.246) -- 0:00:54
127500 -- (-785.839) (-790.901) (-787.065) [-785.749] * (-788.997) [-787.437] (-785.315) (-787.404) -- 0:00:54
128000 -- (-789.559) (-792.252) (-788.301) [-786.681] * (-789.275) [-786.965] (-785.258) (-789.769) -- 0:00:54
128500 -- (-797.225) (-792.691) (-787.213) [-789.295] * (-786.671) (-786.741) [-786.059] (-787.214) -- 0:00:54
129000 -- (-786.011) (-787.662) [-789.351] (-789.328) * [-789.298] (-787.420) (-788.531) (-786.781) -- 0:00:54
129500 -- (-787.938) (-787.334) (-786.551) [-788.713] * [-788.104] (-791.862) (-786.371) (-789.353) -- 0:00:53
130000 -- (-790.168) (-786.192) (-788.303) [-789.969] * (-786.813) [-785.785] (-792.677) (-789.209) -- 0:00:53
Average standard deviation of split frequencies: 0.018580
130500 -- [-786.300] (-785.501) (-786.270) (-790.395) * (-788.746) (-789.304) (-792.189) [-785.942] -- 0:00:53
131000 -- (-786.837) (-786.698) [-786.515] (-788.744) * (-787.139) [-788.199] (-789.064) (-785.125) -- 0:00:59
131500 -- (-787.389) [-785.406] (-786.749) (-785.851) * (-787.960) [-788.266] (-788.495) (-789.559) -- 0:00:59
132000 -- (-788.213) [-787.860] (-786.786) (-791.509) * (-788.371) (-785.419) (-785.749) [-788.325] -- 0:00:59
132500 -- (-789.927) (-791.904) (-786.038) [-791.969] * (-785.438) (-786.358) (-786.963) [-785.173] -- 0:00:58
133000 -- (-791.006) (-791.085) [-785.545] (-793.520) * [-788.957] (-785.826) (-788.775) (-785.574) -- 0:00:58
133500 -- (-785.994) [-786.303] (-785.385) (-787.325) * [-787.333] (-787.286) (-789.860) (-785.244) -- 0:00:58
134000 -- (-785.718) (-786.799) [-790.956] (-789.459) * (-786.736) (-791.240) (-788.457) [-785.750] -- 0:00:58
134500 -- [-785.515] (-786.679) (-791.825) (-788.263) * [-789.333] (-791.418) (-786.528) (-788.076) -- 0:00:57
135000 -- (-787.735) [-786.444] (-791.108) (-788.941) * [-786.564] (-794.492) (-786.333) (-786.345) -- 0:00:57
Average standard deviation of split frequencies: 0.018198
135500 -- [-786.437] (-786.321) (-790.323) (-793.211) * [-785.643] (-792.863) (-786.950) (-788.261) -- 0:00:57
136000 -- [-786.756] (-785.991) (-790.105) (-789.012) * [-786.285] (-792.615) (-787.614) (-791.012) -- 0:00:57
136500 -- (-786.642) [-786.297] (-789.233) (-785.850) * [-785.563] (-790.469) (-787.324) (-791.834) -- 0:00:56
137000 -- (-786.050) (-786.538) [-786.136] (-788.540) * (-785.484) [-789.888] (-787.117) (-789.071) -- 0:00:56
137500 -- [-786.715] (-786.807) (-785.981) (-785.518) * (-785.524) (-796.178) [-785.655] (-786.231) -- 0:00:56
138000 -- (-785.793) (-785.675) (-787.831) [-785.324] * [-787.144] (-797.904) (-786.055) (-786.431) -- 0:00:56
138500 -- (-787.855) (-785.149) (-787.889) [-785.392] * (-787.081) (-786.724) (-786.462) [-786.698] -- 0:00:55
139000 -- (-786.274) (-786.058) [-787.096] (-786.574) * [-788.560] (-785.952) (-786.008) (-786.216) -- 0:00:55
139500 -- (-786.066) (-791.260) [-787.791] (-787.028) * (-787.425) (-787.608) [-787.519] (-786.813) -- 0:00:55
140000 -- (-788.498) [-785.995] (-785.967) (-786.142) * (-786.275) [-789.151] (-786.288) (-789.211) -- 0:00:55
Average standard deviation of split frequencies: 0.019402
140500 -- [-786.499] (-785.493) (-785.543) (-788.248) * (-790.209) [-788.135] (-787.797) (-787.818) -- 0:00:55
141000 -- (-786.488) (-788.934) [-785.330] (-790.933) * (-788.417) [-788.330] (-787.115) (-792.137) -- 0:00:54
141500 -- (-787.104) [-789.278] (-787.719) (-790.732) * [-786.595] (-787.450) (-786.446) (-793.929) -- 0:00:54
142000 -- (-787.977) (-793.135) (-787.687) [-788.770] * (-785.785) (-788.903) (-790.604) [-790.119] -- 0:00:54
142500 -- (-788.357) [-790.422] (-785.174) (-791.095) * [-788.807] (-787.278) (-791.674) (-785.915) -- 0:00:54
143000 -- [-788.666] (-788.137) (-785.411) (-794.120) * [-786.483] (-788.832) (-788.487) (-786.631) -- 0:00:53
143500 -- (-786.670) (-785.552) (-787.975) [-786.332] * (-788.875) [-786.334] (-787.146) (-786.599) -- 0:00:53
144000 -- (-790.206) (-785.804) (-788.506) [-788.766] * (-789.221) (-791.409) [-786.833] (-788.361) -- 0:00:53
144500 -- (-789.236) (-785.807) [-789.041] (-790.115) * [-787.710] (-787.110) (-786.414) (-788.955) -- 0:00:53
145000 -- (-786.533) (-787.742) (-788.711) [-788.636] * (-793.859) (-786.566) [-787.159] (-793.424) -- 0:00:53
Average standard deviation of split frequencies: 0.018727
145500 -- (-785.906) (-788.912) [-787.857] (-785.937) * (-791.148) (-785.794) [-785.977] (-787.046) -- 0:00:52
146000 -- [-786.251] (-786.534) (-787.687) (-785.396) * (-792.092) (-788.372) [-785.483] (-788.866) -- 0:00:52
146500 -- [-787.284] (-785.940) (-786.603) (-788.024) * (-791.176) [-787.948] (-787.001) (-789.039) -- 0:00:52
147000 -- (-788.627) (-786.757) (-786.219) [-788.320] * [-789.738] (-789.087) (-790.662) (-786.576) -- 0:00:58
147500 -- [-789.516] (-789.568) (-786.594) (-789.760) * [-787.500] (-785.619) (-788.501) (-787.288) -- 0:00:57
148000 -- (-788.836) (-788.883) (-787.074) [-790.580] * (-792.047) (-789.974) [-787.303] (-788.326) -- 0:00:57
148500 -- [-787.601] (-787.470) (-787.302) (-790.547) * (-792.105) (-786.497) (-787.421) [-790.200] -- 0:00:57
149000 -- [-785.812] (-786.601) (-786.002) (-792.159) * (-789.530) (-785.637) [-787.462] (-786.764) -- 0:00:57
149500 -- (-786.186) (-787.534) (-789.328) [-786.917] * [-787.121] (-788.384) (-786.378) (-785.507) -- 0:00:56
150000 -- [-786.517] (-789.772) (-791.372) (-790.100) * (-788.619) (-790.734) (-790.460) [-791.631] -- 0:00:56
Average standard deviation of split frequencies: 0.019431
150500 -- [-786.075] (-789.211) (-788.075) (-789.538) * [-787.559] (-787.457) (-788.460) (-786.030) -- 0:00:56
151000 -- (-786.020) (-786.258) (-789.413) [-788.188] * (-790.475) (-791.148) [-787.714] (-787.901) -- 0:00:56
151500 -- (-786.539) (-790.136) [-789.124] (-786.787) * [-786.215] (-794.203) (-786.792) (-788.129) -- 0:00:56
152000 -- (-787.832) (-787.219) [-787.866] (-788.989) * [-786.538] (-786.932) (-787.755) (-788.736) -- 0:00:55
152500 -- (-786.004) (-788.134) (-789.014) [-787.077] * (-786.831) (-786.854) (-789.245) [-790.150] -- 0:00:55
153000 -- [-787.962] (-788.529) (-790.915) (-788.454) * (-790.414) [-786.135] (-787.787) (-787.221) -- 0:00:55
153500 -- (-786.115) (-786.873) (-790.591) [-787.280] * (-789.857) (-790.564) (-788.021) [-787.505] -- 0:00:55
154000 -- (-788.020) [-791.765] (-787.127) (-787.374) * (-786.989) (-785.693) [-786.991] (-787.055) -- 0:00:54
154500 -- [-787.722] (-792.859) (-790.974) (-787.282) * [-788.463] (-785.952) (-787.811) (-785.715) -- 0:00:54
155000 -- [-788.891] (-789.853) (-786.428) (-786.189) * [-785.322] (-786.861) (-789.954) (-785.446) -- 0:00:54
Average standard deviation of split frequencies: 0.017654
155500 -- (-788.142) (-790.214) (-788.913) [-787.425] * (-786.433) (-788.732) (-786.411) [-789.655] -- 0:00:54
156000 -- [-786.486] (-788.816) (-790.869) (-787.025) * (-786.177) (-786.760) [-787.855] (-786.081) -- 0:00:54
156500 -- [-786.049] (-789.897) (-793.921) (-786.151) * [-786.355] (-791.459) (-787.717) (-786.779) -- 0:00:53
157000 -- (-790.297) (-789.348) (-793.132) [-785.316] * (-786.661) (-788.500) (-790.771) [-791.803] -- 0:00:53
157500 -- (-786.104) (-786.101) [-787.574] (-788.629) * [-787.563] (-795.131) (-789.634) (-791.570) -- 0:00:53
158000 -- (-790.838) (-787.543) (-785.736) [-785.722] * [-791.721] (-799.293) (-791.428) (-787.112) -- 0:00:53
158500 -- (-787.120) (-786.520) (-790.143) [-786.284] * (-792.888) [-786.302] (-788.105) (-787.690) -- 0:00:53
159000 -- (-786.286) [-786.447] (-790.746) (-788.450) * (-787.384) [-788.025] (-786.663) (-789.287) -- 0:00:52
159500 -- (-787.683) [-787.603] (-789.395) (-789.593) * [-787.490] (-787.965) (-786.699) (-785.328) -- 0:00:52
160000 -- (-788.067) (-789.131) (-790.340) [-788.166] * (-790.980) (-787.972) [-786.335] (-786.239) -- 0:00:52
Average standard deviation of split frequencies: 0.019457
160500 -- (-786.708) (-787.350) (-787.148) [-785.220] * [-789.878] (-789.821) (-790.190) (-787.432) -- 0:00:52
161000 -- [-787.555] (-785.841) (-789.850) (-787.190) * (-786.886) (-786.741) (-786.918) [-786.253] -- 0:00:52
161500 -- (-785.836) (-786.226) (-786.292) [-785.289] * [-786.260] (-789.081) (-787.021) (-787.037) -- 0:00:51
162000 -- (-787.132) [-787.985] (-786.310) (-785.187) * (-786.003) (-786.581) (-786.047) [-785.767] -- 0:00:51
162500 -- (-791.162) (-794.726) [-787.363] (-785.104) * [-786.430] (-787.682) (-790.621) (-792.041) -- 0:00:56
163000 -- (-787.691) (-791.680) (-786.853) [-785.721] * [-785.813] (-788.891) (-788.155) (-788.118) -- 0:00:56
163500 -- (-786.443) (-786.577) (-786.759) [-787.491] * (-791.648) [-788.024] (-786.392) (-787.011) -- 0:00:56
164000 -- [-786.521] (-785.629) (-792.411) (-790.287) * [-790.181] (-786.882) (-788.310) (-786.531) -- 0:00:56
164500 -- (-787.805) [-787.450] (-793.381) (-786.062) * (-789.137) (-788.550) [-787.979] (-785.579) -- 0:00:55
165000 -- (-795.434) (-785.917) (-791.488) [-786.414] * (-787.236) (-790.231) (-787.128) [-786.071] -- 0:00:55
Average standard deviation of split frequencies: 0.017891
165500 -- (-788.825) (-789.520) (-788.114) [-789.133] * (-786.485) [-785.855] (-792.950) (-787.783) -- 0:00:55
166000 -- (-786.082) [-787.317] (-785.948) (-786.594) * (-785.679) (-789.285) [-789.307] (-785.859) -- 0:00:55
166500 -- (-789.536) [-787.938] (-787.364) (-786.943) * (-788.612) (-785.343) [-786.388] (-785.972) -- 0:00:55
167000 -- (-788.078) (-789.083) (-785.695) [-785.623] * (-786.645) (-786.494) (-786.356) [-786.956] -- 0:00:54
167500 -- [-788.196] (-786.042) (-796.405) (-786.299) * (-786.855) (-786.033) [-786.013] (-786.133) -- 0:00:54
168000 -- (-786.318) (-788.221) [-790.130] (-788.047) * (-787.776) (-788.215) (-789.034) [-787.662] -- 0:00:54
168500 -- [-788.204] (-787.974) (-787.874) (-786.676) * (-790.449) [-785.771] (-786.687) (-788.595) -- 0:00:54
169000 -- [-791.278] (-787.886) (-787.613) (-788.468) * (-787.291) [-787.477] (-786.365) (-785.342) -- 0:00:54
169500 -- [-792.336] (-787.830) (-787.766) (-785.836) * (-788.385) [-787.065] (-786.356) (-786.229) -- 0:00:53
170000 -- [-787.161] (-786.410) (-788.055) (-785.643) * (-789.746) (-787.729) [-790.983] (-787.163) -- 0:00:53
Average standard deviation of split frequencies: 0.017494
170500 -- (-788.005) (-787.076) [-787.034] (-787.368) * (-788.269) [-786.375] (-789.027) (-787.795) -- 0:00:53
171000 -- (-787.207) (-790.452) (-788.835) [-787.036] * (-788.153) (-787.169) [-786.983] (-788.296) -- 0:00:53
171500 -- (-786.713) (-789.350) (-786.447) [-787.897] * (-789.972) [-787.015] (-785.733) (-791.839) -- 0:00:53
172000 -- (-787.616) [-788.517] (-787.234) (-790.245) * (-786.269) (-786.058) (-785.836) [-791.838] -- 0:00:52
172500 -- (-789.099) [-788.195] (-786.778) (-786.604) * [-788.523] (-789.092) (-789.094) (-787.808) -- 0:00:52
173000 -- (-787.444) (-788.445) [-786.955] (-788.842) * (-786.495) (-788.056) (-790.096) [-786.254] -- 0:00:52
173500 -- (-787.164) (-785.689) [-787.564] (-786.945) * [-785.411] (-789.336) (-787.248) (-786.747) -- 0:00:52
174000 -- (-789.646) (-785.907) (-787.594) [-786.447] * (-788.743) [-791.816] (-786.733) (-794.014) -- 0:00:52
174500 -- (-787.609) (-786.937) [-791.832] (-786.733) * (-787.981) (-787.912) [-786.168] (-793.662) -- 0:00:52
175000 -- (-786.191) (-786.940) (-789.174) [-787.284] * (-787.698) (-786.249) (-794.369) [-788.531] -- 0:00:51
Average standard deviation of split frequencies: 0.016666
175500 -- [-786.543] (-785.784) (-785.626) (-787.332) * (-789.623) [-786.172] (-787.042) (-786.930) -- 0:00:51
176000 -- (-791.336) (-786.359) (-790.147) [-786.275] * (-786.092) (-790.058) (-786.162) [-786.627] -- 0:00:51
176500 -- (-790.771) (-789.451) (-788.779) [-786.745] * (-788.498) (-795.311) (-787.064) [-785.834] -- 0:00:51
177000 -- (-791.129) (-791.447) [-786.124] (-787.913) * (-792.540) (-791.558) (-785.560) [-790.897] -- 0:00:51
177500 -- [-788.147] (-794.030) (-787.779) (-789.770) * [-788.351] (-788.219) (-787.268) (-786.877) -- 0:00:50
178000 -- (-785.715) (-791.654) (-786.489) [-788.331] * (-788.378) [-787.427] (-787.686) (-786.244) -- 0:00:50
178500 -- (-789.560) (-790.256) (-785.527) [-785.949] * (-792.188) [-786.667] (-786.801) (-786.901) -- 0:00:50
179000 -- (-788.992) (-788.123) (-785.631) [-785.698] * (-786.219) [-789.015] (-790.232) (-785.450) -- 0:00:55
179500 -- (-786.764) [-787.723] (-785.601) (-786.331) * (-786.129) [-785.376] (-788.568) (-785.455) -- 0:00:54
180000 -- (-786.941) (-790.344) [-785.962] (-788.304) * (-785.818) [-786.176] (-787.617) (-788.058) -- 0:00:54
Average standard deviation of split frequencies: 0.014641
180500 -- (-788.578) (-786.350) (-786.229) [-787.616] * (-788.626) (-785.656) (-789.016) [-786.395] -- 0:00:54
181000 -- (-785.782) (-788.194) [-786.215] (-787.922) * (-787.103) [-786.097] (-789.915) (-787.783) -- 0:00:54
181500 -- (-785.782) [-789.020] (-788.713) (-790.457) * (-790.371) [-786.201] (-786.432) (-787.569) -- 0:00:54
182000 -- (-789.922) (-793.198) (-790.922) [-790.040] * (-785.712) (-786.780) [-787.068] (-792.754) -- 0:00:53
182500 -- (-789.197) [-786.331] (-787.005) (-788.233) * (-786.851) (-787.788) [-786.399] (-787.245) -- 0:00:53
183000 -- [-786.861] (-786.050) (-790.491) (-785.440) * (-789.524) (-785.497) [-786.782] (-790.764) -- 0:00:53
183500 -- (-787.156) (-785.910) (-786.078) [-787.451] * (-786.922) (-785.323) [-786.240] (-789.837) -- 0:00:53
184000 -- [-788.976] (-786.967) (-788.731) (-789.679) * [-786.472] (-786.292) (-786.663) (-788.620) -- 0:00:53
184500 -- (-788.593) (-785.459) (-786.691) [-785.763] * (-788.226) (-786.478) (-786.536) [-787.238] -- 0:00:53
185000 -- (-787.842) (-786.936) [-786.831] (-785.745) * (-790.754) (-786.124) (-788.923) [-787.500] -- 0:00:52
Average standard deviation of split frequencies: 0.014610
185500 -- (-787.470) (-788.657) (-786.163) [-785.686] * (-790.360) (-785.335) [-787.056] (-787.574) -- 0:00:52
186000 -- [-787.978] (-788.310) (-790.098) (-786.470) * (-798.900) (-786.480) [-787.975] (-785.957) -- 0:00:52
186500 -- [-786.979] (-786.481) (-786.264) (-790.079) * [-790.726] (-785.793) (-787.857) (-787.176) -- 0:00:52
187000 -- (-786.712) [-786.761] (-785.669) (-786.265) * (-789.208) [-786.836] (-789.779) (-786.933) -- 0:00:52
187500 -- [-789.012] (-786.040) (-785.874) (-788.739) * [-788.234] (-788.954) (-788.753) (-785.685) -- 0:00:52
188000 -- (-787.295) (-789.898) [-792.281] (-787.285) * [-786.749] (-787.577) (-786.434) (-786.763) -- 0:00:51
188500 -- [-787.678] (-787.801) (-788.127) (-789.199) * [-786.442] (-788.716) (-785.884) (-787.057) -- 0:00:51
189000 -- [-787.769] (-785.720) (-787.310) (-786.856) * (-786.827) (-786.780) (-787.805) [-788.393] -- 0:00:51
189500 -- (-790.793) (-787.028) (-786.235) [-786.061] * (-787.450) (-787.942) [-785.947] (-787.588) -- 0:00:51
190000 -- [-788.856] (-788.496) (-788.420) (-786.386) * [-786.390] (-794.047) (-788.028) (-788.522) -- 0:00:51
Average standard deviation of split frequencies: 0.015796
190500 -- [-787.706] (-787.828) (-786.374) (-785.434) * (-788.821) (-786.585) [-789.285] (-789.290) -- 0:00:50
191000 -- [-791.143] (-789.113) (-790.499) (-785.216) * (-786.241) (-786.989) [-787.614] (-787.092) -- 0:00:50
191500 -- [-787.249] (-786.515) (-790.090) (-786.860) * (-786.817) [-789.848] (-785.660) (-787.108) -- 0:00:50
192000 -- (-787.692) (-786.891) [-788.227] (-790.982) * [-786.008] (-788.670) (-790.387) (-789.506) -- 0:00:50
192500 -- (-791.189) (-788.906) (-787.649) [-786.772] * [-790.475] (-790.776) (-791.236) (-788.605) -- 0:00:50
193000 -- (-786.983) (-789.194) (-786.504) [-786.170] * (-787.800) (-790.186) [-787.887] (-789.566) -- 0:00:50
193500 -- (-789.155) (-785.340) [-787.197] (-788.545) * (-791.231) (-789.544) (-786.148) [-787.257] -- 0:00:50
194000 -- [-786.545] (-787.945) (-786.735) (-789.080) * (-787.973) (-787.218) (-786.028) [-786.866] -- 0:00:49
194500 -- (-789.128) (-787.440) [-787.535] (-788.253) * (-786.590) (-785.934) [-786.881] (-786.790) -- 0:00:49
195000 -- [-787.662] (-788.491) (-789.914) (-786.387) * (-786.231) (-786.493) [-788.986] (-787.410) -- 0:00:49
Average standard deviation of split frequencies: 0.014572
195500 -- (-787.881) [-787.081] (-787.076) (-787.400) * (-787.396) [-786.959] (-785.758) (-788.067) -- 0:00:53
196000 -- (-787.072) [-788.801] (-790.136) (-790.592) * [-786.200] (-787.096) (-786.130) (-794.820) -- 0:00:53
196500 -- [-787.824] (-788.794) (-788.952) (-789.273) * (-785.566) (-787.662) (-788.970) [-786.199] -- 0:00:53
197000 -- (-788.712) (-786.669) (-787.884) [-787.490] * (-786.036) [-786.707] (-786.844) (-786.016) -- 0:00:52
197500 -- (-786.669) (-788.427) [-786.703] (-786.641) * (-786.001) [-786.269] (-786.106) (-787.440) -- 0:00:52
198000 -- (-788.094) (-787.985) [-788.175] (-790.141) * (-787.366) (-786.435) [-786.885] (-788.231) -- 0:00:52
198500 -- (-786.683) [-789.538] (-788.227) (-786.040) * (-787.823) (-787.066) (-786.142) [-786.460] -- 0:00:52
199000 -- [-788.548] (-790.842) (-789.195) (-785.878) * (-788.460) (-789.388) (-789.067) [-787.687] -- 0:00:52
199500 -- (-790.236) (-788.467) (-786.474) [-787.427] * (-787.794) (-792.607) (-789.607) [-788.585] -- 0:00:52
200000 -- (-788.112) (-787.610) [-786.878] (-789.863) * (-785.485) [-786.424] (-791.397) (-787.771) -- 0:00:51
Average standard deviation of split frequencies: 0.015201
200500 -- (-791.755) (-785.408) (-787.052) [-788.288] * (-785.456) [-791.506] (-794.164) (-788.312) -- 0:00:51
201000 -- (-788.769) (-785.648) (-788.232) [-785.158] * (-786.883) [-788.912] (-787.245) (-787.683) -- 0:00:51
201500 -- (-787.859) (-786.660) (-794.401) [-788.195] * (-787.099) [-787.110] (-786.358) (-787.968) -- 0:00:51
202000 -- [-787.462] (-787.713) (-789.049) (-789.745) * (-786.802) (-787.521) [-786.862] (-786.760) -- 0:00:51
202500 -- (-787.095) [-788.557] (-786.995) (-787.928) * (-787.560) (-787.226) [-787.144] (-786.518) -- 0:00:51
203000 -- (-787.308) [-785.817] (-786.865) (-789.603) * [-787.755] (-787.431) (-785.803) (-786.936) -- 0:00:51
203500 -- (-787.265) (-785.574) (-787.846) [-788.704] * [-787.844] (-794.345) (-785.509) (-786.095) -- 0:00:50
204000 -- [-786.634] (-788.711) (-790.070) (-786.089) * (-788.144) (-787.390) (-785.447) [-786.117] -- 0:00:50
204500 -- (-790.631) (-787.430) (-792.078) [-786.437] * (-789.009) [-787.843] (-785.331) (-788.257) -- 0:00:50
205000 -- [-787.224] (-786.027) (-786.040) (-787.134) * (-787.983) (-788.816) (-785.291) [-786.979] -- 0:00:50
Average standard deviation of split frequencies: 0.015510
205500 -- (-790.214) [-786.538] (-789.053) (-786.952) * (-788.983) [-786.952] (-785.751) (-786.873) -- 0:00:50
206000 -- (-785.623) (-789.926) (-786.158) [-785.534] * [-786.477] (-787.469) (-788.632) (-789.049) -- 0:00:50
206500 -- (-786.523) (-790.265) (-787.128) [-785.315] * (-788.713) [-786.553] (-789.290) (-789.884) -- 0:00:49
207000 -- (-786.313) (-787.263) [-787.799] (-787.416) * (-787.743) (-786.162) [-786.226] (-788.446) -- 0:00:49
207500 -- (-790.099) [-787.146] (-785.598) (-786.604) * (-786.969) (-786.543) [-786.935] (-790.609) -- 0:00:49
208000 -- (-800.246) [-787.408] (-787.554) (-786.160) * (-788.005) (-788.245) (-786.712) [-786.815] -- 0:00:49
208500 -- (-788.713) (-788.181) (-785.342) [-785.478] * (-787.974) (-787.382) [-785.273] (-788.344) -- 0:00:49
209000 -- (-787.454) (-789.800) (-787.415) [-785.820] * (-787.283) (-787.058) (-787.706) [-787.540] -- 0:00:49
209500 -- (-788.835) [-788.187] (-786.704) (-786.231) * (-787.076) (-787.964) [-787.776] (-786.714) -- 0:00:49
210000 -- (-787.882) [-788.361] (-786.626) (-785.925) * [-789.025] (-786.835) (-786.008) (-786.304) -- 0:00:48
Average standard deviation of split frequencies: 0.014545
210500 -- (-787.310) (-786.768) (-787.990) [-790.030] * (-785.747) (-786.249) (-786.400) [-785.698] -- 0:00:48
211000 -- (-786.703) [-786.636] (-786.914) (-785.334) * (-786.732) (-787.434) [-789.129] (-786.458) -- 0:00:48
211500 -- (-785.686) (-787.558) (-787.001) [-787.316] * (-786.505) (-788.256) (-787.719) [-787.584] -- 0:00:52
212000 -- (-786.999) [-787.635] (-790.400) (-786.755) * (-790.087) (-787.094) (-787.076) [-789.060] -- 0:00:52
212500 -- (-787.504) [-787.698] (-790.451) (-787.016) * (-787.401) (-788.499) [-786.561] (-792.016) -- 0:00:51
213000 -- (-787.088) [-787.104] (-788.780) (-786.815) * (-788.478) (-790.671) (-788.632) [-787.587] -- 0:00:51
213500 -- (-786.399) (-785.941) [-785.930] (-786.779) * (-786.854) (-788.183) (-787.423) [-789.142] -- 0:00:51
214000 -- (-788.108) (-785.653) [-785.690] (-785.723) * (-787.037) [-789.138] (-786.800) (-789.015) -- 0:00:51
214500 -- (-788.871) [-787.208] (-788.541) (-785.978) * (-786.572) (-788.517) [-785.304] (-787.668) -- 0:00:51
215000 -- (-787.850) [-785.909] (-789.664) (-787.474) * (-787.176) (-786.245) [-788.078] (-787.179) -- 0:00:51
Average standard deviation of split frequencies: 0.015162
215500 -- (-786.034) (-785.438) (-787.098) [-786.496] * (-787.140) (-785.915) (-789.359) [-787.095] -- 0:00:50
216000 -- (-786.114) (-786.842) [-787.083] (-788.363) * (-788.995) (-787.418) [-786.370] (-788.030) -- 0:00:50
216500 -- (-792.515) [-786.504] (-786.598) (-791.941) * (-787.214) [-786.201] (-786.022) (-790.229) -- 0:00:50
217000 -- (-786.542) (-786.943) (-789.831) [-790.702] * (-786.977) (-786.149) (-787.674) [-787.738] -- 0:00:50
217500 -- (-786.356) (-785.964) (-790.924) [-785.969] * (-786.211) (-787.679) (-786.969) [-785.468] -- 0:00:50
218000 -- [-790.393] (-788.433) (-789.405) (-786.534) * (-795.156) (-788.485) [-788.765] (-786.710) -- 0:00:50
218500 -- (-791.369) (-785.521) [-787.338] (-787.299) * (-789.225) (-789.127) [-787.484] (-786.311) -- 0:00:50
219000 -- (-790.338) (-785.456) (-787.878) [-789.844] * [-790.265] (-789.552) (-788.131) (-787.392) -- 0:00:49
219500 -- (-786.926) (-786.014) (-788.966) [-787.166] * (-789.314) [-788.678] (-790.521) (-787.633) -- 0:00:49
220000 -- (-788.590) (-786.168) [-786.464] (-786.824) * (-790.327) [-790.197] (-791.325) (-788.349) -- 0:00:49
Average standard deviation of split frequencies: 0.014703
220500 -- [-787.957] (-785.393) (-790.959) (-789.078) * (-788.976) (-791.872) (-786.820) [-786.854] -- 0:00:49
221000 -- (-791.885) (-786.061) [-794.001] (-787.778) * (-786.126) (-790.964) [-786.609] (-788.145) -- 0:00:49
221500 -- (-787.026) (-786.660) (-787.092) [-787.037] * [-786.323] (-786.055) (-789.094) (-790.319) -- 0:00:49
222000 -- (-787.443) (-789.861) (-786.761) [-787.264] * (-788.695) (-785.870) (-789.871) [-788.119] -- 0:00:49
222500 -- [-788.327] (-786.165) (-788.605) (-787.691) * (-787.554) (-789.237) [-791.770] (-788.595) -- 0:00:48
223000 -- [-789.319] (-785.914) (-789.316) (-788.891) * (-790.642) (-786.559) (-790.840) [-787.002] -- 0:00:48
223500 -- [-786.695] (-786.995) (-789.721) (-792.975) * (-787.826) [-787.685] (-791.709) (-786.520) -- 0:00:48
224000 -- [-786.963] (-786.542) (-788.709) (-788.689) * [-787.547] (-788.207) (-790.169) (-791.899) -- 0:00:48
224500 -- [-786.127] (-787.089) (-790.131) (-786.807) * (-795.002) [-786.457] (-793.342) (-789.632) -- 0:00:48
225000 -- (-786.540) [-787.025] (-787.257) (-788.457) * (-791.936) [-787.554] (-788.995) (-787.125) -- 0:00:48
Average standard deviation of split frequencies: 0.014052
225500 -- (-787.841) [-788.005] (-786.150) (-787.059) * (-787.359) (-786.761) [-788.247] (-787.106) -- 0:00:48
226000 -- [-787.274] (-786.807) (-786.439) (-786.668) * (-787.380) [-785.549] (-790.515) (-787.102) -- 0:00:47
226500 -- [-787.532] (-786.664) (-786.602) (-789.462) * (-787.327) (-786.430) [-789.348] (-788.836) -- 0:00:47
227000 -- (-788.311) (-785.175) [-785.605] (-790.791) * [-786.294] (-786.166) (-785.570) (-788.914) -- 0:00:47
227500 -- (-791.790) (-786.972) (-788.440) [-789.380] * [-786.126] (-787.227) (-785.930) (-786.849) -- 0:00:50
228000 -- (-787.407) [-786.818] (-788.177) (-788.735) * [-786.789] (-785.871) (-786.937) (-789.790) -- 0:00:50
228500 -- (-788.638) (-789.361) [-785.630] (-786.930) * [-786.823] (-786.653) (-786.830) (-789.551) -- 0:00:50
229000 -- (-789.449) [-788.148] (-788.802) (-786.879) * (-785.799) [-785.733] (-787.340) (-786.758) -- 0:00:50
229500 -- (-788.836) (-787.318) (-786.479) [-785.890] * [-791.177] (-785.614) (-787.138) (-786.902) -- 0:00:50
230000 -- (-787.429) [-791.252] (-786.733) (-787.994) * (-785.674) (-786.651) (-787.493) [-789.064] -- 0:00:50
Average standard deviation of split frequencies: 0.015059
230500 -- [-790.672] (-786.920) (-786.880) (-787.137) * (-790.434) [-786.060] (-786.500) (-788.423) -- 0:00:50
231000 -- (-786.282) (-787.594) [-786.174] (-786.179) * (-786.029) (-785.834) (-791.040) [-788.806] -- 0:00:49
231500 -- (-785.865) (-786.796) (-787.380) [-790.360] * (-786.540) [-787.482] (-786.455) (-786.145) -- 0:00:49
232000 -- (-791.307) (-787.493) [-788.059] (-788.978) * [-787.182] (-786.112) (-788.302) (-785.869) -- 0:00:49
232500 -- (-788.086) (-786.944) [-789.632] (-787.156) * (-787.175) [-786.151] (-786.830) (-787.204) -- 0:00:49
233000 -- (-786.686) [-786.712] (-788.536) (-789.180) * [-786.819] (-786.021) (-786.577) (-787.936) -- 0:00:49
233500 -- (-786.803) (-790.205) (-787.927) [-787.214] * (-788.418) (-786.385) (-786.673) [-785.891] -- 0:00:49
234000 -- (-785.937) [-785.211] (-787.023) (-787.169) * (-789.445) [-789.631] (-788.203) (-785.413) -- 0:00:49
234500 -- (-785.643) [-785.397] (-796.236) (-788.206) * (-790.235) (-790.482) (-788.060) [-786.811] -- 0:00:48
235000 -- (-786.084) (-785.970) [-785.776] (-787.943) * (-788.651) [-786.767] (-786.290) (-788.331) -- 0:00:48
Average standard deviation of split frequencies: 0.015454
235500 -- [-786.064] (-787.628) (-786.446) (-790.227) * [-786.520] (-789.045) (-786.186) (-786.381) -- 0:00:48
236000 -- (-789.245) (-789.356) (-786.394) [-790.608] * (-786.960) (-789.923) [-785.630] (-787.369) -- 0:00:48
236500 -- (-791.015) (-787.412) [-785.693] (-795.400) * (-787.929) [-786.513] (-786.627) (-786.807) -- 0:00:48
237000 -- (-788.896) [-786.798] (-785.699) (-795.263) * (-786.956) [-789.164] (-789.027) (-786.018) -- 0:00:48
237500 -- (-786.307) (-788.571) [-786.488] (-789.993) * (-788.549) (-786.559) (-789.984) [-786.452] -- 0:00:48
238000 -- [-786.232] (-786.685) (-789.646) (-787.603) * (-787.760) [-787.021] (-787.281) (-785.416) -- 0:00:48
238500 -- (-786.710) (-787.782) (-787.079) [-786.878] * (-788.821) (-786.452) [-788.397] (-786.663) -- 0:00:47
239000 -- (-788.356) [-786.520] (-792.075) (-789.270) * [-789.482] (-788.201) (-786.442) (-787.368) -- 0:00:47
239500 -- (-786.664) (-787.173) (-788.185) [-785.112] * [-788.988] (-786.406) (-786.173) (-791.586) -- 0:00:47
240000 -- (-785.302) [-786.744] (-786.402) (-785.114) * [-787.018] (-786.802) (-786.030) (-789.817) -- 0:00:47
Average standard deviation of split frequencies: 0.014845
240500 -- (-787.305) (-787.643) (-791.608) [-785.483] * (-788.451) [-787.137] (-785.345) (-786.484) -- 0:00:47
241000 -- [-789.386] (-786.069) (-791.382) (-785.719) * [-786.343] (-790.249) (-787.036) (-786.952) -- 0:00:47
241500 -- (-787.200) [-786.330] (-788.175) (-785.467) * (-787.395) (-786.539) [-786.602] (-786.440) -- 0:00:47
242000 -- (-788.170) (-792.017) (-788.491) [-785.849] * (-786.640) [-786.828] (-786.703) (-789.574) -- 0:00:46
242500 -- (-788.371) (-790.944) (-787.024) [-785.857] * [-789.825] (-785.754) (-787.571) (-787.889) -- 0:00:46
243000 -- [-786.686] (-786.749) (-788.320) (-786.231) * (-792.217) [-785.717] (-788.486) (-785.121) -- 0:00:46
243500 -- (-788.838) (-786.157) [-786.929] (-787.830) * (-786.728) (-786.046) [-787.846] (-785.203) -- 0:00:46
244000 -- [-787.802] (-785.532) (-785.788) (-786.612) * (-786.706) [-786.151] (-786.258) (-787.573) -- 0:00:49
244500 -- (-788.211) (-786.231) (-792.563) [-790.028] * [-785.572] (-787.985) (-786.802) (-786.134) -- 0:00:49
245000 -- [-785.969] (-787.022) (-789.128) (-787.418) * (-786.141) [-785.887] (-789.817) (-785.839) -- 0:00:49
Average standard deviation of split frequencies: 0.015129
245500 -- (-787.035) (-787.056) [-786.058] (-785.960) * (-785.413) (-786.581) (-796.387) [-790.699] -- 0:00:49
246000 -- (-787.009) [-787.321] (-786.183) (-787.623) * (-787.946) [-785.239] (-786.652) (-787.651) -- 0:00:49
246500 -- [-786.711] (-793.042) (-786.610) (-790.529) * (-788.380) (-785.239) [-786.893] (-787.278) -- 0:00:48
247000 -- (-791.691) (-787.113) (-786.915) [-787.628] * (-788.382) (-786.715) (-786.162) [-788.439] -- 0:00:48
247500 -- (-787.282) [-788.116] (-786.099) (-789.702) * (-790.128) [-785.880] (-792.137) (-787.268) -- 0:00:48
248000 -- (-788.589) (-786.747) [-786.366] (-786.734) * (-787.439) [-787.908] (-787.257) (-786.731) -- 0:00:48
248500 -- (-786.176) (-790.771) [-789.023] (-787.864) * [-790.317] (-789.605) (-787.783) (-787.580) -- 0:00:48
249000 -- (-787.155) (-785.795) [-786.730] (-788.767) * (-787.727) (-786.937) (-787.373) [-787.461] -- 0:00:48
249500 -- (-787.180) [-785.481] (-787.815) (-788.180) * (-786.991) (-787.303) [-785.802] (-787.368) -- 0:00:48
250000 -- (-787.723) [-786.222] (-787.617) (-786.211) * [-788.850] (-789.867) (-786.919) (-790.901) -- 0:00:48
Average standard deviation of split frequencies: 0.014522
250500 -- (-785.771) (-786.944) [-786.668] (-788.486) * (-787.995) [-788.711] (-787.324) (-786.571) -- 0:00:47
251000 -- [-787.444] (-786.585) (-786.740) (-785.750) * (-788.999) [-788.519] (-787.687) (-789.502) -- 0:00:47
251500 -- (-787.453) (-785.434) [-788.898] (-785.589) * (-786.699) (-786.679) (-788.803) [-785.155] -- 0:00:47
252000 -- (-787.430) (-785.734) (-786.228) [-788.604] * [-787.540] (-787.174) (-788.951) (-786.453) -- 0:00:47
252500 -- (-787.809) (-785.547) (-788.330) [-788.675] * (-786.709) (-786.410) [-790.356] (-787.515) -- 0:00:47
253000 -- (-787.543) (-785.591) (-789.419) [-789.561] * (-789.075) (-786.334) [-785.959] (-786.327) -- 0:00:47
253500 -- (-789.571) [-786.798] (-787.602) (-789.036) * (-792.529) (-786.666) [-786.361] (-785.989) -- 0:00:47
254000 -- (-792.828) [-786.185] (-787.129) (-791.746) * (-786.593) (-788.850) [-796.372] (-785.691) -- 0:00:46
254500 -- (-789.196) (-787.609) [-786.754] (-792.830) * (-787.390) (-787.735) (-791.618) [-786.517] -- 0:00:46
255000 -- (-787.016) [-785.641] (-787.819) (-788.487) * (-793.040) (-788.014) (-787.277) [-788.601] -- 0:00:46
Average standard deviation of split frequencies: 0.015604
255500 -- (-788.035) (-785.389) (-787.189) [-787.130] * (-790.525) (-786.859) [-788.445] (-787.030) -- 0:00:46
256000 -- (-787.620) (-786.272) (-790.867) [-786.730] * (-788.360) (-786.038) [-786.968] (-791.101) -- 0:00:46
256500 -- (-786.413) [-786.493] (-789.242) (-790.291) * (-785.368) (-785.873) [-788.971] (-791.476) -- 0:00:46
257000 -- (-787.263) (-786.680) [-788.099] (-788.841) * (-785.968) (-789.758) (-787.600) [-788.720] -- 0:00:46
257500 -- (-794.804) (-785.966) (-786.891) [-788.360] * (-794.702) (-788.551) [-787.106] (-788.435) -- 0:00:46
258000 -- (-787.932) (-785.525) (-785.532) [-787.413] * [-791.471] (-789.538) (-787.536) (-786.954) -- 0:00:46
258500 -- (-788.188) [-786.589] (-787.647) (-788.245) * [-787.028] (-786.812) (-793.132) (-786.619) -- 0:00:45
259000 -- [-792.176] (-788.755) (-787.410) (-787.708) * (-785.487) [-790.763] (-788.370) (-791.497) -- 0:00:45
259500 -- (-792.057) (-788.198) (-789.275) [-789.187] * (-786.081) [-785.742] (-789.407) (-788.165) -- 0:00:45
260000 -- (-788.194) [-788.295] (-786.087) (-786.261) * (-785.868) (-788.514) [-789.620] (-787.242) -- 0:00:45
Average standard deviation of split frequencies: 0.015774
260500 -- (-787.141) (-788.070) (-785.637) [-788.248] * (-787.595) (-787.214) [-786.483] (-785.180) -- 0:00:48
261000 -- (-789.660) (-786.938) [-785.584] (-785.248) * (-788.565) (-786.311) (-785.318) [-785.079] -- 0:00:48
261500 -- [-790.062] (-787.561) (-788.341) (-786.589) * (-788.657) [-787.327] (-786.060) (-785.423) -- 0:00:48
262000 -- (-793.148) [-786.926] (-786.510) (-790.534) * (-788.126) (-785.541) (-786.107) [-785.843] -- 0:00:47
262500 -- (-789.428) [-785.512] (-790.587) (-794.187) * (-787.774) [-786.828] (-785.708) (-785.564) -- 0:00:47
263000 -- (-787.540) (-785.764) (-787.240) [-787.325] * (-787.155) (-786.628) [-788.566] (-787.907) -- 0:00:47
263500 -- (-792.328) (-785.680) [-786.588] (-786.322) * (-786.379) (-785.661) [-787.665] (-786.679) -- 0:00:47
264000 -- [-788.080] (-788.139) (-785.761) (-786.515) * [-786.996] (-788.879) (-787.045) (-788.002) -- 0:00:47
264500 -- (-788.053) (-786.968) (-785.630) [-789.206] * (-786.141) (-788.568) (-786.105) [-787.504] -- 0:00:47
265000 -- (-789.361) (-785.687) (-786.013) [-786.897] * (-785.903) (-786.743) [-789.343] (-787.284) -- 0:00:47
Average standard deviation of split frequencies: 0.016203
265500 -- (-791.116) (-785.444) (-788.502) [-785.250] * [-789.306] (-788.335) (-788.869) (-787.969) -- 0:00:47
266000 -- (-790.840) [-788.677] (-787.865) (-786.936) * (-788.902) (-789.934) [-785.771] (-788.224) -- 0:00:46
266500 -- (-788.597) (-791.840) (-786.605) [-787.266] * (-789.451) (-788.949) [-788.625] (-787.865) -- 0:00:46
267000 -- [-788.442] (-785.713) (-786.088) (-786.264) * (-787.222) (-788.374) (-786.256) [-795.441] -- 0:00:46
267500 -- [-788.371] (-786.384) (-785.643) (-786.547) * (-788.796) [-787.752] (-786.464) (-788.021) -- 0:00:46
268000 -- (-787.608) (-790.597) (-786.356) [-785.729] * [-790.239] (-791.802) (-790.856) (-786.677) -- 0:00:46
268500 -- [-788.205] (-787.198) (-788.054) (-785.625) * (-788.439) (-789.580) (-786.978) [-786.753] -- 0:00:46
269000 -- (-787.997) (-786.957) (-787.037) [-787.543] * (-786.945) [-788.910] (-789.012) (-790.766) -- 0:00:46
269500 -- [-787.906] (-788.342) (-787.246) (-789.057) * (-789.321) (-789.686) (-786.530) [-788.611] -- 0:00:46
270000 -- (-788.028) (-788.992) (-788.992) [-787.117] * (-790.512) (-791.190) (-789.738) [-786.533] -- 0:00:45
Average standard deviation of split frequencies: 0.016284
270500 -- (-786.557) (-786.871) (-788.446) [-785.140] * (-787.780) (-788.618) (-786.761) [-786.341] -- 0:00:45
271000 -- (-794.272) (-789.480) (-790.086) [-789.150] * [-785.613] (-786.999) (-786.089) (-787.542) -- 0:00:45
271500 -- (-786.685) (-786.096) (-789.506) [-787.098] * (-789.436) (-787.195) [-787.103] (-787.952) -- 0:00:45
272000 -- (-785.229) (-788.839) (-788.498) [-785.992] * (-791.195) (-791.817) (-789.629) [-788.214] -- 0:00:45
272500 -- (-786.423) (-786.502) (-786.664) [-786.481] * [-787.657] (-787.282) (-788.834) (-788.852) -- 0:00:45
273000 -- (-786.377) (-788.136) (-788.585) [-785.278] * (-787.196) (-787.025) [-786.068] (-792.561) -- 0:00:45
273500 -- [-785.851] (-787.010) (-787.669) (-785.828) * (-787.015) (-787.779) (-785.737) [-786.604] -- 0:00:45
274000 -- (-786.327) (-786.385) (-794.361) [-785.808] * (-789.840) [-785.339] (-786.738) (-786.534) -- 0:00:45
274500 -- (-786.433) [-786.334] (-792.315) (-788.615) * (-786.277) [-786.246] (-787.933) (-791.551) -- 0:00:44
275000 -- (-786.253) [-787.832] (-789.303) (-788.063) * (-786.584) (-786.931) (-789.374) [-786.500] -- 0:00:44
Average standard deviation of split frequencies: 0.015911
275500 -- (-785.859) (-788.633) (-785.980) [-787.313] * (-790.390) (-791.382) [-786.072] (-791.021) -- 0:00:44
276000 -- (-785.675) (-786.896) [-786.063] (-790.062) * (-788.035) (-785.725) (-786.366) [-786.638] -- 0:00:44
276500 -- [-787.202] (-785.324) (-794.232) (-790.122) * (-786.609) [-785.508] (-786.659) (-790.699) -- 0:00:47
277000 -- [-787.254] (-787.166) (-788.132) (-789.504) * [-786.792] (-787.165) (-786.513) (-787.675) -- 0:00:46
277500 -- (-785.784) (-788.145) [-787.613] (-786.040) * [-786.772] (-791.470) (-787.973) (-790.572) -- 0:00:46
278000 -- (-785.784) (-787.092) [-789.155] (-790.381) * (-786.942) (-792.528) [-791.746] (-786.282) -- 0:00:46
278500 -- (-787.903) (-785.860) [-791.016] (-790.035) * (-786.898) (-787.154) [-785.178] (-787.875) -- 0:00:46
279000 -- (-788.156) (-787.243) [-785.815] (-791.677) * (-785.973) (-787.826) [-788.765] (-786.468) -- 0:00:46
279500 -- [-788.069] (-790.161) (-785.663) (-786.735) * [-786.806] (-790.228) (-787.535) (-785.709) -- 0:00:46
280000 -- (-787.010) (-790.526) (-785.192) [-786.599] * (-786.252) (-786.457) (-790.290) [-787.729] -- 0:00:46
Average standard deviation of split frequencies: 0.016177
280500 -- (-787.824) [-785.756] (-785.585) (-787.267) * (-787.549) (-785.471) [-786.333] (-786.842) -- 0:00:46
281000 -- (-788.395) [-786.038] (-789.202) (-786.389) * (-788.026) (-787.124) [-786.383] (-786.955) -- 0:00:46
281500 -- [-786.857] (-785.663) (-786.508) (-786.495) * (-785.836) (-787.768) (-789.750) [-787.499] -- 0:00:45
282000 -- (-786.117) (-788.767) [-787.657] (-787.013) * (-787.486) [-788.791] (-787.582) (-788.780) -- 0:00:45
282500 -- (-787.261) [-788.156] (-787.190) (-788.484) * (-786.987) [-787.052] (-785.768) (-787.284) -- 0:00:45
283000 -- (-788.687) [-789.836] (-788.556) (-787.535) * [-788.016] (-792.517) (-788.971) (-788.629) -- 0:00:45
283500 -- (-786.498) [-789.089] (-786.319) (-788.486) * (-786.173) (-788.158) [-787.124] (-796.312) -- 0:00:45
284000 -- (-786.986) (-787.711) (-787.674) [-792.096] * (-788.152) (-789.820) [-789.477] (-787.411) -- 0:00:45
284500 -- [-788.072] (-785.762) (-789.493) (-791.245) * (-788.252) [-788.557] (-787.031) (-785.994) -- 0:00:45
285000 -- (-790.146) (-787.879) [-788.962] (-789.135) * [-789.276] (-787.207) (-788.308) (-785.593) -- 0:00:45
Average standard deviation of split frequencies: 0.015494
285500 -- (-788.717) (-787.523) [-787.620] (-788.995) * [-788.765] (-787.159) (-787.194) (-788.596) -- 0:00:45
286000 -- (-788.031) (-786.547) (-785.913) [-785.656] * (-787.068) [-790.186] (-787.459) (-786.849) -- 0:00:44
286500 -- (-786.679) (-787.908) [-789.989] (-786.798) * [-786.393] (-788.622) (-793.141) (-787.261) -- 0:00:44
287000 -- [-786.191] (-787.628) (-787.689) (-787.718) * [-787.479] (-791.462) (-785.302) (-786.938) -- 0:00:44
287500 -- (-786.615) (-788.820) (-787.069) [-786.420] * (-786.848) (-787.766) [-786.099] (-789.907) -- 0:00:44
288000 -- (-786.468) [-786.273] (-789.596) (-787.500) * [-789.186] (-790.139) (-790.007) (-789.899) -- 0:00:44
288500 -- [-785.265] (-790.204) (-786.755) (-788.067) * (-786.438) (-789.950) (-789.185) [-790.062] -- 0:00:44
289000 -- [-788.747] (-787.525) (-788.506) (-787.368) * (-789.278) (-785.665) (-787.349) [-787.955] -- 0:00:44
289500 -- (-789.586) (-787.719) (-787.872) [-786.956] * (-785.839) (-787.452) [-787.263] (-788.432) -- 0:00:44
290000 -- (-792.667) (-789.391) (-786.475) [-789.027] * (-787.684) (-788.134) [-786.468] (-787.386) -- 0:00:44
Average standard deviation of split frequencies: 0.015194
290500 -- (-786.576) [-787.027] (-787.702) (-787.267) * [-785.544] (-796.285) (-790.914) (-787.647) -- 0:00:43
291000 -- (-786.009) (-787.305) (-786.758) [-786.349] * [-785.320] (-789.694) (-786.762) (-789.272) -- 0:00:43
291500 -- (-788.042) [-786.003] (-786.141) (-785.568) * (-785.509) (-786.763) (-791.332) [-788.917] -- 0:00:43
292000 -- (-789.503) (-786.509) (-786.222) [-788.078] * (-791.902) (-785.385) [-787.279] (-787.900) -- 0:00:43
292500 -- (-785.817) [-786.000] (-789.780) (-788.564) * (-786.567) (-787.720) (-787.252) [-786.388] -- 0:00:43
293000 -- (-785.950) (-785.844) (-790.556) [-788.658] * (-787.037) (-786.568) [-788.612] (-786.792) -- 0:00:43
293500 -- (-786.920) (-785.863) (-790.090) [-789.717] * (-786.186) [-785.782] (-791.731) (-786.266) -- 0:00:45
294000 -- [-789.687] (-786.555) (-786.589) (-786.475) * [-788.690] (-788.546) (-787.072) (-786.020) -- 0:00:45
294500 -- (-788.196) (-787.725) [-785.705] (-787.333) * (-786.750) [-785.690] (-786.793) (-786.826) -- 0:00:45
295000 -- (-788.580) (-786.723) [-785.342] (-786.155) * (-789.444) (-785.523) (-789.198) [-790.619] -- 0:00:45
Average standard deviation of split frequencies: 0.015171
295500 -- (-789.378) (-787.220) (-787.238) [-787.349] * [-787.476] (-788.464) (-788.757) (-787.642) -- 0:00:45
296000 -- (-788.943) [-789.656] (-788.235) (-786.124) * (-788.960) (-788.455) (-788.836) [-787.586] -- 0:00:45
296500 -- (-794.435) (-787.971) [-787.279] (-786.160) * (-791.981) (-785.676) [-788.014] (-788.956) -- 0:00:45
297000 -- (-787.802) [-787.866] (-787.764) (-787.588) * [-788.697] (-785.878) (-786.412) (-786.732) -- 0:00:44
297500 -- (-787.246) (-785.576) [-787.736] (-787.919) * (-790.667) [-787.014] (-785.705) (-788.066) -- 0:00:44
298000 -- (-787.447) [-786.123] (-787.012) (-785.971) * (-790.911) (-789.464) (-787.793) [-786.802] -- 0:00:44
298500 -- (-786.880) (-786.276) (-788.621) [-785.674] * [-788.913] (-786.353) (-792.133) (-787.898) -- 0:00:44
299000 -- (-797.452) [-788.891] (-788.446) (-787.584) * (-785.842) [-786.832] (-786.990) (-792.968) -- 0:00:44
299500 -- (-788.019) [-787.503] (-787.900) (-786.937) * [-785.885] (-786.849) (-787.424) (-788.014) -- 0:00:44
300000 -- (-787.382) (-788.194) (-786.892) [-785.401] * (-786.081) (-789.181) (-787.715) [-786.754] -- 0:00:44
Average standard deviation of split frequencies: 0.016724
300500 -- (-785.918) (-787.231) [-786.285] (-787.106) * (-789.001) (-790.478) (-789.753) [-786.263] -- 0:00:44
301000 -- [-786.452] (-786.428) (-786.433) (-786.904) * [-786.248] (-787.429) (-787.884) (-785.884) -- 0:00:44
301500 -- (-786.734) (-786.934) [-788.152] (-788.504) * (-787.571) (-786.955) [-790.255] (-788.919) -- 0:00:44
302000 -- (-787.773) (-787.447) (-787.551) [-791.654] * (-785.498) [-788.503] (-787.781) (-787.545) -- 0:00:43
302500 -- (-787.299) [-788.569] (-788.089) (-789.706) * (-788.939) (-785.630) [-785.677] (-792.005) -- 0:00:43
303000 -- (-787.568) (-787.398) [-788.390] (-788.350) * (-797.278) [-788.285] (-786.234) (-787.829) -- 0:00:43
303500 -- (-789.840) [-788.612] (-791.861) (-786.005) * [-786.393] (-787.071) (-786.113) (-785.796) -- 0:00:43
304000 -- (-790.535) (-787.064) (-787.861) [-785.879] * (-788.808) (-789.449) (-788.526) [-787.817] -- 0:00:43
304500 -- (-791.909) (-789.349) [-785.561] (-786.353) * (-788.568) [-787.570] (-790.275) (-787.066) -- 0:00:43
305000 -- (-787.171) (-789.909) [-786.228] (-787.701) * (-792.271) (-786.876) [-787.785] (-789.634) -- 0:00:43
Average standard deviation of split frequencies: 0.016004
305500 -- (-787.189) (-787.627) [-786.891] (-786.468) * (-792.117) [-786.969] (-787.896) (-786.742) -- 0:00:43
306000 -- (-790.473) [-787.724] (-788.156) (-788.211) * (-789.925) (-787.274) (-792.481) [-785.980] -- 0:00:43
306500 -- (-787.639) [-787.336] (-787.334) (-790.363) * [-788.784] (-786.028) (-786.941) (-786.395) -- 0:00:42
307000 -- (-787.008) (-788.417) (-786.320) [-787.193] * (-788.525) (-787.508) (-788.674) [-788.577] -- 0:00:42
307500 -- (-788.027) [-786.182] (-786.970) (-786.189) * [-787.229] (-785.323) (-789.613) (-791.556) -- 0:00:42
308000 -- [-790.721] (-786.781) (-787.330) (-786.019) * [-787.409] (-788.753) (-786.605) (-787.466) -- 0:00:42
308500 -- (-789.828) (-787.278) (-786.934) [-785.967] * (-788.606) [-789.358] (-790.558) (-788.289) -- 0:00:42
309000 -- [-787.294] (-786.477) (-787.267) (-786.406) * [-786.475] (-786.018) (-787.607) (-789.318) -- 0:00:42
309500 -- (-789.240) [-786.336] (-786.939) (-786.533) * (-786.540) (-788.167) [-786.991] (-789.087) -- 0:00:44
310000 -- (-789.785) [-786.906] (-787.888) (-786.631) * (-787.215) (-787.250) [-788.022] (-788.996) -- 0:00:44
Average standard deviation of split frequencies: 0.016186
310500 -- [-789.448] (-786.315) (-786.894) (-785.381) * (-793.403) (-786.813) [-788.048] (-789.128) -- 0:00:44
311000 -- (-788.359) (-785.695) [-787.558] (-785.624) * (-788.872) (-785.884) (-787.967) [-789.225] -- 0:00:44
311500 -- (-787.997) (-786.708) (-788.731) [-788.885] * (-787.886) (-789.515) [-786.254] (-786.471) -- 0:00:44
312000 -- (-793.124) (-786.122) [-787.781] (-790.021) * [-787.785] (-786.546) (-786.900) (-786.104) -- 0:00:44
312500 -- (-788.112) (-787.112) [-788.267] (-787.651) * [-787.068] (-791.635) (-787.826) (-786.810) -- 0:00:44
313000 -- (-789.088) [-788.957] (-789.054) (-788.582) * (-788.135) [-791.535] (-786.849) (-787.724) -- 0:00:43
313500 -- (-789.267) (-786.894) [-788.012] (-791.605) * (-791.011) (-788.513) [-785.406] (-789.940) -- 0:00:43
314000 -- [-787.064] (-786.165) (-788.730) (-786.642) * [-792.189] (-786.164) (-786.648) (-786.469) -- 0:00:43
314500 -- (-787.160) (-786.522) (-787.582) [-787.223] * (-789.259) (-785.728) [-789.023] (-785.769) -- 0:00:43
315000 -- (-788.050) (-787.497) [-787.771] (-790.205) * (-788.656) (-786.326) [-790.785] (-786.364) -- 0:00:43
Average standard deviation of split frequencies: 0.016990
315500 -- [-786.819] (-788.417) (-785.976) (-786.256) * [-787.429] (-787.068) (-790.229) (-785.404) -- 0:00:43
316000 -- [-790.081] (-790.294) (-786.475) (-785.591) * (-786.383) (-786.798) [-788.425] (-788.379) -- 0:00:43
316500 -- (-787.306) (-785.902) [-786.561] (-785.958) * (-786.156) (-786.639) (-786.334) [-786.431] -- 0:00:43
317000 -- (-786.950) (-786.909) (-787.484) [-785.753] * [-789.464] (-786.380) (-787.270) (-786.212) -- 0:00:43
317500 -- (-787.172) (-791.098) (-786.753) [-787.003] * (-792.228) (-788.480) [-786.125] (-791.972) -- 0:00:42
318000 -- [-788.219] (-788.066) (-785.686) (-789.318) * [-785.558] (-789.229) (-786.256) (-788.114) -- 0:00:42
318500 -- (-786.772) (-787.249) (-786.015) [-787.248] * [-787.629] (-785.407) (-789.081) (-787.800) -- 0:00:42
319000 -- (-788.365) (-787.551) [-787.059] (-787.929) * (-787.745) (-786.688) (-787.690) [-788.462] -- 0:00:42
319500 -- (-786.218) [-788.647] (-787.075) (-786.911) * [-788.228] (-786.410) (-788.332) (-790.316) -- 0:00:42
320000 -- [-786.509] (-788.050) (-788.736) (-787.273) * (-788.680) (-786.579) (-788.717) [-788.322] -- 0:00:42
Average standard deviation of split frequencies: 0.018049
320500 -- (-785.582) [-789.625] (-792.452) (-788.296) * (-788.180) (-787.274) [-785.371] (-787.181) -- 0:00:42
321000 -- [-786.151] (-785.976) (-788.553) (-789.289) * (-785.150) [-786.760] (-785.675) (-790.954) -- 0:00:42
321500 -- (-785.417) (-786.315) [-787.168] (-788.386) * (-785.227) [-786.495] (-785.402) (-787.735) -- 0:00:42
322000 -- [-785.418] (-786.084) (-785.913) (-790.520) * (-786.304) [-788.312] (-787.694) (-791.638) -- 0:00:42
322500 -- (-787.136) (-785.757) (-786.381) [-787.940] * (-787.803) [-787.538] (-790.223) (-785.550) -- 0:00:42
323000 -- [-787.882] (-787.259) (-786.822) (-788.388) * (-790.625) (-788.653) (-788.099) [-785.732] -- 0:00:41
323500 -- [-787.048] (-786.590) (-786.712) (-788.393) * (-788.263) (-787.342) [-786.692] (-787.013) -- 0:00:41
324000 -- (-787.337) (-790.779) (-787.226) [-792.033] * (-788.797) (-790.030) (-788.426) [-790.360] -- 0:00:41
324500 -- (-786.945) (-789.530) [-788.759] (-789.305) * (-785.232) (-788.930) (-789.349) [-789.194] -- 0:00:41
325000 -- (-786.513) [-787.754] (-785.873) (-787.829) * [-787.974] (-786.401) (-786.240) (-788.871) -- 0:00:41
Average standard deviation of split frequencies: 0.017915
325500 -- (-788.620) (-787.398) (-787.677) [-786.942] * (-785.935) (-790.013) (-791.422) [-786.639] -- 0:00:41
326000 -- (-788.210) (-786.572) (-788.082) [-786.776] * (-788.038) (-793.529) [-786.949] (-790.634) -- 0:00:43
326500 -- [-787.741] (-787.123) (-788.012) (-786.220) * [-788.621] (-788.984) (-788.246) (-789.522) -- 0:00:43
327000 -- (-791.526) [-788.665] (-788.676) (-787.010) * [-786.505] (-791.934) (-788.588) (-788.377) -- 0:00:43
327500 -- (-790.727) [-787.779] (-791.442) (-787.690) * (-787.942) (-790.618) [-788.348] (-787.877) -- 0:00:43
328000 -- (-789.634) (-787.763) (-786.467) [-792.301] * [-786.004] (-787.898) (-788.730) (-790.770) -- 0:00:43
328500 -- (-786.605) (-790.135) [-787.584] (-786.492) * (-790.456) (-787.918) (-789.047) [-786.366] -- 0:00:42
329000 -- (-787.150) [-788.420] (-786.718) (-788.916) * (-786.273) (-787.185) (-788.178) [-786.397] -- 0:00:42
329500 -- (-787.986) (-789.495) [-786.909] (-789.007) * (-787.212) [-786.383] (-790.547) (-788.504) -- 0:00:42
330000 -- (-786.425) (-790.578) (-785.780) [-787.897] * (-785.318) (-787.183) (-788.811) [-788.352] -- 0:00:42
Average standard deviation of split frequencies: 0.016957
330500 -- (-787.428) (-787.939) [-786.048] (-789.432) * (-786.635) [-787.247] (-785.453) (-787.983) -- 0:00:42
331000 -- [-787.467] (-786.239) (-786.733) (-786.053) * (-786.576) (-786.023) [-787.765] (-787.541) -- 0:00:42
331500 -- (-791.878) [-785.602] (-785.929) (-785.914) * (-788.264) (-785.831) [-786.235] (-790.384) -- 0:00:42
332000 -- [-786.110] (-785.709) (-788.765) (-788.205) * (-788.247) [-787.435] (-788.576) (-788.418) -- 0:00:42
332500 -- (-785.554) (-786.606) (-786.321) [-787.938] * [-786.038] (-787.811) (-788.300) (-788.607) -- 0:00:42
333000 -- [-785.648] (-787.019) (-790.394) (-789.450) * (-786.022) (-790.359) (-792.222) [-786.979] -- 0:00:42
333500 -- (-786.758) (-786.721) [-786.255] (-787.869) * (-786.398) (-786.635) (-786.773) [-787.116] -- 0:00:41
334000 -- (-788.616) (-787.521) [-786.245] (-786.936) * [-785.626] (-787.694) (-788.437) (-789.731) -- 0:00:41
334500 -- (-786.417) (-785.658) (-791.189) [-788.498] * [-785.306] (-793.330) (-786.694) (-787.614) -- 0:00:41
335000 -- (-788.123) (-785.609) [-786.625] (-788.518) * [-786.439] (-789.573) (-786.423) (-785.466) -- 0:00:41
Average standard deviation of split frequencies: 0.017331
335500 -- (-787.805) [-785.453] (-786.970) (-789.917) * (-787.289) (-786.734) [-786.220] (-785.319) -- 0:00:41
336000 -- (-787.321) (-787.223) (-788.246) [-785.255] * (-791.124) (-785.797) [-786.949] (-789.428) -- 0:00:41
336500 -- (-786.197) (-786.397) (-785.519) [-785.285] * (-793.093) (-789.626) [-787.244] (-792.152) -- 0:00:41
337000 -- (-785.819) [-786.804] (-787.190) (-787.543) * (-788.576) [-788.260] (-788.846) (-786.591) -- 0:00:41
337500 -- (-786.906) (-786.179) (-789.752) [-791.061] * (-792.116) [-789.282] (-787.731) (-787.790) -- 0:00:41
338000 -- [-786.838] (-789.866) (-789.081) (-787.814) * (-791.593) (-789.624) [-791.743] (-791.166) -- 0:00:41
338500 -- [-785.846] (-788.751) (-789.411) (-789.931) * [-786.149] (-790.190) (-787.672) (-789.517) -- 0:00:41
339000 -- (-789.244) (-787.590) [-785.865] (-786.705) * (-791.307) (-790.533) [-787.188] (-788.758) -- 0:00:40
339500 -- (-793.329) (-785.246) [-785.991] (-786.820) * (-787.534) [-790.090] (-788.307) (-789.150) -- 0:00:40
340000 -- (-786.895) (-787.003) [-788.386] (-787.897) * (-786.193) (-797.639) (-786.717) [-789.770] -- 0:00:40
Average standard deviation of split frequencies: 0.017042
340500 -- (-786.550) (-786.147) [-786.889] (-788.415) * (-788.892) (-789.061) [-791.345] (-789.802) -- 0:00:40
341000 -- [-786.445] (-786.403) (-787.846) (-787.749) * (-786.360) [-785.835] (-789.266) (-791.194) -- 0:00:40
341500 -- (-787.502) (-786.030) [-786.703] (-787.408) * (-788.345) (-786.367) [-785.832] (-790.116) -- 0:00:40
342000 -- (-787.267) (-788.109) (-788.570) [-788.985] * (-787.987) [-786.014] (-786.854) (-786.452) -- 0:00:40
342500 -- (-785.890) [-785.992] (-791.218) (-788.596) * (-787.569) [-788.268] (-789.349) (-788.750) -- 0:00:42
343000 -- [-786.437] (-785.776) (-791.897) (-786.962) * [-787.362] (-787.392) (-790.605) (-786.626) -- 0:00:42
343500 -- [-785.844] (-786.177) (-786.936) (-787.456) * [-786.816] (-786.949) (-789.198) (-786.029) -- 0:00:42
344000 -- [-786.800] (-787.605) (-786.266) (-786.587) * (-785.659) (-786.646) [-786.394] (-787.083) -- 0:00:41
344500 -- (-787.093) [-789.123] (-785.911) (-785.977) * (-786.118) (-785.955) [-787.686] (-785.531) -- 0:00:41
345000 -- (-786.242) [-786.987] (-786.920) (-786.012) * [-787.495] (-785.363) (-788.229) (-786.573) -- 0:00:41
Average standard deviation of split frequencies: 0.017066
345500 -- (-785.663) (-789.056) [-786.177] (-785.966) * (-788.230) [-785.363] (-787.511) (-787.069) -- 0:00:41
346000 -- [-786.805] (-789.753) (-786.385) (-785.644) * (-787.864) (-786.397) (-790.199) [-787.698] -- 0:00:41
346500 -- (-785.482) [-789.496] (-786.295) (-788.702) * (-786.960) (-787.117) [-786.800] (-787.136) -- 0:00:41
347000 -- [-786.189] (-789.680) (-788.019) (-786.531) * (-788.573) (-790.301) (-789.826) [-786.518] -- 0:00:41
347500 -- (-786.671) (-791.949) [-785.822] (-788.663) * (-786.635) (-788.662) [-786.502] (-785.670) -- 0:00:41
348000 -- (-788.802) (-787.059) [-785.840] (-788.158) * [-788.644] (-787.104) (-785.822) (-786.972) -- 0:00:41
348500 -- (-788.498) (-790.849) [-787.111] (-786.633) * (-786.157) (-786.856) (-787.331) [-785.343] -- 0:00:41
349000 -- [-786.652] (-788.584) (-788.075) (-787.826) * (-786.188) (-786.498) (-785.857) [-786.459] -- 0:00:41
349500 -- (-788.155) (-792.552) [-786.285] (-786.840) * (-788.395) (-788.886) [-786.034] (-788.934) -- 0:00:40
350000 -- (-788.965) (-787.856) (-786.839) [-786.413] * (-792.443) (-789.400) (-786.719) [-790.757] -- 0:00:40
Average standard deviation of split frequencies: 0.016804
350500 -- (-789.682) [-789.150] (-786.325) (-788.962) * (-793.625) (-787.167) [-787.870] (-786.642) -- 0:00:40
351000 -- (-791.090) (-787.234) [-788.205] (-789.057) * [-789.813] (-786.016) (-788.542) (-786.236) -- 0:00:40
351500 -- (-791.660) [-789.801] (-787.494) (-792.089) * (-786.935) (-785.998) [-788.358] (-788.017) -- 0:00:40
352000 -- (-789.264) [-786.093] (-786.951) (-787.793) * (-786.150) (-786.696) [-788.659] (-789.746) -- 0:00:40
352500 -- (-785.675) (-787.438) (-790.882) [-785.884] * [-786.541] (-792.149) (-787.357) (-785.648) -- 0:00:40
353000 -- (-787.321) (-788.715) [-785.677] (-785.605) * (-787.506) (-793.492) [-787.122] (-786.071) -- 0:00:40
353500 -- (-791.609) (-788.459) (-787.141) [-785.612] * (-786.656) [-789.867] (-787.962) (-790.306) -- 0:00:40
354000 -- [-791.677] (-790.647) (-786.533) (-788.339) * (-787.509) (-789.611) [-788.701] (-787.854) -- 0:00:40
354500 -- [-788.228] (-786.845) (-785.963) (-787.369) * (-787.289) (-787.044) [-787.543] (-787.870) -- 0:00:40
355000 -- (-788.032) (-786.518) (-786.290) [-787.812] * (-786.929) (-788.593) (-786.572) [-786.755] -- 0:00:39
Average standard deviation of split frequencies: 0.017354
355500 -- (-789.724) [-786.428] (-786.470) (-786.965) * [-785.740] (-787.304) (-786.084) (-793.824) -- 0:00:39
356000 -- (-788.968) (-785.885) (-785.689) [-787.094] * (-787.270) (-787.490) (-787.847) [-789.006] -- 0:00:39
356500 -- (-787.070) (-786.724) (-789.522) [-788.327] * (-788.684) (-785.949) [-785.671] (-786.318) -- 0:00:39
357000 -- (-786.884) (-786.152) [-786.439] (-788.552) * (-786.565) [-786.667] (-785.668) (-789.863) -- 0:00:39
357500 -- (-787.050) (-788.228) (-789.717) [-787.596] * [-786.775] (-787.910) (-788.582) (-789.072) -- 0:00:39
358000 -- (-785.864) [-789.929] (-792.453) (-791.063) * (-786.896) [-788.794] (-790.006) (-787.584) -- 0:00:39
358500 -- (-785.803) (-792.188) [-787.798] (-785.392) * (-787.619) (-790.131) [-786.544] (-788.272) -- 0:00:39
359000 -- (-785.937) (-790.203) [-788.090] (-786.844) * (-785.893) [-788.541] (-786.920) (-788.280) -- 0:00:39
359500 -- (-792.725) [-787.312] (-788.127) (-787.879) * (-789.621) (-786.070) [-787.180] (-787.880) -- 0:00:40
360000 -- (-788.469) (-785.386) (-791.390) [-786.334] * [-787.538] (-791.775) (-786.689) (-786.886) -- 0:00:40
Average standard deviation of split frequencies: 0.017473
360500 -- (-790.354) (-787.769) (-789.632) [-787.216] * (-790.003) [-789.115] (-788.614) (-787.766) -- 0:00:40
361000 -- (-788.093) [-789.320] (-789.676) (-789.006) * (-789.648) (-788.937) [-789.360] (-790.278) -- 0:00:40
361500 -- (-788.315) (-787.342) [-787.319] (-789.152) * [-788.760] (-786.139) (-789.001) (-789.991) -- 0:00:40
362000 -- [-786.836] (-791.019) (-788.331) (-785.829) * (-789.971) [-788.527] (-787.288) (-786.867) -- 0:00:40
362500 -- (-792.297) (-792.652) [-785.434] (-787.012) * (-787.503) (-787.016) (-785.987) [-791.465] -- 0:00:40
363000 -- [-787.909] (-796.703) (-787.353) (-787.224) * (-787.891) [-785.964] (-790.041) (-788.605) -- 0:00:40
363500 -- (-790.841) (-791.402) [-788.908] (-788.075) * (-787.041) (-787.371) (-787.424) [-787.463] -- 0:00:40
364000 -- (-785.797) [-787.876] (-787.490) (-787.788) * [-786.748] (-792.837) (-786.457) (-787.228) -- 0:00:40
364500 -- [-788.882] (-789.239) (-789.269) (-786.277) * (-788.050) [-793.500] (-787.793) (-789.701) -- 0:00:40
365000 -- (-787.502) (-789.364) (-788.866) [-786.276] * (-786.657) (-788.554) [-786.452] (-794.642) -- 0:00:40
Average standard deviation of split frequencies: 0.016202
365500 -- [-786.003] (-788.665) (-791.388) (-787.595) * [-787.868] (-789.304) (-787.355) (-785.406) -- 0:00:39
366000 -- (-786.097) [-788.630] (-785.622) (-793.289) * (-791.659) (-789.288) (-785.211) [-785.764] -- 0:00:39
366500 -- (-785.749) (-790.283) (-785.942) [-787.345] * (-787.921) (-791.077) (-788.093) [-788.680] -- 0:00:39
367000 -- (-787.215) [-786.196] (-786.654) (-790.712) * [-786.767] (-785.733) (-788.294) (-788.737) -- 0:00:39
367500 -- [-787.889] (-791.668) (-787.749) (-790.603) * (-785.865) (-787.654) (-785.878) [-786.543] -- 0:00:39
368000 -- (-786.629) (-791.106) [-786.612] (-787.259) * (-786.520) [-787.526] (-787.053) (-785.482) -- 0:00:39
368500 -- (-789.304) [-789.514] (-785.456) (-786.764) * (-786.967) (-786.447) (-786.573) [-792.594] -- 0:00:39
369000 -- (-787.150) [-788.255] (-786.281) (-788.084) * (-788.239) (-790.106) (-788.123) [-785.570] -- 0:00:39
369500 -- [-786.894] (-788.255) (-786.903) (-787.759) * (-787.904) (-794.613) (-787.926) [-790.622] -- 0:00:39
370000 -- (-787.093) [-789.516] (-786.696) (-787.970) * (-786.985) (-790.309) (-788.913) [-787.726] -- 0:00:39
Average standard deviation of split frequencies: 0.016250
370500 -- [-789.097] (-789.300) (-788.280) (-787.069) * (-788.137) [-786.693] (-787.827) (-788.690) -- 0:00:39
371000 -- (-786.046) [-788.308] (-786.893) (-788.333) * [-787.922] (-788.780) (-792.079) (-787.409) -- 0:00:38
371500 -- [-786.890] (-786.481) (-787.034) (-789.887) * (-788.651) [-787.877] (-793.314) (-787.597) -- 0:00:38
372000 -- (-787.183) (-788.298) (-787.609) [-787.133] * (-791.292) [-786.694] (-788.839) (-790.476) -- 0:00:38
372500 -- (-786.346) [-786.536] (-787.249) (-788.133) * (-788.483) (-787.821) [-788.087] (-788.862) -- 0:00:38
373000 -- (-786.263) (-786.932) [-787.511] (-788.519) * (-788.552) [-786.958] (-786.244) (-786.085) -- 0:00:38
373500 -- (-786.300) [-785.429] (-791.974) (-786.705) * [-790.123] (-786.895) (-786.345) (-786.707) -- 0:00:38
374000 -- (-788.308) (-789.158) [-788.244] (-786.326) * (-790.486) [-787.718] (-792.878) (-787.691) -- 0:00:38
374500 -- (-788.836) [-789.346] (-786.674) (-791.728) * (-790.553) (-786.775) (-794.291) [-786.597] -- 0:00:38
375000 -- (-788.868) (-795.313) [-786.578] (-788.538) * (-790.359) (-793.510) (-787.865) [-786.152] -- 0:00:38
Average standard deviation of split frequencies: 0.015309
375500 -- [-788.346] (-785.960) (-786.489) (-786.803) * [-786.711] (-788.215) (-792.233) (-788.195) -- 0:00:38
376000 -- (-792.549) (-787.585) (-787.115) [-787.191] * (-786.493) (-790.532) [-790.741] (-791.105) -- 0:00:39
376500 -- (-786.939) [-786.549] (-787.808) (-786.979) * (-788.985) (-790.314) (-789.277) [-789.716] -- 0:00:39
377000 -- (-787.493) (-787.922) (-786.556) [-788.639] * (-790.162) (-788.374) [-788.408] (-787.141) -- 0:00:39
377500 -- (-786.105) (-786.486) (-791.621) [-785.650] * (-787.789) [-787.661] (-786.753) (-788.032) -- 0:00:39
378000 -- (-787.574) [-786.470] (-790.698) (-786.790) * (-789.894) (-787.554) (-790.313) [-790.626] -- 0:00:39
378500 -- (-790.775) (-786.620) (-786.851) [-786.369] * [-787.361] (-790.393) (-787.675) (-789.717) -- 0:00:39
379000 -- (-791.749) [-786.636] (-788.096) (-788.123) * [-786.924] (-787.438) (-788.510) (-786.239) -- 0:00:39
379500 -- (-789.653) (-788.925) (-787.959) [-787.540] * (-791.821) [-785.502] (-789.431) (-785.634) -- 0:00:39
380000 -- (-786.266) (-789.422) [-786.133] (-789.780) * (-789.553) [-785.998] (-786.667) (-786.842) -- 0:00:39
Average standard deviation of split frequencies: 0.014795
380500 -- (-788.473) (-789.103) [-787.055] (-788.404) * (-788.026) [-789.473] (-790.695) (-788.148) -- 0:00:39
381000 -- [-787.104] (-786.528) (-788.904) (-787.957) * (-789.654) [-787.113] (-785.471) (-787.749) -- 0:00:38
381500 -- [-787.697] (-786.575) (-789.451) (-786.197) * (-789.876) [-785.858] (-794.848) (-787.926) -- 0:00:38
382000 -- [-788.447] (-790.064) (-788.622) (-785.575) * (-791.452) [-788.745] (-787.208) (-787.055) -- 0:00:38
382500 -- (-787.370) [-788.825] (-787.473) (-785.324) * (-786.960) [-787.553] (-787.300) (-790.436) -- 0:00:38
383000 -- [-786.223] (-786.515) (-788.209) (-787.567) * [-790.856] (-787.065) (-786.771) (-786.497) -- 0:00:38
383500 -- (-787.491) [-786.955] (-787.057) (-788.034) * (-787.924) (-786.886) (-792.252) [-786.422] -- 0:00:38
384000 -- [-786.548] (-787.021) (-786.521) (-787.138) * (-785.966) (-786.763) (-785.606) [-788.551] -- 0:00:38
384500 -- [-788.625] (-787.387) (-786.405) (-787.018) * (-790.548) (-789.086) (-786.171) [-787.187] -- 0:00:38
385000 -- (-788.645) (-788.290) [-786.904] (-787.023) * (-787.377) [-788.919] (-790.387) (-790.511) -- 0:00:38
Average standard deviation of split frequencies: 0.015130
385500 -- [-788.112] (-787.518) (-791.801) (-788.142) * [-788.903] (-788.518) (-789.001) (-787.023) -- 0:00:38
386000 -- (-790.044) (-788.907) (-785.780) [-787.540] * (-786.030) (-787.377) (-792.125) [-791.421] -- 0:00:38
386500 -- (-786.403) (-786.088) (-787.379) [-787.736] * (-790.440) (-786.705) (-786.414) [-787.751] -- 0:00:38
387000 -- [-785.205] (-787.694) (-786.536) (-788.877) * (-786.964) [-787.976] (-786.414) (-788.700) -- 0:00:38
387500 -- [-787.879] (-787.593) (-786.359) (-786.630) * (-787.084) [-788.100] (-785.466) (-790.218) -- 0:00:37
388000 -- (-788.998) (-786.628) [-786.984] (-787.411) * (-785.812) (-792.522) [-786.991] (-789.649) -- 0:00:37
388500 -- (-787.852) (-787.482) (-788.402) [-787.157] * (-786.564) (-786.361) [-786.417] (-786.765) -- 0:00:37
389000 -- [-790.192] (-790.447) (-789.651) (-786.310) * (-786.741) [-785.966] (-787.634) (-787.953) -- 0:00:37
389500 -- (-791.431) (-786.521) [-786.435] (-790.237) * [-789.040] (-791.073) (-787.288) (-788.302) -- 0:00:37
390000 -- [-785.921] (-785.339) (-786.397) (-786.661) * (-790.256) [-786.493] (-787.548) (-786.526) -- 0:00:39
Average standard deviation of split frequencies: 0.014346
390500 -- (-786.273) (-787.901) (-790.937) [-787.645] * [-795.365] (-789.012) (-787.544) (-785.598) -- 0:00:39
391000 -- (-787.598) (-786.245) (-786.825) [-785.807] * (-786.555) [-787.482] (-787.934) (-788.571) -- 0:00:38
391500 -- (-788.719) [-787.369] (-786.118) (-793.920) * (-791.617) (-786.253) (-789.969) [-785.688] -- 0:00:38
392000 -- (-786.128) [-790.197] (-789.559) (-786.430) * (-785.229) (-787.459) [-787.981] (-794.985) -- 0:00:38
392500 -- [-786.538] (-791.019) (-794.350) (-787.768) * (-786.590) (-787.489) (-790.538) [-786.758] -- 0:00:38
393000 -- (-786.519) (-786.970) (-789.302) [-785.989] * [-789.411] (-785.965) (-788.165) (-791.622) -- 0:00:38
393500 -- (-789.750) (-790.844) [-787.049] (-786.518) * [-787.279] (-785.208) (-787.547) (-788.841) -- 0:00:38
394000 -- (-788.311) [-787.738] (-786.684) (-786.888) * (-787.940) [-788.823] (-787.787) (-787.551) -- 0:00:38
394500 -- [-787.747] (-791.326) (-786.899) (-786.774) * (-790.077) (-787.111) (-789.674) [-785.837] -- 0:00:38
395000 -- (-789.445) (-789.141) [-786.107] (-786.894) * [-787.441] (-786.696) (-788.941) (-787.097) -- 0:00:38
Average standard deviation of split frequencies: 0.014483
395500 -- (-786.446) (-788.835) (-786.187) [-786.760] * (-787.310) (-791.535) (-786.950) [-789.405] -- 0:00:38
396000 -- (-789.922) (-791.351) (-785.490) [-787.621] * [-788.355] (-791.316) (-786.705) (-791.905) -- 0:00:38
396500 -- (-791.556) (-787.842) [-787.601] (-788.117) * (-786.195) (-794.562) (-787.078) [-788.318] -- 0:00:38
397000 -- (-794.202) (-788.517) (-791.602) [-786.707] * [-786.906] (-788.532) (-787.698) (-787.804) -- 0:00:37
397500 -- [-790.151] (-785.961) (-788.078) (-790.002) * [-786.363] (-788.999) (-787.865) (-788.528) -- 0:00:37
398000 -- (-787.771) [-788.004] (-788.172) (-788.769) * [-787.060] (-787.331) (-786.210) (-787.436) -- 0:00:37
398500 -- (-786.596) (-786.752) (-786.845) [-788.820] * (-788.338) [-790.192] (-788.233) (-786.448) -- 0:00:37
399000 -- (-790.763) (-787.017) (-791.435) [-787.668] * (-785.566) [-787.258] (-790.076) (-788.401) -- 0:00:37
399500 -- [-786.579] (-789.075) (-790.117) (-786.412) * (-785.771) (-789.256) (-789.596) [-786.823] -- 0:00:37
400000 -- (-786.372) (-786.474) [-789.286] (-786.675) * (-787.079) (-787.517) [-789.252] (-785.572) -- 0:00:37
Average standard deviation of split frequencies: 0.014249
400500 -- [-786.716] (-787.050) (-791.409) (-785.926) * (-789.770) (-785.305) (-787.848) [-787.300] -- 0:00:37
401000 -- [-786.721] (-786.736) (-789.698) (-785.502) * [-788.713] (-785.305) (-785.088) (-787.503) -- 0:00:37
401500 -- (-787.922) [-786.740] (-787.640) (-789.236) * (-789.931) (-789.381) [-787.183] (-789.247) -- 0:00:37
402000 -- [-787.611] (-787.771) (-787.342) (-786.994) * [-795.208] (-786.520) (-787.531) (-789.441) -- 0:00:37
402500 -- (-786.331) (-787.639) [-788.268] (-786.963) * (-794.711) (-786.748) (-788.396) [-786.207] -- 0:00:37
403000 -- [-785.949] (-786.058) (-785.631) (-785.910) * (-786.188) (-786.955) (-787.345) [-789.378] -- 0:00:37
403500 -- [-788.057] (-788.734) (-786.124) (-789.927) * (-789.379) (-786.584) [-791.403] (-789.222) -- 0:00:38
404000 -- (-786.393) (-788.903) [-788.138] (-789.766) * (-788.103) [-786.230] (-789.683) (-787.403) -- 0:00:38
404500 -- (-788.734) (-789.628) (-789.171) [-786.452] * (-790.289) (-786.625) (-787.585) [-786.811] -- 0:00:38
405000 -- (-789.565) (-787.023) (-787.030) [-788.539] * [-786.077] (-787.260) (-787.388) (-786.031) -- 0:00:38
Average standard deviation of split frequencies: 0.014239
405500 -- (-787.993) [-785.730] (-791.347) (-786.126) * [-785.557] (-789.445) (-789.098) (-786.805) -- 0:00:38
406000 -- (-788.650) [-787.273] (-788.176) (-787.462) * (-792.156) (-790.869) (-790.603) [-787.570] -- 0:00:38
406500 -- (-788.229) (-790.255) [-790.149] (-787.485) * [-787.078] (-789.853) (-786.329) (-788.757) -- 0:00:37
407000 -- [-786.112] (-786.445) (-785.763) (-789.552) * (-785.909) [-785.729] (-787.815) (-786.094) -- 0:00:37
407500 -- (-787.810) (-791.157) [-785.160] (-785.820) * (-789.141) [-787.475] (-791.447) (-786.363) -- 0:00:37
408000 -- (-787.551) (-786.699) (-786.272) [-786.417] * (-792.157) (-786.485) [-785.932] (-790.323) -- 0:00:37
408500 -- [-785.675] (-787.060) (-786.797) (-786.129) * [-786.608] (-790.104) (-787.592) (-787.400) -- 0:00:37
409000 -- (-788.269) (-787.083) (-786.385) [-786.180] * (-786.156) (-790.869) [-786.122] (-786.399) -- 0:00:37
409500 -- [-788.260] (-787.735) (-786.069) (-786.187) * (-788.292) (-785.809) [-786.234] (-788.503) -- 0:00:37
410000 -- (-794.075) (-786.865) [-786.046] (-786.488) * [-786.941] (-786.501) (-785.471) (-786.747) -- 0:00:37
Average standard deviation of split frequencies: 0.013775
410500 -- (-791.367) (-791.884) [-786.245] (-786.817) * [-788.018] (-787.089) (-789.419) (-787.267) -- 0:00:37
411000 -- [-787.584] (-791.518) (-785.542) (-787.434) * [-787.907] (-795.382) (-786.607) (-792.396) -- 0:00:37
411500 -- (-788.475) (-786.280) (-786.408) [-785.543] * [-788.241] (-788.045) (-786.655) (-792.672) -- 0:00:37
412000 -- (-787.890) [-787.320] (-786.659) (-787.015) * (-789.242) (-791.069) (-788.049) [-789.980] -- 0:00:37
412500 -- [-785.925] (-790.236) (-788.855) (-786.004) * [-789.282] (-787.679) (-786.720) (-788.490) -- 0:00:37
413000 -- [-787.618] (-786.514) (-789.392) (-785.397) * [-786.682] (-793.619) (-789.161) (-791.105) -- 0:00:36
413500 -- (-789.917) (-785.826) [-787.845] (-790.774) * (-787.264) (-788.974) (-789.450) [-785.689] -- 0:00:36
414000 -- (-786.378) (-785.682) (-787.137) [-788.653] * (-790.234) (-786.090) (-786.782) [-785.819] -- 0:00:36
414500 -- (-789.800) (-787.198) (-786.913) [-785.999] * (-786.681) (-786.819) [-786.256] (-786.617) -- 0:00:36
415000 -- (-787.621) (-785.760) [-787.442] (-790.330) * [-786.985] (-789.688) (-788.357) (-790.619) -- 0:00:36
Average standard deviation of split frequencies: 0.013002
415500 -- (-788.112) (-785.899) [-786.676] (-787.304) * (-787.037) (-791.404) (-787.130) [-787.239] -- 0:00:37
416000 -- [-787.254] (-789.326) (-786.105) (-787.807) * (-789.275) (-787.176) (-787.165) [-787.243] -- 0:00:37
416500 -- [-787.552] (-792.875) (-788.132) (-786.883) * (-786.836) (-785.550) (-795.348) [-787.960] -- 0:00:37
417000 -- (-788.886) (-792.210) [-787.361] (-786.887) * (-785.635) [-788.246] (-789.079) (-787.312) -- 0:00:37
417500 -- (-790.906) (-786.537) (-787.867) [-785.726] * (-785.638) (-787.287) [-791.678] (-787.421) -- 0:00:37
418000 -- (-790.813) (-786.353) [-786.419] (-785.249) * (-786.655) [-786.489] (-789.176) (-789.632) -- 0:00:37
418500 -- (-785.964) (-787.129) (-789.245) [-787.445] * (-785.853) [-786.357] (-787.451) (-787.289) -- 0:00:37
419000 -- (-788.643) [-785.985] (-789.532) (-786.509) * (-786.654) [-785.339] (-787.150) (-788.534) -- 0:00:37
419500 -- (-786.762) (-787.835) [-787.162] (-789.538) * (-787.547) (-787.599) [-786.933] (-789.693) -- 0:00:37
420000 -- (-787.351) [-791.022] (-788.222) (-789.183) * (-788.156) (-787.755) [-785.413] (-786.649) -- 0:00:37
Average standard deviation of split frequencies: 0.012327
420500 -- (-787.991) (-785.971) (-788.326) [-787.891] * [-789.048] (-786.353) (-786.019) (-788.374) -- 0:00:37
421000 -- [-788.053] (-790.220) (-788.321) (-792.529) * (-786.473) (-792.276) (-788.202) [-787.113] -- 0:00:37
421500 -- (-786.999) [-786.118] (-789.720) (-788.220) * [-787.627] (-790.298) (-788.158) (-786.193) -- 0:00:37
422000 -- (-785.716) (-787.654) [-791.921] (-789.594) * (-786.218) (-788.139) (-786.426) [-786.198] -- 0:00:36
422500 -- [-787.992] (-787.613) (-787.110) (-788.344) * (-788.080) (-790.072) (-789.334) [-785.746] -- 0:00:36
423000 -- (-791.301) (-787.359) [-788.145] (-791.438) * (-790.930) (-788.565) [-787.925] (-791.937) -- 0:00:36
423500 -- [-788.456] (-792.682) (-791.349) (-789.040) * (-787.088) [-788.009] (-787.358) (-785.948) -- 0:00:36
424000 -- [-788.813] (-792.158) (-789.041) (-789.839) * [-787.875] (-786.521) (-790.031) (-785.948) -- 0:00:36
424500 -- (-788.464) [-787.983] (-786.216) (-786.246) * [-786.258] (-787.458) (-789.136) (-785.846) -- 0:00:36
425000 -- (-786.146) (-788.126) [-787.069] (-786.535) * (-787.287) (-786.354) [-790.258] (-787.590) -- 0:00:36
Average standard deviation of split frequencies: 0.012697
425500 -- [-785.318] (-790.199) (-785.584) (-786.326) * [-787.956] (-785.803) (-788.267) (-786.908) -- 0:00:36
426000 -- [-787.535] (-786.941) (-786.605) (-785.990) * (-786.705) (-787.515) (-788.998) [-787.057] -- 0:00:36
426500 -- (-790.464) (-787.424) [-787.281] (-787.015) * (-787.474) (-791.229) (-788.310) [-787.047] -- 0:00:36
427000 -- (-788.994) (-786.386) (-789.330) [-788.856] * [-786.618] (-789.278) (-787.827) (-787.917) -- 0:00:37
427500 -- (-789.356) [-787.017] (-790.849) (-789.132) * [-789.704] (-787.075) (-785.713) (-786.375) -- 0:00:37
428000 -- (-786.059) (-789.328) (-791.032) [-787.984] * (-787.268) [-787.154] (-791.133) (-785.504) -- 0:00:37
428500 -- (-785.886) [-789.334] (-786.923) (-788.237) * (-786.371) (-787.535) [-791.618] (-786.491) -- 0:00:37
429000 -- [-787.221] (-786.916) (-785.403) (-787.630) * (-789.642) (-786.752) (-786.586) [-792.009] -- 0:00:37
429500 -- (-789.415) (-786.195) [-785.905] (-787.263) * (-785.453) (-786.179) (-789.493) [-788.696] -- 0:00:37
430000 -- (-791.524) [-790.328] (-788.612) (-788.051) * (-786.299) (-785.625) [-787.578] (-790.256) -- 0:00:37
Average standard deviation of split frequencies: 0.012098
430500 -- (-789.739) (-789.353) (-786.018) [-787.708] * (-788.531) [-785.752] (-790.766) (-788.468) -- 0:00:37
431000 -- (-789.237) [-787.812] (-785.798) (-786.867) * [-787.427] (-785.715) (-789.233) (-790.923) -- 0:00:36
431500 -- (-788.134) [-786.815] (-788.556) (-785.942) * [-787.716] (-786.737) (-790.061) (-786.964) -- 0:00:36
432000 -- (-788.768) [-788.193] (-786.030) (-789.083) * (-789.125) (-786.142) [-789.373] (-786.667) -- 0:00:36
432500 -- (-786.700) (-788.569) (-785.911) [-791.109] * [-785.834] (-786.329) (-787.770) (-786.901) -- 0:00:36
433000 -- [-786.238] (-791.160) (-787.091) (-786.784) * (-787.968) (-789.146) (-786.443) [-789.795] -- 0:00:36
433500 -- (-785.645) (-789.571) [-787.623] (-785.803) * [-786.745] (-791.031) (-785.936) (-790.761) -- 0:00:36
434000 -- (-787.096) [-786.350] (-788.568) (-790.504) * (-787.116) [-786.424] (-786.636) (-786.726) -- 0:00:36
434500 -- (-787.750) [-787.780] (-789.369) (-789.512) * (-786.543) [-786.631] (-787.496) (-788.288) -- 0:00:36
435000 -- (-786.570) (-787.710) [-788.571] (-788.576) * [-785.952] (-786.384) (-791.955) (-785.750) -- 0:00:36
Average standard deviation of split frequencies: 0.011953
435500 -- (-786.101) (-789.743) (-788.838) [-790.376] * (-786.673) (-786.783) [-787.405] (-785.297) -- 0:00:36
436000 -- (-786.140) (-788.185) (-785.358) [-787.554] * (-786.075) (-786.147) [-790.680] (-790.151) -- 0:00:36
436500 -- (-788.782) [-785.049] (-785.955) (-787.685) * (-787.423) (-787.173) (-787.070) [-786.533] -- 0:00:36
437000 -- (-785.717) (-789.065) [-785.524] (-789.593) * [-790.142] (-786.875) (-787.522) (-786.431) -- 0:00:36
437500 -- [-787.530] (-787.592) (-788.102) (-788.354) * (-789.537) [-786.844] (-789.428) (-788.758) -- 0:00:36
438000 -- (-786.769) (-789.582) (-786.839) [-787.852] * (-787.040) (-785.497) [-787.748] (-788.995) -- 0:00:35
438500 -- (-786.371) (-788.576) [-786.109] (-789.033) * (-786.033) (-786.816) (-793.597) [-787.560] -- 0:00:35
439000 -- [-786.382] (-788.970) (-786.911) (-787.138) * (-788.363) (-785.501) (-790.461) [-787.007] -- 0:00:35
439500 -- (-786.958) [-790.094] (-789.868) (-789.548) * (-786.916) (-786.399) (-792.106) [-787.215] -- 0:00:35
440000 -- (-786.750) (-788.731) (-786.246) [-787.700] * (-787.002) (-789.490) (-787.976) [-786.509] -- 0:00:35
Average standard deviation of split frequencies: 0.012540
440500 -- (-789.811) (-785.742) (-785.958) [-785.906] * [-785.869] (-790.115) (-788.964) (-789.935) -- 0:00:35
441000 -- (-790.563) [-785.878] (-793.502) (-788.881) * (-785.897) [-788.913] (-788.152) (-788.845) -- 0:00:35
441500 -- (-788.032) [-785.897] (-786.355) (-787.688) * (-786.040) (-787.152) [-788.072] (-787.378) -- 0:00:35
442000 -- (-786.835) [-791.471] (-787.236) (-788.175) * (-786.689) [-787.223] (-786.349) (-786.792) -- 0:00:35
442500 -- [-787.163] (-787.344) (-785.508) (-786.638) * (-787.687) (-788.026) [-788.096] (-786.552) -- 0:00:35
443000 -- (-786.093) (-787.354) [-786.020] (-788.662) * (-786.280) [-789.691] (-792.088) (-787.572) -- 0:00:35
443500 -- [-785.900] (-785.463) (-786.085) (-790.292) * [-788.220] (-787.421) (-791.687) (-788.272) -- 0:00:36
444000 -- (-785.425) (-788.351) [-786.472] (-787.150) * [-786.563] (-786.143) (-793.316) (-788.899) -- 0:00:36
444500 -- (-785.859) [-787.399] (-789.099) (-788.044) * (-788.124) (-786.772) [-785.636] (-792.362) -- 0:00:36
445000 -- (-785.718) [-786.208] (-789.507) (-785.489) * (-788.559) (-790.345) [-785.793] (-787.099) -- 0:00:36
Average standard deviation of split frequencies: 0.012373
445500 -- [-786.045] (-785.670) (-788.826) (-790.121) * (-786.445) [-787.443] (-787.772) (-790.150) -- 0:00:36
446000 -- (-786.033) (-786.801) (-786.309) [-787.379] * (-788.570) (-787.719) [-786.586] (-786.143) -- 0:00:36
446500 -- [-786.218] (-786.359) (-786.496) (-790.678) * (-792.362) [-788.373] (-790.900) (-787.563) -- 0:00:35
447000 -- (-786.088) [-785.964] (-789.827) (-790.110) * (-789.770) (-787.789) [-786.047] (-785.900) -- 0:00:35
447500 -- [-785.579] (-786.436) (-789.306) (-789.833) * (-789.654) [-786.956] (-786.427) (-788.061) -- 0:00:35
448000 -- [-788.130] (-790.826) (-786.398) (-786.336) * (-785.359) (-788.407) [-792.324] (-787.548) -- 0:00:35
448500 -- (-787.274) (-788.983) [-785.755] (-790.609) * (-787.097) (-790.023) (-789.016) [-787.336] -- 0:00:35
449000 -- [-786.417] (-785.910) (-785.954) (-787.353) * (-788.959) [-786.637] (-787.357) (-787.955) -- 0:00:35
449500 -- [-787.006] (-786.059) (-787.461) (-786.063) * (-788.929) [-789.045] (-786.134) (-785.730) -- 0:00:35
450000 -- (-785.813) [-787.942] (-787.039) (-787.557) * (-787.690) (-792.454) [-786.554] (-788.573) -- 0:00:35
Average standard deviation of split frequencies: 0.012675
450500 -- [-786.563] (-785.787) (-787.867) (-787.404) * (-785.718) (-789.842) (-785.562) [-787.531] -- 0:00:35
451000 -- (-787.643) (-788.869) (-790.448) [-787.350] * (-790.131) (-786.403) (-792.617) [-788.453] -- 0:00:35
451500 -- (-787.802) (-788.893) (-787.643) [-786.929] * [-787.570] (-786.979) (-787.537) (-788.999) -- 0:00:35
452000 -- [-785.727] (-791.896) (-786.354) (-790.528) * (-787.779) [-788.867] (-787.175) (-786.306) -- 0:00:35
452500 -- (-787.841) [-790.402] (-787.187) (-792.314) * (-788.693) (-787.311) [-786.312] (-787.459) -- 0:00:35
453000 -- [-792.223] (-787.133) (-788.663) (-789.668) * (-789.215) (-786.880) (-789.552) [-788.218] -- 0:00:35
453500 -- (-788.215) (-786.480) [-786.931] (-788.942) * [-787.256] (-787.858) (-788.391) (-786.139) -- 0:00:34
454000 -- [-787.084] (-787.618) (-786.951) (-790.983) * (-787.001) [-787.651] (-789.038) (-791.889) -- 0:00:34
454500 -- (-787.735) (-787.040) [-787.600] (-790.973) * (-789.453) (-788.421) [-786.727] (-786.975) -- 0:00:34
455000 -- (-786.050) (-787.926) (-794.053) [-786.383] * [-786.154] (-787.291) (-788.132) (-786.892) -- 0:00:34
Average standard deviation of split frequencies: 0.013318
455500 -- [-786.007] (-786.111) (-786.208) (-786.703) * (-790.271) (-790.404) [-786.589] (-786.412) -- 0:00:34
456000 -- (-786.692) (-787.102) (-787.791) [-789.711] * (-788.446) (-786.183) [-786.407] (-786.235) -- 0:00:34
456500 -- (-787.489) [-791.144] (-788.191) (-794.408) * (-791.880) [-786.891] (-786.642) (-788.368) -- 0:00:34
457000 -- [-785.657] (-786.601) (-787.130) (-787.587) * (-789.832) [-787.635] (-787.104) (-788.796) -- 0:00:34
457500 -- (-789.711) (-785.667) [-791.418] (-786.575) * (-786.884) (-789.766) [-786.372] (-789.477) -- 0:00:34
458000 -- (-789.395) (-786.162) (-789.515) [-786.233] * (-785.937) (-788.547) [-789.275] (-787.083) -- 0:00:34
458500 -- (-788.544) (-785.462) (-785.350) [-785.446] * [-787.498] (-788.344) (-787.375) (-787.952) -- 0:00:34
459000 -- (-786.159) (-788.390) (-791.238) [-786.663] * [-791.573] (-786.566) (-789.673) (-787.825) -- 0:00:34
459500 -- (-786.881) (-786.275) (-787.178) [-787.291] * (-790.428) (-787.341) [-790.794] (-787.683) -- 0:00:34
460000 -- [-787.966] (-787.687) (-785.760) (-787.847) * (-787.328) [-791.061] (-789.455) (-785.949) -- 0:00:35
Average standard deviation of split frequencies: 0.013062
460500 -- [-791.741] (-795.921) (-786.071) (-787.846) * (-787.511) [-787.054] (-788.824) (-789.380) -- 0:00:35
461000 -- (-789.018) (-791.941) (-786.071) [-789.713] * (-788.860) (-786.696) [-789.683] (-787.040) -- 0:00:35
461500 -- (-790.162) [-786.390] (-788.006) (-788.790) * [-786.272] (-788.907) (-789.399) (-785.710) -- 0:00:35
462000 -- (-793.102) [-787.626] (-789.217) (-788.281) * (-785.832) (-790.644) [-786.296] (-787.063) -- 0:00:34
462500 -- (-787.956) [-785.912] (-788.888) (-786.200) * (-786.778) (-786.249) [-786.958] (-788.913) -- 0:00:34
463000 -- (-786.333) (-787.670) [-786.735] (-786.272) * (-786.054) [-788.938] (-787.469) (-789.111) -- 0:00:34
463500 -- (-787.514) [-787.264] (-786.598) (-786.668) * (-786.984) (-789.029) [-786.675] (-788.502) -- 0:00:34
464000 -- [-787.560] (-788.198) (-787.375) (-790.765) * [-787.671] (-788.336) (-787.047) (-787.354) -- 0:00:34
464500 -- [-787.853] (-785.778) (-788.103) (-787.142) * (-786.453) [-787.169] (-787.619) (-786.115) -- 0:00:34
465000 -- (-785.674) (-786.926) [-787.319] (-786.857) * (-788.380) (-787.708) [-786.297] (-787.656) -- 0:00:34
Average standard deviation of split frequencies: 0.013329
465500 -- (-789.189) (-786.140) (-787.925) [-786.464] * [-787.477] (-790.725) (-787.715) (-786.746) -- 0:00:34
466000 -- (-787.321) [-785.858] (-787.922) (-786.366) * (-792.756) (-789.697) (-786.240) [-789.059] -- 0:00:34
466500 -- [-787.980] (-785.780) (-786.553) (-787.708) * (-787.117) (-791.092) [-786.292] (-787.776) -- 0:00:34
467000 -- (-787.400) [-787.184] (-790.018) (-787.944) * [-787.231] (-794.041) (-786.596) (-787.694) -- 0:00:34
467500 -- (-787.392) (-787.027) [-788.878] (-787.508) * (-791.525) [-790.595] (-786.319) (-788.157) -- 0:00:34
468000 -- [-785.661] (-786.414) (-787.802) (-787.202) * (-789.948) [-785.979] (-789.135) (-788.805) -- 0:00:34
468500 -- (-785.400) (-786.703) [-788.045] (-788.116) * [-790.164] (-788.893) (-787.600) (-793.877) -- 0:00:34
469000 -- (-785.651) [-786.896] (-790.452) (-786.989) * [-787.430] (-788.865) (-786.134) (-791.096) -- 0:00:33
469500 -- (-787.336) (-786.690) (-786.660) [-786.136] * [-788.208] (-788.726) (-794.070) (-788.294) -- 0:00:33
470000 -- (-785.942) (-789.079) (-788.984) [-785.889] * [-786.691] (-789.855) (-788.053) (-787.025) -- 0:00:33
Average standard deviation of split frequencies: 0.013551
470500 -- (-790.381) (-786.051) (-788.350) [-789.116] * (-786.205) (-786.723) [-788.996] (-786.838) -- 0:00:33
471000 -- (-786.818) (-786.373) [-789.368] (-788.800) * (-786.696) (-787.588) (-788.816) [-786.193] -- 0:00:33
471500 -- [-788.202] (-786.771) (-789.169) (-787.709) * (-787.521) (-788.427) [-787.504] (-786.949) -- 0:00:33
472000 -- (-788.223) (-785.631) [-789.733] (-787.355) * [-787.263] (-788.385) (-787.247) (-786.953) -- 0:00:33
472500 -- (-789.062) (-785.559) [-788.540] (-787.826) * (-786.380) [-786.930] (-790.423) (-786.510) -- 0:00:33
473000 -- (-786.602) [-790.455] (-789.208) (-788.488) * (-786.470) (-785.856) (-786.329) [-788.736] -- 0:00:33
473500 -- [-789.004] (-787.165) (-792.808) (-788.978) * (-786.478) (-786.227) (-791.646) [-789.746] -- 0:00:33
474000 -- [-791.282] (-785.990) (-789.506) (-786.748) * [-786.317] (-795.666) (-789.504) (-793.322) -- 0:00:33
474500 -- (-792.071) [-788.474] (-786.415) (-787.733) * [-787.107] (-786.324) (-787.746) (-790.792) -- 0:00:33
475000 -- (-787.148) (-787.908) (-786.162) [-786.373] * (-787.574) (-786.819) (-786.962) [-786.519] -- 0:00:33
Average standard deviation of split frequencies: 0.012998
475500 -- (-789.114) (-785.601) [-787.810] (-787.822) * (-788.974) [-786.280] (-790.320) (-790.601) -- 0:00:33
476000 -- (-789.659) (-786.024) [-787.700] (-787.389) * [-790.295] (-786.878) (-789.297) (-788.801) -- 0:00:33
476500 -- (-788.894) [-786.549] (-786.864) (-787.306) * (-787.744) (-788.316) (-789.377) [-787.409] -- 0:00:32
477000 -- (-787.271) [-787.156] (-787.235) (-787.145) * (-785.482) (-792.400) [-786.639] (-787.081) -- 0:00:33
477500 -- (-786.255) [-788.764] (-785.258) (-786.128) * (-785.584) [-787.701] (-787.153) (-787.297) -- 0:00:33
478000 -- (-787.170) (-785.465) [-785.258] (-787.624) * (-787.695) (-788.775) (-788.260) [-788.143] -- 0:00:33
478500 -- (-786.479) (-787.494) [-787.514] (-785.622) * (-790.084) [-790.036] (-787.496) (-786.233) -- 0:00:33
479000 -- (-787.403) (-786.201) [-789.181] (-786.738) * (-789.679) (-791.068) [-786.077] (-786.945) -- 0:00:33
479500 -- (-789.131) (-785.614) (-787.806) [-786.795] * (-787.011) (-790.514) [-787.667] (-785.318) -- 0:00:33
480000 -- [-786.510] (-787.582) (-787.301) (-788.486) * [-789.878] (-789.748) (-790.960) (-786.480) -- 0:00:33
Average standard deviation of split frequencies: 0.013788
480500 -- (-787.549) (-787.483) (-786.952) [-789.682] * (-788.688) (-787.881) [-789.182] (-786.046) -- 0:00:33
481000 -- [-788.961] (-785.555) (-788.985) (-792.466) * (-786.693) [-790.990] (-787.244) (-788.514) -- 0:00:33
481500 -- (-787.569) (-786.885) (-790.704) [-787.515] * (-787.250) [-788.848] (-787.308) (-788.468) -- 0:00:33
482000 -- (-791.780) (-789.972) (-787.568) [-787.947] * [-786.431] (-790.669) (-786.625) (-787.343) -- 0:00:33
482500 -- (-788.802) (-785.926) (-786.284) [-785.780] * (-790.267) (-786.362) [-786.035] (-786.035) -- 0:00:33
483000 -- (-791.205) (-787.451) (-786.636) [-786.588] * (-787.371) (-785.836) (-786.758) [-789.051] -- 0:00:33
483500 -- [-787.840] (-787.070) (-788.013) (-792.651) * (-787.282) [-790.161] (-787.616) (-785.718) -- 0:00:33
484000 -- (-789.380) (-786.268) [-786.514] (-787.704) * (-785.507) (-789.576) [-786.773] (-787.315) -- 0:00:33
484500 -- (-786.245) (-786.256) [-792.376] (-787.969) * [-787.478] (-788.283) (-787.357) (-785.513) -- 0:00:32
485000 -- (-787.778) (-786.960) (-786.583) [-787.984] * [-786.833] (-787.202) (-790.176) (-789.386) -- 0:00:32
Average standard deviation of split frequencies: 0.014264
485500 -- (-787.871) [-786.960] (-786.961) (-786.536) * (-788.022) (-786.584) (-787.106) [-787.064] -- 0:00:32
486000 -- (-792.217) (-787.221) (-787.687) [-786.431] * [-787.326] (-790.174) (-787.649) (-789.042) -- 0:00:32
486500 -- (-786.248) (-792.883) [-786.172] (-788.555) * (-786.711) (-788.728) (-786.166) [-787.403] -- 0:00:32
487000 -- (-792.744) (-786.831) [-787.947] (-786.131) * [-790.561] (-791.187) (-786.264) (-786.619) -- 0:00:32
487500 -- (-788.171) (-787.020) [-788.231] (-787.757) * [-787.225] (-788.667) (-788.725) (-786.461) -- 0:00:32
488000 -- (-792.953) (-786.761) (-786.384) [-788.153] * (-788.422) [-789.194] (-791.563) (-787.271) -- 0:00:32
488500 -- (-789.696) (-786.329) (-793.950) [-787.887] * [-785.788] (-787.609) (-787.556) (-789.999) -- 0:00:32
489000 -- (-790.163) (-788.777) (-790.211) [-785.908] * (-788.868) (-788.967) [-786.650] (-790.474) -- 0:00:32
489500 -- (-788.700) (-789.288) (-787.959) [-787.141] * (-787.046) (-794.695) [-788.066] (-795.377) -- 0:00:32
490000 -- [-793.519] (-786.621) (-786.469) (-786.900) * (-787.217) (-788.493) [-786.802] (-792.590) -- 0:00:32
Average standard deviation of split frequencies: 0.014471
490500 -- (-793.475) (-786.306) (-785.787) [-786.467] * (-788.330) (-788.656) (-786.776) [-786.596] -- 0:00:32
491000 -- (-792.701) (-786.039) [-785.646] (-788.776) * (-785.933) (-785.790) [-786.241] (-787.727) -- 0:00:32
491500 -- [-789.382] (-786.512) (-787.636) (-789.330) * (-788.177) [-786.581] (-787.169) (-792.174) -- 0:00:32
492000 -- (-787.883) (-790.372) [-788.652] (-787.523) * (-789.363) (-790.676) [-787.989] (-791.824) -- 0:00:33
492500 -- (-789.882) (-787.064) [-785.147] (-786.453) * [-785.637] (-787.398) (-787.377) (-786.747) -- 0:00:32
493000 -- [-787.287] (-788.467) (-786.543) (-786.336) * [-785.706] (-786.831) (-786.734) (-786.982) -- 0:00:32
493500 -- (-786.692) (-787.071) (-790.287) [-786.168] * (-787.798) (-785.161) (-793.400) [-786.818] -- 0:00:32
494000 -- (-791.654) (-785.752) [-787.360] (-785.710) * (-785.815) (-787.071) [-790.444] (-786.576) -- 0:00:32
494500 -- (-786.455) [-785.624] (-786.654) (-786.464) * (-787.580) (-788.061) (-785.037) [-787.491] -- 0:00:32
495000 -- (-786.309) (-786.544) (-788.947) [-788.042] * [-786.073] (-786.784) (-786.910) (-787.557) -- 0:00:32
Average standard deviation of split frequencies: 0.014137
495500 -- (-786.909) (-789.318) (-790.300) [-791.976] * (-785.954) (-786.235) (-786.161) [-788.537] -- 0:00:32
496000 -- (-788.522) (-787.819) (-786.728) [-787.851] * (-787.569) (-786.905) (-790.233) [-789.319] -- 0:00:32
496500 -- (-789.235) (-788.169) [-787.430] (-788.479) * [-788.699] (-787.459) (-788.413) (-789.051) -- 0:00:32
497000 -- (-787.560) [-791.307] (-788.626) (-788.153) * (-786.133) (-785.753) (-790.960) [-785.270] -- 0:00:32
497500 -- (-789.273) (-788.067) (-790.406) [-788.227] * [-785.449] (-788.161) (-793.767) (-786.110) -- 0:00:32
498000 -- (-791.758) (-789.565) [-788.020] (-786.689) * [-786.863] (-786.382) (-788.652) (-788.999) -- 0:00:32
498500 -- [-793.585] (-789.161) (-787.109) (-787.584) * (-785.709) (-787.378) (-789.852) [-789.015] -- 0:00:32
499000 -- (-788.546) (-787.342) [-791.140] (-793.547) * [-789.094] (-791.841) (-788.350) (-787.964) -- 0:00:32
499500 -- (-787.329) [-785.744] (-791.024) (-785.817) * (-786.809) (-791.538) [-791.778] (-786.414) -- 0:00:32
500000 -- (-788.324) [-790.252] (-786.270) (-787.940) * (-790.046) [-785.822] (-786.950) (-789.572) -- 0:00:32
Average standard deviation of split frequencies: 0.014182
500500 -- (-785.783) (-787.338) [-787.179] (-788.648) * (-785.611) (-789.546) (-786.994) [-787.741] -- 0:00:31
501000 -- (-787.147) (-786.766) [-786.172] (-789.853) * (-787.787) (-790.332) (-788.061) [-787.022] -- 0:00:31
501500 -- (-786.229) [-787.857] (-787.597) (-787.927) * (-788.303) (-789.406) (-788.822) [-785.919] -- 0:00:31
502000 -- (-786.598) [-788.206] (-788.004) (-788.258) * (-785.751) [-787.259] (-788.919) (-786.409) -- 0:00:31
502500 -- (-785.927) (-786.453) (-789.367) [-787.128] * (-787.810) [-787.593] (-786.147) (-786.104) -- 0:00:31
503000 -- (-785.974) [-789.190] (-789.670) (-789.055) * (-788.071) [-786.548] (-787.016) (-787.186) -- 0:00:31
503500 -- [-786.840] (-788.930) (-791.132) (-791.783) * [-789.922] (-786.419) (-786.613) (-792.264) -- 0:00:31
504000 -- (-787.188) [-788.569] (-790.781) (-796.678) * [-789.009] (-786.710) (-788.368) (-786.712) -- 0:00:31
504500 -- (-790.527) (-787.006) [-785.831] (-787.331) * (-790.819) [-789.617] (-789.253) (-786.642) -- 0:00:31
505000 -- (-787.992) (-787.810) [-786.591] (-789.017) * [-788.608] (-789.555) (-789.268) (-786.405) -- 0:00:31
Average standard deviation of split frequencies: 0.013567
505500 -- (-790.449) [-790.625] (-785.773) (-785.573) * (-788.519) (-790.028) (-790.673) [-786.468] -- 0:00:31
506000 -- (-792.512) [-787.050] (-785.419) (-785.534) * (-789.025) (-786.896) (-786.601) [-791.577] -- 0:00:31
506500 -- [-787.129] (-789.348) (-785.542) (-785.856) * (-788.523) [-789.207] (-785.656) (-787.513) -- 0:00:31
507000 -- (-789.174) (-786.410) [-787.261] (-787.949) * (-785.611) [-785.506] (-790.172) (-786.152) -- 0:00:31
507500 -- (-788.192) (-786.691) (-786.334) [-786.501] * [-789.290] (-788.932) (-786.804) (-793.617) -- 0:00:31
508000 -- (-786.772) (-786.603) [-786.720] (-787.169) * [-787.836] (-789.066) (-785.457) (-789.547) -- 0:00:30
508500 -- (-786.693) [-787.150] (-789.821) (-787.703) * (-788.283) (-790.601) [-785.732] (-787.896) -- 0:00:31
509000 -- (-789.210) (-787.613) [-786.645] (-787.626) * (-786.202) (-788.020) (-791.539) [-786.505] -- 0:00:31
509500 -- (-788.247) [-788.276] (-789.162) (-786.166) * (-788.472) (-787.417) (-793.159) [-786.196] -- 0:00:31
510000 -- [-792.116] (-788.511) (-789.022) (-787.535) * (-787.083) (-786.835) [-789.344] (-786.711) -- 0:00:31
Average standard deviation of split frequencies: 0.014251
510500 -- (-790.046) (-785.817) (-788.737) [-787.087] * (-789.340) (-786.566) (-786.516) [-786.293] -- 0:00:31
511000 -- [-788.621] (-785.834) (-786.126) (-786.481) * (-787.387) [-786.827] (-785.884) (-785.957) -- 0:00:31
511500 -- [-790.964] (-787.795) (-790.061) (-790.373) * [-788.975] (-790.576) (-790.384) (-787.808) -- 0:00:31
512000 -- [-786.778] (-788.781) (-790.302) (-788.562) * (-788.789) [-789.057] (-793.076) (-788.635) -- 0:00:31
512500 -- [-786.011] (-786.693) (-787.425) (-787.473) * (-790.065) [-786.320] (-787.538) (-785.854) -- 0:00:31
513000 -- (-787.665) [-786.161] (-786.894) (-785.666) * (-789.927) [-786.579] (-790.837) (-787.217) -- 0:00:31
513500 -- (-789.459) [-788.095] (-787.493) (-788.158) * [-790.588] (-785.665) (-787.249) (-787.459) -- 0:00:31
514000 -- [-786.767] (-789.042) (-788.589) (-786.754) * (-791.366) (-786.798) (-786.074) [-787.429] -- 0:00:31
514500 -- (-792.073) (-787.825) [-787.112] (-786.050) * (-786.277) [-790.211] (-787.209) (-787.646) -- 0:00:31
515000 -- (-793.197) (-787.161) (-787.307) [-786.812] * (-787.957) (-786.286) [-785.199] (-788.837) -- 0:00:31
Average standard deviation of split frequencies: 0.014218
515500 -- (-787.024) (-789.439) [-787.386] (-787.243) * (-787.023) (-787.350) [-786.184] (-790.242) -- 0:00:31
516000 -- (-788.004) (-790.972) (-785.801) [-786.362] * (-789.407) (-787.905) (-787.194) [-788.964] -- 0:00:30
516500 -- [-787.913] (-789.301) (-786.375) (-786.283) * [-787.252] (-788.884) (-789.827) (-788.737) -- 0:00:30
517000 -- (-788.698) (-786.893) [-785.847] (-786.028) * (-786.732) (-786.467) [-786.916] (-785.675) -- 0:00:30
517500 -- [-790.330] (-787.389) (-785.922) (-786.055) * (-789.122) (-790.509) [-785.808] (-786.048) -- 0:00:30
518000 -- [-789.246] (-788.298) (-785.833) (-788.893) * [-788.624] (-789.966) (-788.484) (-790.789) -- 0:00:30
518500 -- [-789.735] (-787.700) (-786.628) (-790.955) * (-788.620) (-786.331) (-786.585) [-789.801] -- 0:00:30
519000 -- (-788.817) (-785.907) (-787.721) [-786.181] * (-788.333) [-785.862] (-787.734) (-788.045) -- 0:00:30
519500 -- (-788.243) (-786.357) [-787.953] (-787.161) * (-787.137) (-789.136) [-787.842] (-792.845) -- 0:00:30
520000 -- (-789.857) (-785.996) [-790.053] (-790.587) * (-788.971) (-790.199) [-785.985] (-788.435) -- 0:00:30
Average standard deviation of split frequencies: 0.014316
520500 -- [-787.376] (-787.395) (-786.402) (-788.812) * (-788.046) [-787.131] (-786.186) (-793.362) -- 0:00:30
521000 -- (-786.761) [-785.467] (-793.049) (-787.018) * (-790.527) (-787.760) (-785.307) [-789.209] -- 0:00:30
521500 -- (-787.106) (-787.268) (-791.696) [-790.746] * [-788.291] (-788.096) (-786.020) (-787.012) -- 0:00:30
522000 -- (-788.521) (-786.494) [-787.461] (-792.236) * [-785.629] (-786.949) (-787.834) (-788.823) -- 0:00:30
522500 -- (-790.357) (-787.386) (-787.400) [-787.121] * [-788.603] (-786.034) (-788.462) (-788.495) -- 0:00:30
523000 -- (-789.566) (-788.064) [-785.712] (-792.323) * (-787.845) (-788.587) (-787.245) [-788.568] -- 0:00:30
523500 -- (-788.755) (-790.138) [-786.724] (-785.908) * (-787.850) [-788.987] (-786.264) (-791.097) -- 0:00:30
524000 -- [-788.292] (-789.865) (-789.404) (-791.822) * (-787.210) (-787.240) (-787.248) [-788.733] -- 0:00:30
524500 -- [-791.136] (-789.425) (-787.861) (-787.266) * (-786.159) (-787.177) [-789.914] (-788.335) -- 0:00:30
525000 -- (-791.031) (-787.775) [-788.619] (-786.032) * [-791.804] (-787.158) (-786.384) (-787.140) -- 0:00:30
Average standard deviation of split frequencies: 0.014451
525500 -- (-787.283) [-788.389] (-788.737) (-791.087) * (-787.052) (-787.983) (-787.877) [-789.640] -- 0:00:30
526000 -- [-787.584] (-789.299) (-785.849) (-787.079) * (-787.214) (-788.608) (-789.275) [-789.119] -- 0:00:30
526500 -- (-786.094) (-788.815) (-791.461) [-786.311] * (-790.030) (-788.095) (-789.796) [-787.277] -- 0:00:30
527000 -- (-788.236) (-796.350) [-790.155] (-787.121) * (-785.533) [-786.992] (-787.026) (-786.837) -- 0:00:30
527500 -- (-789.460) (-790.514) (-789.445) [-786.669] * [-787.169] (-797.360) (-786.395) (-787.291) -- 0:00:30
528000 -- (-790.561) [-791.579] (-791.435) (-787.589) * (-791.680) (-790.692) [-786.441] (-786.660) -- 0:00:30
528500 -- (-787.573) (-786.469) [-790.772] (-786.328) * (-790.715) [-787.099] (-788.485) (-788.739) -- 0:00:30
529000 -- (-785.959) [-786.707] (-789.963) (-788.216) * (-788.464) [-786.692] (-789.541) (-788.807) -- 0:00:30
529500 -- (-789.293) [-786.430] (-791.708) (-787.176) * (-788.970) (-789.234) [-787.915] (-795.580) -- 0:00:30
530000 -- (-787.459) (-788.171) [-789.276] (-787.833) * (-792.834) (-789.025) [-786.563] (-785.882) -- 0:00:30
Average standard deviation of split frequencies: 0.014380
530500 -- (-788.397) (-787.285) (-787.617) [-786.613] * (-786.951) (-789.902) (-786.594) [-787.150] -- 0:00:30
531000 -- (-787.706) (-791.221) [-787.022] (-787.720) * (-788.644) (-789.125) (-785.770) [-786.355] -- 0:00:30
531500 -- (-790.557) (-789.175) (-788.482) [-786.373] * (-790.312) [-790.356] (-787.291) (-786.340) -- 0:00:29
532000 -- (-786.531) (-790.570) (-788.290) [-786.514] * (-787.042) (-791.932) [-787.501] (-787.566) -- 0:00:29
532500 -- (-787.467) (-789.744) (-790.914) [-789.905] * (-788.980) (-790.129) [-787.021] (-787.987) -- 0:00:29
533000 -- (-787.415) (-790.476) (-789.296) [-786.759] * (-787.555) (-788.333) [-787.271] (-788.767) -- 0:00:29
533500 -- [-786.488] (-785.629) (-786.060) (-787.046) * (-787.232) (-789.160) (-785.669) [-790.169] -- 0:00:29
534000 -- [-787.911] (-789.079) (-787.182) (-790.102) * [-787.440] (-787.288) (-786.515) (-792.493) -- 0:00:29
534500 -- [-788.965] (-786.504) (-787.321) (-786.272) * (-788.414) (-801.186) (-788.042) [-788.137] -- 0:00:29
535000 -- (-786.078) (-786.859) (-786.474) [-786.419] * (-787.697) (-792.261) [-787.944] (-785.854) -- 0:00:29
Average standard deviation of split frequencies: 0.014347
535500 -- (-787.463) [-786.957] (-790.225) (-786.001) * (-786.997) (-786.898) [-787.967] (-787.591) -- 0:00:29
536000 -- (-788.456) (-788.562) [-786.264] (-787.005) * (-786.158) [-786.990] (-788.482) (-785.372) -- 0:00:29
536500 -- [-785.995] (-789.924) (-791.329) (-786.006) * (-786.543) [-789.030] (-789.021) (-786.966) -- 0:00:29
537000 -- (-786.514) (-789.152) [-788.449] (-785.840) * (-791.205) [-787.139] (-788.840) (-788.409) -- 0:00:29
537500 -- (-787.561) (-789.092) [-787.471] (-786.551) * (-790.806) (-785.757) (-786.498) [-785.752] -- 0:00:29
538000 -- [-789.043] (-785.970) (-791.548) (-786.953) * [-789.436] (-786.900) (-786.170) (-786.938) -- 0:00:29
538500 -- (-788.480) (-785.848) (-788.524) [-786.682] * (-787.839) [-788.450] (-786.215) (-786.685) -- 0:00:29
539000 -- (-788.921) (-791.429) [-786.070] (-788.821) * [-787.495] (-786.788) (-787.968) (-785.754) -- 0:00:29
539500 -- (-789.480) (-788.370) (-786.485) [-787.507] * (-788.657) [-785.499] (-786.360) (-787.459) -- 0:00:29
540000 -- (-787.649) (-790.721) (-785.382) [-788.424] * [-789.476] (-791.459) (-786.868) (-791.476) -- 0:00:29
Average standard deviation of split frequencies: 0.015095
540500 -- (-788.099) (-792.803) (-786.545) [-789.886] * (-787.419) [-788.712] (-789.901) (-787.054) -- 0:00:29
541000 -- (-785.463) [-790.513] (-785.915) (-786.463) * (-789.040) (-788.836) (-788.900) [-786.114] -- 0:00:29
541500 -- (-786.640) (-786.583) [-786.375] (-791.888) * (-790.928) [-788.598] (-786.368) (-786.300) -- 0:00:29
542000 -- [-785.558] (-787.395) (-785.961) (-787.237) * (-786.956) [-785.632] (-788.693) (-787.844) -- 0:00:29
542500 -- (-785.994) (-785.616) (-787.897) [-785.702] * (-786.846) (-786.693) [-786.995] (-786.482) -- 0:00:29
543000 -- (-786.032) [-786.297] (-787.433) (-786.960) * (-788.028) (-788.396) (-788.605) [-790.768] -- 0:00:29
543500 -- (-786.155) (-786.784) [-788.044] (-785.992) * (-789.639) [-791.496] (-788.237) (-791.649) -- 0:00:29
544000 -- (-787.743) [-788.382] (-787.456) (-785.677) * [-788.326] (-788.372) (-787.669) (-786.032) -- 0:00:29
544500 -- [-786.024] (-787.055) (-787.460) (-787.359) * (-786.425) (-787.821) (-786.665) [-786.968] -- 0:00:29
545000 -- (-785.815) [-787.031] (-788.022) (-791.837) * [-788.803] (-786.807) (-787.745) (-788.003) -- 0:00:29
Average standard deviation of split frequencies: 0.014300
545500 -- [-786.595] (-792.498) (-786.784) (-785.958) * [-790.886] (-787.763) (-787.508) (-789.815) -- 0:00:29
546000 -- (-786.683) (-786.677) [-786.728] (-787.688) * (-790.835) (-789.168) [-787.228] (-785.599) -- 0:00:29
546500 -- (-786.146) [-788.010] (-790.572) (-789.960) * [-790.711] (-790.849) (-788.540) (-786.691) -- 0:00:29
547000 -- (-787.142) [-785.163] (-789.426) (-787.475) * (-787.622) [-788.222] (-787.602) (-788.989) -- 0:00:28
547500 -- (-786.304) (-786.832) (-787.435) [-787.132] * [-788.069] (-787.416) (-787.465) (-787.962) -- 0:00:28
548000 -- (-789.294) (-788.106) (-786.588) [-787.535] * (-790.524) (-787.372) [-787.586] (-785.558) -- 0:00:28
548500 -- (-787.853) (-787.079) [-785.902] (-789.348) * (-791.231) [-787.855] (-785.972) (-786.237) -- 0:00:28
549000 -- (-786.874) (-787.054) (-786.345) [-787.486] * (-788.837) [-788.202] (-788.590) (-787.096) -- 0:00:28
549500 -- (-789.751) [-788.930] (-793.109) (-787.727) * (-787.950) (-789.131) [-785.546] (-787.260) -- 0:00:28
550000 -- [-787.181] (-789.293) (-787.700) (-787.901) * (-792.284) (-786.107) [-790.717] (-786.706) -- 0:00:28
Average standard deviation of split frequencies: 0.014286
550500 -- (-786.704) (-791.513) (-788.273) [-789.810] * (-791.670) [-786.091] (-786.553) (-790.636) -- 0:00:28
551000 -- (-789.811) (-788.245) [-786.575] (-788.687) * (-787.505) (-791.067) [-787.443] (-787.527) -- 0:00:28
551500 -- (-786.548) (-786.121) (-787.992) [-789.287] * (-787.935) (-788.360) (-787.310) [-786.604] -- 0:00:28
552000 -- (-786.752) [-786.671] (-791.118) (-789.385) * (-789.819) (-785.554) [-786.017] (-788.368) -- 0:00:28
552500 -- [-785.700] (-785.605) (-787.620) (-791.176) * (-790.598) (-789.149) (-786.304) [-786.945] -- 0:00:28
553000 -- (-787.179) (-785.481) [-787.787] (-788.929) * [-790.293] (-787.946) (-788.050) (-786.987) -- 0:00:28
553500 -- (-787.316) (-792.989) [-787.498] (-786.424) * (-788.034) (-786.119) (-786.823) [-788.126] -- 0:00:28
554000 -- (-788.385) [-787.136] (-787.947) (-790.208) * (-789.687) (-787.018) (-786.157) [-785.860] -- 0:00:28
554500 -- (-786.396) (-786.150) [-787.250] (-789.595) * (-786.223) (-786.221) [-786.369] (-787.364) -- 0:00:28
555000 -- (-788.214) (-787.252) [-788.412] (-786.608) * [-786.305] (-788.975) (-787.094) (-785.637) -- 0:00:28
Average standard deviation of split frequencies: 0.014307
555500 -- [-787.433] (-786.636) (-787.240) (-786.797) * (-786.832) [-789.157] (-788.378) (-789.883) -- 0:00:28
556000 -- [-787.595] (-786.781) (-786.652) (-789.584) * (-785.484) (-787.637) (-788.200) [-786.859] -- 0:00:28
556500 -- (-788.317) (-788.247) [-785.951] (-787.797) * (-785.665) [-787.291] (-786.962) (-787.024) -- 0:00:28
557000 -- [-787.276] (-791.259) (-785.705) (-786.488) * [-787.796] (-792.727) (-789.714) (-786.804) -- 0:00:28
557500 -- [-786.717] (-785.992) (-786.403) (-788.063) * (-787.970) [-785.775] (-788.443) (-787.803) -- 0:00:28
558000 -- (-788.412) (-787.208) (-790.282) [-788.501] * (-787.110) [-785.345] (-786.493) (-788.225) -- 0:00:28
558500 -- (-788.056) (-787.784) [-786.603] (-789.828) * [-787.453] (-786.493) (-788.313) (-785.201) -- 0:00:28
559000 -- (-792.755) (-789.290) [-787.709] (-787.645) * [-787.525] (-790.929) (-786.935) (-785.126) -- 0:00:28
559500 -- (-792.499) (-787.671) (-786.243) [-786.769] * (-787.494) (-787.608) [-787.580] (-786.612) -- 0:00:28
560000 -- (-793.122) [-786.739] (-789.359) (-787.144) * (-791.100) [-785.769] (-791.866) (-791.711) -- 0:00:28
Average standard deviation of split frequencies: 0.013978
560500 -- (-787.078) [-786.889] (-788.741) (-788.765) * (-792.024) [-785.444] (-790.423) (-792.120) -- 0:00:28
561000 -- (-786.522) [-786.245] (-786.765) (-787.112) * (-790.480) [-786.128] (-788.642) (-789.711) -- 0:00:28
561500 -- (-785.751) (-785.830) (-787.396) [-785.898] * (-786.585) [-787.173] (-786.203) (-787.123) -- 0:00:28
562000 -- (-788.336) (-785.634) (-787.498) [-787.712] * (-786.715) (-786.403) (-786.651) [-786.508] -- 0:00:28
562500 -- (-785.817) [-786.484] (-792.056) (-788.063) * (-794.986) (-787.393) [-788.429] (-786.457) -- 0:00:28
563000 -- (-785.818) (-786.413) (-789.388) [-785.539] * (-791.840) (-785.122) (-787.613) [-786.448] -- 0:00:27
563500 -- (-787.611) [-787.123] (-787.276) (-786.022) * (-786.500) [-786.168] (-787.785) (-787.530) -- 0:00:27
564000 -- (-785.762) (-786.839) [-785.442] (-786.033) * (-786.869) (-785.518) (-787.021) [-789.127] -- 0:00:27
564500 -- (-786.294) [-786.258] (-786.842) (-788.073) * (-787.742) (-787.251) (-790.288) [-786.974] -- 0:00:27
565000 -- (-786.912) (-786.784) [-787.531] (-787.953) * (-786.390) (-785.908) (-790.537) [-788.611] -- 0:00:27
Average standard deviation of split frequencies: 0.014110
565500 -- (-786.402) [-786.293] (-789.377) (-787.406) * (-788.210) (-788.656) (-789.872) [-786.519] -- 0:00:27
566000 -- (-787.926) [-785.258] (-787.031) (-787.741) * (-786.229) (-789.261) [-785.746] (-786.829) -- 0:00:27
566500 -- (-786.560) [-785.801] (-789.134) (-788.076) * (-786.042) [-789.853] (-786.590) (-787.518) -- 0:00:27
567000 -- (-787.337) (-785.908) (-789.006) [-786.326] * (-787.904) [-786.193] (-785.821) (-789.689) -- 0:00:27
567500 -- [-791.452] (-789.845) (-790.377) (-786.443) * (-785.370) (-786.775) [-787.496] (-788.432) -- 0:00:27
568000 -- [-785.983] (-787.360) (-786.514) (-786.357) * (-786.138) (-786.746) [-785.739] (-790.754) -- 0:00:27
568500 -- [-785.256] (-785.520) (-786.129) (-786.045) * (-785.972) (-787.492) (-787.247) [-788.343] -- 0:00:27
569000 -- (-787.316) (-786.145) (-786.905) [-785.817] * (-785.992) (-786.125) [-786.717] (-786.989) -- 0:00:27
569500 -- (-787.051) [-786.294] (-787.701) (-787.649) * (-786.838) [-785.825] (-787.580) (-787.459) -- 0:00:27
570000 -- (-785.805) (-787.344) [-785.519] (-789.119) * (-787.838) [-786.491] (-793.284) (-787.789) -- 0:00:27
Average standard deviation of split frequencies: 0.013946
570500 -- [-785.536] (-787.033) (-785.702) (-789.493) * (-786.407) [-787.572] (-794.059) (-787.964) -- 0:00:27
571000 -- [-788.945] (-788.308) (-787.888) (-788.572) * (-793.206) (-787.111) (-789.600) [-787.571] -- 0:00:27
571500 -- (-788.580) [-786.814] (-786.006) (-786.338) * [-787.954] (-790.181) (-788.352) (-788.234) -- 0:00:27
572000 -- (-786.213) (-787.655) (-792.626) [-786.844] * [-787.291] (-789.072) (-787.574) (-788.928) -- 0:00:27
572500 -- [-786.460] (-787.104) (-790.886) (-789.206) * (-788.201) (-785.644) [-786.905] (-793.850) -- 0:00:27
573000 -- (-792.471) [-788.145] (-785.961) (-788.012) * (-788.258) (-789.597) (-786.329) [-785.775] -- 0:00:27
573500 -- [-786.509] (-789.719) (-785.702) (-786.000) * [-785.934] (-785.826) (-785.228) (-786.606) -- 0:00:27
574000 -- (-790.275) (-791.766) [-786.297] (-785.131) * (-786.585) [-788.434] (-787.199) (-785.877) -- 0:00:27
574500 -- (-786.347) (-789.236) [-788.600] (-791.024) * (-788.329) (-788.300) (-787.520) [-786.712] -- 0:00:27
575000 -- (-790.933) (-785.483) [-786.804] (-787.721) * (-786.510) [-787.956] (-788.552) (-786.181) -- 0:00:27
Average standard deviation of split frequencies: 0.014424
575500 -- [-787.911] (-786.561) (-787.342) (-789.157) * (-788.763) (-788.797) (-793.617) [-786.929] -- 0:00:27
576000 -- [-788.553] (-786.451) (-788.146) (-789.323) * (-787.183) [-787.627] (-787.524) (-786.493) -- 0:00:27
576500 -- (-791.183) [-789.199] (-787.940) (-786.779) * (-786.316) (-786.314) (-786.036) [-786.798] -- 0:00:27
577000 -- (-786.080) (-788.483) (-788.289) [-786.956] * [-787.597] (-786.562) (-787.532) (-786.334) -- 0:00:27
577500 -- (-787.050) (-786.591) (-786.327) [-787.190] * [-785.997] (-787.336) (-785.753) (-788.598) -- 0:00:27
578000 -- (-785.899) (-785.924) [-787.076] (-790.411) * [-787.717] (-786.587) (-794.149) (-785.922) -- 0:00:27
578500 -- [-786.425] (-787.300) (-787.207) (-788.077) * (-793.688) [-786.983] (-787.607) (-789.065) -- 0:00:26
579000 -- [-786.937] (-786.903) (-787.059) (-788.946) * (-788.968) (-788.666) (-786.339) [-785.104] -- 0:00:26
579500 -- [-788.304] (-786.836) (-787.928) (-788.454) * (-787.455) (-786.622) [-789.631] (-785.733) -- 0:00:26
580000 -- (-790.987) (-786.074) (-785.513) [-790.700] * (-787.369) (-787.600) (-786.893) [-786.150] -- 0:00:26
Average standard deviation of split frequencies: 0.014867
580500 -- (-785.897) (-786.732) (-792.604) [-788.576] * [-786.178] (-788.107) (-785.616) (-786.906) -- 0:00:26
581000 -- (-787.769) (-788.031) (-791.080) [-786.071] * (-786.650) (-787.195) (-786.137) [-788.271] -- 0:00:26
581500 -- [-789.367] (-787.558) (-787.996) (-785.549) * (-786.039) (-789.703) (-786.253) [-786.830] -- 0:00:26
582000 -- (-788.796) (-788.050) (-787.157) [-786.935] * (-785.651) (-790.263) [-786.681] (-788.208) -- 0:00:26
582500 -- (-787.771) (-791.637) [-786.347] (-786.085) * [-789.204] (-789.934) (-786.985) (-790.807) -- 0:00:26
583000 -- (-786.848) (-789.593) [-788.576] (-787.471) * [-786.853] (-786.931) (-786.591) (-785.640) -- 0:00:26
583500 -- (-786.110) (-789.074) (-785.955) [-787.628] * (-786.772) (-786.910) [-787.632] (-786.596) -- 0:00:26
584000 -- (-788.652) (-790.011) (-787.252) [-791.651] * (-789.488) (-786.302) (-787.202) [-789.538] -- 0:00:26
584500 -- (-786.593) (-793.313) (-789.831) [-786.676] * (-791.397) (-785.785) [-788.362] (-788.281) -- 0:00:26
585000 -- (-787.572) (-791.837) (-792.000) [-789.237] * (-790.228) [-788.725] (-788.344) (-786.542) -- 0:00:26
Average standard deviation of split frequencies: 0.015237
585500 -- (-785.585) (-785.814) (-787.018) [-789.509] * (-788.336) [-791.614] (-787.792) (-786.006) -- 0:00:26
586000 -- (-788.463) (-786.184) [-786.143] (-790.603) * (-786.133) (-789.054) (-787.456) [-785.893] -- 0:00:26
586500 -- [-786.463] (-787.879) (-791.366) (-790.404) * (-786.236) [-788.997] (-789.673) (-790.436) -- 0:00:26
587000 -- (-786.235) (-786.041) [-788.763] (-791.853) * (-785.807) [-785.363] (-793.323) (-787.354) -- 0:00:26
587500 -- (-788.630) [-785.417] (-786.537) (-788.225) * (-787.957) [-787.714] (-786.091) (-786.300) -- 0:00:26
588000 -- (-785.988) [-786.102] (-788.110) (-786.439) * [-787.653] (-788.397) (-789.536) (-787.661) -- 0:00:26
588500 -- (-785.970) (-787.827) (-787.275) [-792.098] * (-788.904) (-787.547) [-786.316] (-786.745) -- 0:00:26
589000 -- [-785.838] (-785.908) (-787.894) (-788.966) * (-786.379) (-788.349) [-787.742] (-787.889) -- 0:00:26
589500 -- (-787.605) (-787.586) (-789.343) [-788.528] * (-787.021) (-788.359) [-787.811] (-787.482) -- 0:00:26
590000 -- [-787.192] (-786.221) (-788.722) (-797.293) * (-789.155) (-788.439) [-787.787] (-793.296) -- 0:00:26
Average standard deviation of split frequencies: 0.014976
590500 -- (-787.706) [-787.358] (-786.057) (-789.980) * [-788.440] (-789.830) (-789.231) (-790.726) -- 0:00:26
591000 -- (-786.672) (-788.992) (-787.047) [-789.367] * (-788.371) (-792.249) [-789.285] (-787.082) -- 0:00:26
591500 -- (-788.465) (-787.768) (-788.031) [-786.310] * (-792.269) (-788.660) [-788.460] (-786.872) -- 0:00:26
592000 -- (-787.242) (-786.264) (-788.387) [-786.956] * (-788.658) (-788.645) [-786.504] (-791.622) -- 0:00:26
592500 -- (-788.312) [-787.217] (-786.745) (-785.834) * (-787.604) (-789.554) [-788.234] (-789.598) -- 0:00:26
593000 -- (-786.639) [-785.118] (-787.532) (-789.282) * (-787.634) (-787.361) (-788.552) [-789.918] -- 0:00:26
593500 -- (-787.966) [-786.049] (-789.632) (-788.902) * (-787.034) (-789.676) (-791.510) [-787.843] -- 0:00:26
594000 -- (-788.054) (-786.834) (-789.041) [-788.867] * (-786.534) [-789.415] (-787.866) (-785.669) -- 0:00:25
594500 -- (-788.447) (-790.498) (-787.685) [-787.862] * (-789.341) (-788.007) [-788.227] (-788.978) -- 0:00:25
595000 -- (-788.773) [-787.487] (-787.773) (-786.969) * (-789.304) (-786.998) (-791.112) [-789.004] -- 0:00:25
Average standard deviation of split frequencies: 0.015473
595500 -- (-787.766) [-786.094] (-788.161) (-787.258) * (-789.731) [-787.879] (-794.389) (-787.584) -- 0:00:25
596000 -- (-786.888) [-787.332] (-786.192) (-788.296) * (-790.173) [-786.194] (-790.575) (-789.543) -- 0:00:25
596500 -- (-789.497) (-785.536) [-787.359] (-791.906) * (-793.782) (-786.804) [-789.752] (-786.843) -- 0:00:25
597000 -- (-785.303) [-785.478] (-786.729) (-789.514) * (-789.268) (-788.041) [-788.131] (-786.803) -- 0:00:25
597500 -- (-786.703) (-787.008) [-787.628] (-787.627) * (-787.247) [-789.349] (-788.134) (-786.687) -- 0:00:25
598000 -- (-786.711) (-786.258) [-786.517] (-786.558) * (-786.646) [-785.359] (-786.302) (-788.630) -- 0:00:25
598500 -- (-788.344) (-786.867) (-787.395) [-785.934] * (-785.671) [-787.639] (-786.330) (-787.624) -- 0:00:25
599000 -- (-789.127) (-790.160) [-788.395] (-788.837) * (-786.248) (-785.930) (-788.361) [-787.089] -- 0:00:25
599500 -- (-788.979) [-789.104] (-786.988) (-786.828) * [-785.956] (-786.127) (-786.627) (-787.200) -- 0:00:25
600000 -- (-789.276) (-790.526) [-787.019] (-789.114) * (-787.363) [-786.970] (-792.260) (-788.656) -- 0:00:25
Average standard deviation of split frequencies: 0.015696
600500 -- (-790.191) (-792.049) (-786.708) [-787.887] * [-787.152] (-788.818) (-788.775) (-787.215) -- 0:00:25
601000 -- [-787.048] (-792.126) (-789.434) (-787.332) * (-786.383) [-785.698] (-788.516) (-786.264) -- 0:00:25
601500 -- [-786.426] (-789.674) (-787.148) (-786.196) * (-787.308) (-786.369) (-788.902) [-786.967] -- 0:00:25
602000 -- (-785.856) [-787.954] (-786.468) (-787.018) * (-785.650) [-786.886] (-793.094) (-786.828) -- 0:00:25
602500 -- (-787.761) (-787.595) [-787.141] (-785.519) * (-786.121) [-786.282] (-787.194) (-787.914) -- 0:00:25
603000 -- [-786.409] (-785.887) (-786.209) (-789.377) * [-785.698] (-786.285) (-788.933) (-786.839) -- 0:00:25
603500 -- [-790.378] (-788.524) (-785.923) (-786.714) * (-789.449) [-785.608] (-789.241) (-790.475) -- 0:00:25
604000 -- [-786.514] (-786.871) (-786.781) (-788.056) * [-787.787] (-786.899) (-786.516) (-788.101) -- 0:00:25
604500 -- [-792.915] (-786.638) (-787.334) (-787.410) * [-789.251] (-790.508) (-786.909) (-790.695) -- 0:00:25
605000 -- (-786.033) [-788.300] (-789.640) (-788.122) * (-785.398) [-791.458] (-788.705) (-787.821) -- 0:00:25
Average standard deviation of split frequencies: 0.015471
605500 -- (-786.383) [-785.700] (-788.171) (-788.745) * [-787.998] (-789.602) (-788.388) (-786.301) -- 0:00:25
606000 -- (-786.863) (-788.413) [-788.160] (-788.925) * [-787.179] (-793.030) (-786.637) (-788.413) -- 0:00:25
606500 -- [-786.274] (-789.754) (-790.127) (-786.307) * (-788.356) [-786.446] (-787.040) (-785.563) -- 0:00:25
607000 -- (-785.903) [-790.084] (-787.340) (-788.396) * (-790.666) (-787.773) [-787.076] (-786.681) -- 0:00:25
607500 -- [-786.569] (-788.545) (-787.113) (-786.960) * (-785.230) [-790.178] (-788.930) (-785.397) -- 0:00:25
608000 -- (-789.167) (-787.316) [-788.978] (-789.358) * (-787.742) (-789.254) [-786.039] (-788.780) -- 0:00:25
608500 -- (-786.822) (-786.986) (-789.379) [-786.990] * (-785.145) (-788.773) [-786.510] (-792.536) -- 0:00:25
609000 -- (-787.298) [-786.836] (-790.211) (-786.905) * (-787.077) (-788.178) [-787.771] (-789.524) -- 0:00:25
609500 -- [-788.707] (-789.752) (-788.179) (-788.983) * (-785.563) [-789.114] (-792.564) (-788.606) -- 0:00:24
610000 -- [-786.961] (-787.724) (-786.385) (-787.856) * (-785.257) [-790.446] (-786.479) (-786.915) -- 0:00:24
Average standard deviation of split frequencies: 0.016166
610500 -- [-787.935] (-786.797) (-785.735) (-787.441) * (-785.801) [-785.943] (-786.666) (-786.809) -- 0:00:24
611000 -- (-788.374) (-789.862) [-786.324] (-786.162) * (-788.376) (-786.725) (-787.670) [-788.166] -- 0:00:24
611500 -- (-786.000) (-790.523) (-788.579) [-785.992] * [-793.593] (-786.838) (-788.683) (-787.525) -- 0:00:24
612000 -- (-786.094) (-790.230) [-786.200] (-786.238) * (-785.849) [-786.808] (-787.811) (-788.038) -- 0:00:24
612500 -- (-785.305) (-793.314) [-785.897] (-788.680) * (-786.280) (-788.938) [-786.811] (-788.188) -- 0:00:24
613000 -- (-788.007) (-786.126) [-786.930] (-788.260) * (-788.005) (-788.435) [-786.718] (-787.789) -- 0:00:24
613500 -- (-787.497) (-787.589) [-787.595] (-786.896) * [-789.730] (-788.268) (-787.218) (-790.524) -- 0:00:24
614000 -- (-787.135) [-788.272] (-786.019) (-786.632) * (-788.960) [-787.991] (-791.086) (-786.943) -- 0:00:24
614500 -- [-788.294] (-790.443) (-794.252) (-787.898) * [-787.429] (-788.893) (-789.960) (-788.784) -- 0:00:24
615000 -- (-789.029) (-787.388) [-787.085] (-789.533) * (-787.205) (-787.404) [-787.268] (-787.211) -- 0:00:24
Average standard deviation of split frequencies: 0.016206
615500 -- (-786.458) [-786.653] (-786.362) (-790.592) * (-786.335) (-788.569) (-786.314) [-789.004] -- 0:00:24
616000 -- (-786.351) (-787.359) [-786.267] (-785.733) * (-786.598) (-787.285) (-788.429) [-789.354] -- 0:00:24
616500 -- (-786.476) (-786.488) [-785.764] (-787.466) * (-787.516) [-785.657] (-786.323) (-787.717) -- 0:00:24
617000 -- [-785.782] (-786.093) (-786.836) (-787.763) * [-787.377] (-785.868) (-788.598) (-788.661) -- 0:00:24
617500 -- (-788.114) [-787.002] (-788.267) (-786.581) * (-787.354) (-787.822) (-787.315) [-793.643] -- 0:00:24
618000 -- [-786.099] (-787.177) (-786.223) (-788.387) * (-786.772) [-787.744] (-791.657) (-787.325) -- 0:00:24
618500 -- [-786.159] (-789.014) (-786.528) (-787.429) * (-790.374) (-786.786) [-785.800] (-790.428) -- 0:00:24
619000 -- [-787.993] (-790.437) (-791.327) (-787.095) * (-789.479) (-785.834) [-785.596] (-787.252) -- 0:00:24
619500 -- (-792.865) (-785.344) (-786.974) [-786.643] * (-790.069) (-786.599) [-790.528] (-787.075) -- 0:00:24
620000 -- [-789.617] (-792.039) (-785.971) (-790.669) * (-787.854) (-785.982) [-786.526] (-786.305) -- 0:00:24
Average standard deviation of split frequencies: 0.015646
620500 -- (-790.852) (-789.358) [-787.279] (-788.292) * (-785.549) [-786.821] (-786.906) (-786.140) -- 0:00:24
621000 -- (-787.260) (-789.237) (-786.485) [-788.087] * (-787.244) [-786.123] (-787.047) (-785.756) -- 0:00:24
621500 -- (-786.656) [-788.382] (-791.970) (-791.477) * (-785.674) (-791.088) [-786.782] (-787.992) -- 0:00:24
622000 -- (-786.149) (-787.076) [-786.231] (-790.154) * (-785.920) (-792.556) [-788.845] (-786.138) -- 0:00:24
622500 -- (-790.828) (-790.364) (-785.933) [-786.426] * (-787.507) (-791.626) [-788.177] (-788.955) -- 0:00:24
623000 -- (-790.971) (-789.030) (-785.789) [-787.435] * (-790.731) (-786.154) [-788.614] (-787.209) -- 0:00:24
623500 -- (-787.475) (-788.276) (-788.447) [-788.721] * (-788.261) (-786.285) [-787.022] (-787.401) -- 0:00:24
624000 -- [-787.208] (-788.070) (-787.265) (-788.189) * (-785.560) (-787.177) [-785.430] (-786.070) -- 0:00:24
624500 -- (-785.790) (-791.260) [-787.249] (-787.951) * (-785.371) (-786.084) [-787.268] (-789.214) -- 0:00:24
625000 -- (-787.368) (-790.301) [-786.764] (-786.486) * (-786.559) (-788.408) [-786.245] (-789.097) -- 0:00:24
Average standard deviation of split frequencies: 0.015202
625500 -- (-788.081) (-795.760) [-786.098] (-786.465) * (-785.966) (-786.252) [-786.281] (-785.962) -- 0:00:23
626000 -- (-788.302) (-787.607) [-785.666] (-786.633) * (-788.125) (-786.437) (-786.191) [-786.695] -- 0:00:23
626500 -- (-786.556) [-787.785] (-785.615) (-790.741) * [-790.077] (-787.973) (-785.536) (-789.307) -- 0:00:23
627000 -- [-786.087] (-786.886) (-785.186) (-786.508) * (-789.950) (-785.271) [-786.812] (-789.727) -- 0:00:23
627500 -- (-792.085) (-785.992) (-787.067) [-786.177] * (-788.270) (-786.570) (-789.358) [-790.981] -- 0:00:23
628000 -- (-790.855) [-785.228] (-787.884) (-787.204) * (-788.096) (-785.986) (-785.928) [-785.981] -- 0:00:23
628500 -- [-788.352] (-786.054) (-785.841) (-785.785) * (-789.071) [-788.568] (-786.341) (-785.881) -- 0:00:23
629000 -- (-785.810) [-785.465] (-785.633) (-785.565) * (-786.257) [-789.106] (-788.502) (-787.241) -- 0:00:23
629500 -- (-789.616) [-788.539] (-785.945) (-786.561) * [-790.137] (-786.712) (-788.214) (-785.817) -- 0:00:23
630000 -- (-787.700) (-787.361) [-788.581] (-785.905) * [-787.214] (-791.714) (-786.300) (-788.186) -- 0:00:23
Average standard deviation of split frequencies: 0.015463
630500 -- (-791.160) (-788.270) [-787.207] (-786.669) * [-789.955] (-786.774) (-786.662) (-789.385) -- 0:00:23
631000 -- (-788.350) [-786.317] (-787.368) (-789.146) * [-788.792] (-790.572) (-792.325) (-789.733) -- 0:00:23
631500 -- [-790.309] (-787.648) (-788.277) (-787.993) * (-786.251) [-790.227] (-787.797) (-787.101) -- 0:00:23
632000 -- [-787.371] (-793.920) (-790.664) (-790.735) * (-787.824) (-785.806) (-786.253) [-786.035] -- 0:00:23
632500 -- (-785.783) [-787.014] (-787.736) (-787.415) * (-787.236) [-786.425] (-785.124) (-791.530) -- 0:00:23
633000 -- [-786.647] (-790.565) (-789.957) (-788.218) * [-785.165] (-787.107) (-785.589) (-787.707) -- 0:00:23
633500 -- [-785.986] (-786.330) (-786.552) (-790.869) * (-785.166) [-788.800] (-786.028) (-787.928) -- 0:00:23
634000 -- [-786.142] (-785.901) (-789.106) (-797.455) * (-787.051) (-787.143) [-787.416] (-787.546) -- 0:00:23
634500 -- [-786.854] (-787.982) (-786.803) (-788.634) * (-788.117) (-785.726) [-788.406] (-788.523) -- 0:00:23
635000 -- [-786.665] (-786.501) (-787.482) (-786.985) * (-788.691) (-786.432) (-788.767) [-786.660] -- 0:00:23
Average standard deviation of split frequencies: 0.015022
635500 -- (-787.024) (-785.792) [-786.323] (-787.150) * (-788.118) [-786.127] (-787.177) (-787.566) -- 0:00:23
636000 -- [-789.131] (-786.368) (-791.148) (-787.372) * (-789.141) [-786.796] (-787.747) (-790.765) -- 0:00:23
636500 -- (-786.883) [-787.233] (-786.191) (-786.416) * (-790.488) [-786.844] (-788.550) (-788.805) -- 0:00:23
637000 -- (-787.588) [-787.885] (-786.441) (-786.268) * (-787.993) (-787.110) (-787.768) [-787.978] -- 0:00:23
637500 -- (-787.589) [-787.696] (-789.506) (-786.959) * [-787.304] (-792.762) (-788.677) (-786.479) -- 0:00:23
638000 -- [-787.325] (-786.572) (-786.533) (-789.568) * (-789.002) (-787.656) [-787.223] (-788.344) -- 0:00:23
638500 -- (-790.634) (-788.520) (-788.230) [-788.231] * [-788.103] (-786.045) (-789.488) (-790.559) -- 0:00:23
639000 -- (-789.760) [-786.066] (-787.496) (-787.142) * [-786.632] (-788.758) (-791.567) (-790.741) -- 0:00:23
639500 -- [-786.164] (-788.078) (-791.779) (-785.687) * [-786.156] (-786.301) (-791.173) (-792.391) -- 0:00:23
640000 -- (-787.272) (-789.717) (-788.010) [-785.750] * [-786.435] (-790.459) (-786.713) (-786.319) -- 0:00:23
Average standard deviation of split frequencies: 0.015599
640500 -- (-789.254) (-791.365) (-787.139) [-787.747] * (-785.910) (-786.067) [-787.477] (-788.114) -- 0:00:23
641000 -- (-786.908) (-789.413) (-787.068) [-786.580] * (-790.551) [-785.923] (-789.869) (-787.769) -- 0:00:22
641500 -- [-785.200] (-788.560) (-786.579) (-788.877) * (-789.192) (-785.636) [-785.566] (-788.372) -- 0:00:22
642000 -- (-785.869) (-785.619) [-788.076] (-788.234) * (-786.171) [-789.656] (-787.664) (-787.301) -- 0:00:22
642500 -- [-786.415] (-785.936) (-788.182) (-786.740) * (-787.136) (-786.024) [-788.034] (-785.551) -- 0:00:22
643000 -- [-786.356] (-791.312) (-789.420) (-786.348) * (-792.242) (-785.784) (-789.117) [-788.654] -- 0:00:22
643500 -- (-785.725) [-790.879] (-789.298) (-787.825) * (-790.511) [-785.490] (-786.249) (-785.986) -- 0:00:22
644000 -- [-786.062] (-790.527) (-787.776) (-786.668) * (-788.110) [-789.924] (-790.102) (-787.437) -- 0:00:22
644500 -- (-788.026) (-788.530) [-786.407] (-786.220) * (-786.461) (-788.002) (-786.713) [-789.038] -- 0:00:22
645000 -- [-786.631] (-796.772) (-790.507) (-785.550) * (-789.729) [-785.590] (-787.089) (-790.668) -- 0:00:22
Average standard deviation of split frequencies: 0.015461
645500 -- (-787.236) (-789.035) [-787.150] (-785.717) * [-790.170] (-786.774) (-786.285) (-789.465) -- 0:00:22
646000 -- [-791.539] (-792.118) (-787.514) (-786.790) * (-786.934) [-785.836] (-786.270) (-789.401) -- 0:00:22
646500 -- (-786.702) (-786.879) [-788.355] (-787.042) * [-787.274] (-791.887) (-786.407) (-787.585) -- 0:00:22
647000 -- (-786.767) (-789.389) (-786.735) [-786.600] * [-786.895] (-789.467) (-788.721) (-790.330) -- 0:00:22
647500 -- (-786.640) (-789.253) (-787.661) [-786.784] * [-787.912] (-786.361) (-786.384) (-794.727) -- 0:00:22
648000 -- (-787.767) (-789.718) [-785.768] (-787.386) * [-787.633] (-786.296) (-787.867) (-787.520) -- 0:00:22
648500 -- (-786.933) (-791.416) [-786.214] (-785.752) * (-791.336) [-790.777] (-787.548) (-786.028) -- 0:00:22
649000 -- (-786.806) (-786.109) [-787.450] (-787.284) * (-787.269) [-788.403] (-788.069) (-786.517) -- 0:00:22
649500 -- (-786.440) (-786.125) (-786.042) [-787.713] * (-787.145) (-789.964) [-786.422] (-786.102) -- 0:00:22
650000 -- (-786.428) (-785.952) (-786.229) [-786.203] * (-788.634) (-788.148) (-787.297) [-785.827] -- 0:00:22
Average standard deviation of split frequencies: 0.015172
650500 -- (-788.192) (-791.524) [-786.120] (-786.450) * (-786.179) (-788.965) (-786.714) [-785.841] -- 0:00:22
651000 -- [-785.846] (-789.857) (-785.982) (-788.019) * [-785.267] (-793.076) (-789.602) (-786.034) -- 0:00:22
651500 -- (-789.400) (-785.547) [-787.112] (-786.614) * [-786.531] (-790.725) (-786.602) (-786.615) -- 0:00:22
652000 -- (-789.347) (-792.199) (-789.754) [-786.383] * [-785.693] (-787.395) (-788.057) (-786.508) -- 0:00:22
652500 -- (-786.614) [-789.930] (-790.224) (-789.281) * (-786.101) (-787.437) (-789.774) [-785.910] -- 0:00:22
653000 -- (-786.265) [-789.048] (-789.259) (-785.965) * (-785.780) (-789.426) [-788.022] (-786.577) -- 0:00:22
653500 -- (-787.553) [-786.249] (-787.537) (-785.944) * (-785.824) (-790.043) (-788.015) [-786.470] -- 0:00:22
654000 -- (-787.688) [-785.806] (-791.347) (-785.710) * (-794.006) (-785.722) (-788.922) [-788.214] -- 0:00:22
654500 -- (-787.504) [-788.517] (-787.168) (-789.974) * [-785.741] (-785.356) (-789.168) (-787.726) -- 0:00:22
655000 -- (-792.758) (-789.779) (-787.079) [-790.476] * (-785.844) (-791.016) (-787.228) [-785.157] -- 0:00:22
Average standard deviation of split frequencies: 0.015175
655500 -- (-787.285) [-794.101] (-786.220) (-787.910) * [-785.331] (-792.292) (-787.078) (-787.470) -- 0:00:22
656000 -- (-789.491) [-789.055] (-790.109) (-789.624) * [-786.872] (-789.551) (-786.826) (-787.431) -- 0:00:22
656500 -- (-788.313) (-787.234) [-789.262] (-786.929) * (-790.611) (-787.368) [-786.661] (-786.363) -- 0:00:21
657000 -- (-786.159) (-786.318) (-788.775) [-787.941] * (-785.937) (-787.666) (-786.834) [-786.794] -- 0:00:21
657500 -- (-786.633) (-786.738) [-785.864] (-788.908) * (-788.711) [-787.466] (-790.428) (-788.212) -- 0:00:21
658000 -- (-785.712) (-786.938) [-785.929] (-787.534) * [-787.021] (-786.409) (-786.499) (-788.367) -- 0:00:21
658500 -- (-790.590) (-785.827) [-786.366] (-789.192) * (-786.167) (-786.685) [-787.429] (-790.411) -- 0:00:21
659000 -- (-791.568) (-785.454) [-786.198] (-787.055) * [-786.602] (-787.220) (-788.382) (-794.472) -- 0:00:21
659500 -- (-791.764) [-786.494] (-785.711) (-787.651) * (-786.864) (-789.041) [-788.631] (-786.731) -- 0:00:21
660000 -- (-788.668) (-786.007) [-786.375] (-791.306) * [-789.167] (-793.442) (-788.441) (-787.904) -- 0:00:21
Average standard deviation of split frequencies: 0.015446
660500 -- (-785.994) [-786.982] (-787.296) (-793.344) * (-791.808) (-786.267) (-789.309) [-788.421] -- 0:00:21
661000 -- [-786.510] (-787.893) (-787.123) (-788.375) * (-787.863) [-787.478] (-790.665) (-790.692) -- 0:00:21
661500 -- (-787.660) (-789.318) [-790.953] (-786.212) * (-788.909) (-789.973) (-786.606) [-790.416] -- 0:00:21
662000 -- [-787.635] (-785.584) (-787.946) (-789.815) * (-786.675) (-787.250) [-786.415] (-786.310) -- 0:00:21
662500 -- (-786.214) (-786.241) (-789.760) [-790.150] * (-788.654) (-786.785) (-787.372) [-785.825] -- 0:00:21
663000 -- (-790.049) [-786.893] (-786.873) (-787.672) * (-788.642) [-786.538] (-786.077) (-787.057) -- 0:00:21
663500 -- (-785.316) [-786.410] (-785.675) (-788.258) * (-787.695) (-787.262) [-787.405] (-789.570) -- 0:00:21
664000 -- [-786.792] (-786.292) (-791.559) (-785.915) * (-787.182) (-787.523) (-785.839) [-788.016] -- 0:00:21
664500 -- [-786.930] (-790.040) (-786.152) (-785.765) * [-794.119] (-789.887) (-787.035) (-787.040) -- 0:00:21
665000 -- (-786.729) [-788.079] (-786.821) (-787.038) * (-790.574) (-790.262) [-789.236] (-786.957) -- 0:00:21
Average standard deviation of split frequencies: 0.014781
665500 -- (-787.527) (-787.931) [-787.041] (-787.304) * (-785.820) [-790.552] (-787.258) (-785.935) -- 0:00:21
666000 -- (-791.178) (-788.471) (-787.281) [-786.178] * [-788.064] (-789.888) (-786.305) (-788.030) -- 0:00:21
666500 -- (-788.999) (-787.997) (-786.868) [-785.987] * (-787.100) [-787.712] (-787.396) (-786.883) -- 0:00:21
667000 -- [-786.622] (-788.504) (-786.927) (-788.425) * (-793.124) [-787.457] (-785.887) (-789.617) -- 0:00:20
667500 -- (-785.269) (-786.995) (-786.875) [-787.697] * (-789.817) (-786.233) (-786.177) [-788.304] -- 0:00:21
668000 -- [-785.245] (-788.174) (-785.998) (-792.612) * (-791.446) (-786.935) (-787.999) [-787.417] -- 0:00:21
668500 -- [-785.775] (-788.148) (-785.755) (-788.503) * (-793.449) [-787.020] (-787.662) (-786.730) -- 0:00:21
669000 -- (-785.746) (-787.842) (-787.417) [-786.641] * (-793.492) [-789.426] (-787.926) (-786.303) -- 0:00:21
669500 -- (-785.863) (-786.279) (-786.462) [-785.664] * (-789.583) (-790.742) [-786.838] (-787.004) -- 0:00:21
670000 -- (-791.336) [-786.749] (-785.985) (-786.104) * (-789.568) (-787.885) [-790.084] (-789.984) -- 0:00:21
Average standard deviation of split frequencies: 0.014058
670500 -- (-786.789) (-786.300) (-791.236) [-787.952] * (-789.948) [-787.199] (-788.977) (-786.642) -- 0:00:21
671000 -- (-785.963) (-785.507) [-788.893] (-787.717) * (-786.102) [-785.332] (-785.877) (-786.559) -- 0:00:21
671500 -- (-787.082) (-787.273) [-786.575] (-788.484) * [-787.807] (-786.488) (-785.909) (-787.773) -- 0:00:21
672000 -- (-786.408) (-786.495) (-789.246) [-792.288] * (-789.018) (-788.357) (-786.443) [-787.993] -- 0:00:20
672500 -- (-786.790) (-787.587) [-788.600] (-786.166) * [-785.535] (-786.710) (-787.624) (-790.391) -- 0:00:20
673000 -- (-787.942) (-787.687) [-787.459] (-785.904) * [-786.410] (-787.650) (-787.238) (-789.181) -- 0:00:20
673500 -- (-788.648) (-788.542) (-785.991) [-789.554] * (-786.696) (-786.930) (-787.744) [-787.385] -- 0:00:20
674000 -- [-788.371] (-792.693) (-787.202) (-787.431) * [-786.484] (-788.486) (-785.985) (-791.425) -- 0:00:20
674500 -- (-788.737) (-788.547) (-788.670) [-787.146] * (-790.347) (-789.233) (-788.501) [-786.075] -- 0:00:20
675000 -- (-787.119) [-789.011] (-787.445) (-788.232) * (-789.160) (-786.222) [-786.041] (-786.707) -- 0:00:20
Average standard deviation of split frequencies: 0.014165
675500 -- (-787.719) (-788.738) [-787.092] (-787.260) * (-785.822) [-787.010] (-786.619) (-788.665) -- 0:00:20
676000 -- [-786.372] (-791.725) (-786.204) (-785.751) * (-786.951) [-787.325] (-787.727) (-785.626) -- 0:00:20
676500 -- (-788.228) (-787.038) (-789.112) [-788.504] * (-787.239) [-787.342] (-786.259) (-785.665) -- 0:00:20
677000 -- (-786.771) [-787.238] (-788.997) (-788.309) * (-786.569) (-786.632) [-787.085] (-787.713) -- 0:00:20
677500 -- (-788.699) (-788.467) [-786.069] (-787.122) * (-791.886) (-786.561) [-789.467] (-787.674) -- 0:00:20
678000 -- (-792.895) [-785.339] (-786.247) (-786.116) * [-785.939] (-786.402) (-791.246) (-786.497) -- 0:00:20
678500 -- (-790.775) (-786.054) (-788.428) [-787.869] * (-786.373) [-786.929] (-788.561) (-785.870) -- 0:00:20
679000 -- [-788.174] (-789.368) (-786.776) (-789.393) * [-786.828] (-787.652) (-786.125) (-785.673) -- 0:00:20
679500 -- (-786.946) (-788.325) [-785.792] (-789.707) * (-786.460) (-788.658) [-786.422] (-785.990) -- 0:00:20
680000 -- [-788.041] (-786.723) (-789.436) (-791.030) * [-787.334] (-787.485) (-785.186) (-791.123) -- 0:00:20
Average standard deviation of split frequencies: 0.014055
680500 -- (-787.683) [-786.018] (-785.993) (-788.650) * (-791.019) (-787.415) (-787.993) [-787.050] -- 0:00:20
681000 -- (-791.054) [-785.811] (-788.290) (-790.727) * (-789.902) (-789.424) (-785.820) [-789.122] -- 0:00:20
681500 -- [-786.573] (-787.046) (-786.786) (-789.342) * [-786.894] (-785.567) (-788.266) (-787.913) -- 0:00:20
682000 -- (-786.614) (-787.565) (-785.938) [-786.813] * (-787.310) (-786.561) (-788.688) [-787.295] -- 0:00:20
682500 -- (-786.741) [-786.612] (-790.871) (-790.919) * [-789.097] (-788.077) (-787.868) (-788.181) -- 0:00:20
683000 -- (-789.346) [-789.137] (-786.650) (-789.773) * (-787.198) (-786.674) (-787.385) [-787.125] -- 0:00:19
683500 -- (-786.427) (-788.033) (-788.417) [-786.797] * (-786.292) [-785.659] (-789.280) (-789.939) -- 0:00:20
684000 -- (-789.682) [-788.322] (-788.548) (-789.012) * (-787.238) (-788.261) [-786.303] (-787.173) -- 0:00:20
684500 -- (-788.565) [-785.463] (-789.371) (-790.800) * (-787.470) [-785.753] (-790.009) (-785.844) -- 0:00:20
685000 -- [-786.161] (-790.368) (-789.732) (-786.931) * (-787.219) (-787.597) (-787.027) [-785.976] -- 0:00:20
Average standard deviation of split frequencies: 0.014067
685500 -- (-787.853) [-785.975] (-788.065) (-786.181) * (-785.690) (-787.258) (-787.625) [-786.290] -- 0:00:20
686000 -- (-787.519) (-788.077) [-785.771] (-794.772) * (-786.508) (-787.377) [-788.989] (-786.247) -- 0:00:20
686500 -- [-788.155] (-787.917) (-788.333) (-791.366) * [-786.181] (-787.550) (-786.782) (-788.189) -- 0:00:20
687000 -- (-789.820) [-787.176] (-788.503) (-785.429) * [-787.846] (-787.746) (-791.194) (-787.315) -- 0:00:20
687500 -- (-785.869) (-786.198) (-786.056) [-787.189] * [-786.517] (-787.071) (-789.242) (-787.724) -- 0:00:20
688000 -- (-786.923) [-787.170] (-790.182) (-786.632) * (-790.219) (-786.902) [-785.781] (-787.832) -- 0:00:19
688500 -- (-788.985) (-786.992) (-790.909) [-786.885] * [-790.824] (-790.431) (-785.601) (-785.761) -- 0:00:19
689000 -- (-786.664) (-786.969) (-789.524) [-787.893] * (-790.313) [-786.813] (-786.590) (-786.471) -- 0:00:19
689500 -- (-790.677) (-791.009) (-786.944) [-787.573] * [-788.647] (-785.463) (-786.938) (-787.428) -- 0:00:19
690000 -- (-787.705) (-787.946) [-787.283] (-787.305) * [-787.882] (-785.462) (-787.172) (-789.579) -- 0:00:19
Average standard deviation of split frequencies: 0.014291
690500 -- (-789.475) [-785.520] (-787.608) (-788.386) * (-787.385) (-786.226) [-789.198] (-788.826) -- 0:00:19
691000 -- (-788.258) [-787.032] (-787.199) (-792.142) * (-788.707) [-785.608] (-789.174) (-787.825) -- 0:00:19
691500 -- (-788.558) (-785.944) [-787.443] (-793.482) * (-793.397) [-790.805] (-787.607) (-787.515) -- 0:00:19
692000 -- [-789.800] (-786.118) (-787.458) (-788.717) * (-792.724) (-786.919) (-788.087) [-787.339] -- 0:00:19
692500 -- (-791.443) (-787.730) (-786.060) [-786.522] * (-789.126) [-787.344] (-786.980) (-787.143) -- 0:00:19
693000 -- [-790.220] (-785.155) (-789.313) (-787.897) * (-786.318) (-790.517) (-789.493) [-786.492] -- 0:00:19
693500 -- [-788.209] (-785.971) (-786.543) (-786.581) * [-787.298] (-788.914) (-792.157) (-786.500) -- 0:00:19
694000 -- (-787.648) (-787.036) (-788.389) [-786.802] * [-785.713] (-788.811) (-789.236) (-787.222) -- 0:00:19
694500 -- (-787.682) [-786.969] (-789.592) (-788.889) * [-785.444] (-786.772) (-785.974) (-788.169) -- 0:00:19
695000 -- (-787.409) (-788.779) (-791.415) [-791.195] * (-786.381) (-787.086) (-789.868) [-786.949] -- 0:00:19
Average standard deviation of split frequencies: 0.013800
695500 -- (-786.600) (-788.731) (-789.373) [-787.072] * (-786.098) (-788.126) [-786.296] (-786.289) -- 0:00:19
696000 -- (-786.949) [-785.857] (-787.573) (-786.272) * (-786.493) (-787.381) [-793.529] (-788.518) -- 0:00:19
696500 -- (-789.679) (-785.926) (-786.684) [-788.222] * (-787.966) [-787.138] (-786.365) (-789.007) -- 0:00:19
697000 -- (-789.436) (-791.228) (-786.173) [-786.487] * [-788.247] (-785.621) (-786.666) (-789.688) -- 0:00:19
697500 -- [-791.534] (-787.852) (-790.714) (-791.231) * (-791.667) [-786.325] (-786.763) (-788.061) -- 0:00:19
698000 -- [-787.497] (-787.466) (-786.397) (-788.083) * (-788.923) (-789.208) (-790.530) [-787.260] -- 0:00:19
698500 -- [-786.951] (-787.501) (-786.036) (-789.459) * (-789.806) [-789.651] (-787.112) (-786.094) -- 0:00:18
699000 -- [-787.320] (-788.600) (-789.411) (-788.839) * (-788.196) (-788.061) [-788.017] (-786.606) -- 0:00:18
699500 -- (-787.171) (-789.291) (-787.805) [-786.715] * [-789.045] (-787.625) (-787.393) (-794.436) -- 0:00:18
700000 -- (-786.948) (-789.389) (-785.960) [-788.028] * (-787.874) (-785.927) [-786.964] (-801.246) -- 0:00:19
Average standard deviation of split frequencies: 0.014089
700500 -- (-790.360) (-787.099) (-787.995) [-786.166] * (-787.149) (-786.405) (-786.486) [-787.091] -- 0:00:19
701000 -- [-786.845] (-786.945) (-789.907) (-787.713) * (-785.719) (-788.532) [-786.655] (-787.693) -- 0:00:19
701500 -- [-788.238] (-786.241) (-788.245) (-786.435) * (-786.328) (-788.572) (-790.928) [-786.956] -- 0:00:19
702000 -- (-787.478) (-789.244) [-786.486] (-787.810) * (-786.872) (-788.176) (-791.548) [-786.055] -- 0:00:19
702500 -- (-789.820) [-787.763] (-787.525) (-787.615) * [-786.078] (-789.473) (-789.247) (-787.564) -- 0:00:19
703000 -- (-785.638) [-789.204] (-785.444) (-787.898) * (-785.421) (-794.266) [-785.789] (-786.677) -- 0:00:19
703500 -- (-787.609) (-785.828) [-788.160] (-791.154) * (-789.798) (-793.141) [-787.661] (-787.247) -- 0:00:18
704000 -- [-785.380] (-787.859) (-789.825) (-788.474) * (-787.074) (-793.045) [-786.242] (-787.063) -- 0:00:18
704500 -- (-785.871) (-787.738) [-789.703] (-787.667) * [-788.233] (-788.475) (-786.241) (-786.917) -- 0:00:18
705000 -- (-790.467) (-788.879) (-789.997) [-789.899] * (-788.559) (-786.569) [-787.024] (-787.628) -- 0:00:18
Average standard deviation of split frequencies: 0.013668
705500 -- (-788.215) (-787.627) (-790.390) [-786.691] * (-786.404) [-786.652] (-789.162) (-786.557) -- 0:00:18
706000 -- [-786.989] (-790.705) (-787.474) (-785.891) * (-787.143) (-792.188) (-787.128) [-785.602] -- 0:00:18
706500 -- [-788.099] (-786.200) (-787.621) (-789.168) * (-786.422) (-786.788) [-787.040] (-788.345) -- 0:00:18
707000 -- [-787.104] (-790.250) (-786.468) (-786.734) * [-787.079] (-789.207) (-790.000) (-787.941) -- 0:00:18
707500 -- [-786.955] (-786.384) (-787.667) (-789.451) * (-785.886) [-786.485] (-788.604) (-786.079) -- 0:00:18
708000 -- [-793.302] (-787.821) (-786.555) (-785.475) * [-788.931] (-786.341) (-787.187) (-787.329) -- 0:00:18
708500 -- (-786.561) [-788.943] (-788.846) (-787.320) * [-786.744] (-787.550) (-788.348) (-787.239) -- 0:00:18
709000 -- (-786.475) (-787.781) (-787.379) [-786.350] * (-790.032) [-789.798] (-787.080) (-785.864) -- 0:00:18
709500 -- [-788.409] (-790.465) (-788.695) (-787.115) * (-789.083) [-785.791] (-787.283) (-788.347) -- 0:00:18
710000 -- [-789.121] (-786.456) (-786.923) (-789.807) * [-786.089] (-786.734) (-786.078) (-787.273) -- 0:00:18
Average standard deviation of split frequencies: 0.013306
710500 -- (-792.765) [-786.361] (-786.424) (-789.025) * (-785.542) [-786.030] (-786.955) (-786.899) -- 0:00:18
711000 -- (-789.353) (-787.925) (-792.213) [-787.279] * (-786.656) [-785.767] (-787.263) (-789.522) -- 0:00:18
711500 -- (-786.072) (-785.478) (-789.122) [-786.669] * (-790.835) (-785.999) (-787.231) [-786.013] -- 0:00:18
712000 -- [-786.751] (-785.750) (-789.406) (-787.777) * (-793.253) [-785.889] (-788.260) (-788.184) -- 0:00:18
712500 -- [-788.935] (-786.064) (-786.735) (-788.839) * [-786.468] (-786.956) (-788.551) (-787.209) -- 0:00:18
713000 -- (-787.788) (-785.663) (-786.237) [-785.916] * (-785.378) (-787.315) (-788.150) [-787.312] -- 0:00:18
713500 -- (-791.651) (-786.898) [-788.278] (-786.501) * (-788.753) [-789.433] (-788.053) (-786.113) -- 0:00:18
714000 -- (-794.368) [-785.420] (-785.908) (-787.160) * (-787.276) (-789.200) (-788.544) [-787.671] -- 0:00:18
714500 -- (-786.481) [-786.367] (-786.286) (-785.526) * [-786.497] (-789.200) (-790.404) (-792.528) -- 0:00:17
715000 -- (-786.876) [-785.836] (-786.222) (-791.008) * [-786.916] (-788.002) (-787.909) (-789.757) -- 0:00:17
Average standard deviation of split frequencies: 0.013361
715500 -- (-786.337) [-785.837] (-786.507) (-789.390) * [-786.507] (-788.060) (-786.467) (-787.487) -- 0:00:17
716000 -- (-790.435) [-790.541] (-787.674) (-786.396) * [-787.783] (-787.237) (-787.825) (-787.896) -- 0:00:17
716500 -- (-790.794) (-789.845) [-786.929] (-786.265) * (-789.549) [-787.075] (-787.442) (-787.123) -- 0:00:18
717000 -- (-787.460) (-788.451) [-785.743] (-786.956) * (-789.563) (-794.089) [-792.545] (-789.005) -- 0:00:18
717500 -- (-791.994) (-787.991) (-786.100) [-786.716] * (-787.925) [-794.139] (-787.810) (-788.968) -- 0:00:18
718000 -- (-788.523) (-786.530) (-786.090) [-786.568] * [-786.360] (-788.724) (-786.907) (-789.883) -- 0:00:18
718500 -- [-786.608] (-787.427) (-792.069) (-786.165) * [-786.945] (-789.668) (-788.127) (-786.333) -- 0:00:18
719000 -- [-786.189] (-785.969) (-787.312) (-788.421) * (-788.269) (-791.411) (-787.927) [-788.201] -- 0:00:17
719500 -- (-786.786) (-787.408) (-788.064) [-790.534] * (-787.622) (-789.901) (-787.137) [-788.476] -- 0:00:17
720000 -- (-789.317) (-788.358) (-790.905) [-788.921] * [-788.324] (-789.575) (-789.159) (-786.753) -- 0:00:17
Average standard deviation of split frequencies: 0.013121
720500 -- [-787.869] (-790.500) (-789.906) (-786.567) * (-790.077) (-787.177) [-788.211] (-785.773) -- 0:00:17
721000 -- (-785.910) (-794.336) (-790.072) [-787.785] * (-790.051) [-787.487] (-785.929) (-785.600) -- 0:00:17
721500 -- [-786.170] (-787.757) (-786.205) (-785.773) * (-787.119) (-786.150) (-785.670) [-787.220] -- 0:00:17
722000 -- (-787.798) (-789.005) (-786.886) [-786.324] * (-790.426) (-789.139) [-787.880] (-789.350) -- 0:00:17
722500 -- (-790.364) (-787.736) (-788.950) [-787.184] * (-788.624) (-787.157) [-787.246] (-788.270) -- 0:00:17
723000 -- (-788.909) (-789.255) [-788.174] (-787.915) * (-787.992) (-791.958) (-791.344) [-786.514] -- 0:00:17
723500 -- (-791.905) (-787.413) [-789.372] (-786.884) * (-787.010) (-785.367) (-785.936) [-787.687] -- 0:00:17
724000 -- [-789.798] (-786.814) (-786.871) (-786.553) * [-786.896] (-786.899) (-791.801) (-790.063) -- 0:00:17
724500 -- (-785.357) [-786.037] (-793.599) (-785.920) * (-788.121) [-785.448] (-785.740) (-786.022) -- 0:00:17
725000 -- (-785.342) (-786.839) (-788.748) [-786.360] * (-787.458) (-787.997) [-785.897] (-786.163) -- 0:00:17
Average standard deviation of split frequencies: 0.013292
725500 -- (-788.099) (-786.748) (-786.229) [-788.100] * (-788.684) [-791.826] (-787.805) (-786.318) -- 0:00:17
726000 -- (-789.898) (-787.242) (-786.872) [-787.725] * (-788.919) (-791.100) (-789.085) [-789.113] -- 0:00:17
726500 -- (-788.737) [-788.411] (-785.304) (-791.426) * (-788.193) (-792.522) [-788.959] (-788.662) -- 0:00:17
727000 -- [-788.786] (-788.280) (-787.438) (-787.683) * [-786.344] (-785.173) (-787.466) (-791.736) -- 0:00:17
727500 -- (-785.736) (-787.462) [-792.095] (-785.440) * (-786.248) (-786.166) (-787.152) [-786.583] -- 0:00:17
728000 -- (-786.263) (-787.674) [-790.106] (-786.240) * (-786.387) (-789.380) (-786.560) [-787.306] -- 0:00:17
728500 -- [-785.302] (-787.443) (-788.605) (-786.056) * (-786.522) [-788.730] (-787.072) (-786.689) -- 0:00:17
729000 -- (-787.151) (-789.037) [-788.732] (-786.280) * (-788.089) (-786.622) [-786.066] (-787.833) -- 0:00:17
729500 -- (-789.146) (-788.373) (-788.008) [-786.048] * (-786.570) (-787.781) (-789.137) [-785.763] -- 0:00:17
730000 -- (-788.246) (-788.041) [-787.304] (-785.490) * (-785.986) (-788.386) [-789.751] (-787.615) -- 0:00:17
Average standard deviation of split frequencies: 0.013511
730500 -- [-788.892] (-786.393) (-789.740) (-785.234) * (-791.110) (-786.852) [-788.727] (-787.864) -- 0:00:16
731000 -- (-787.016) [-785.688] (-790.110) (-786.667) * (-786.146) [-786.288] (-788.716) (-789.398) -- 0:00:16
731500 -- (-787.392) (-785.897) [-788.307] (-790.155) * (-786.910) [-787.920] (-786.566) (-788.658) -- 0:00:16
732000 -- [-786.890] (-788.032) (-786.817) (-785.897) * (-790.851) (-788.106) [-786.631] (-787.507) -- 0:00:16
732500 -- [-785.962] (-789.945) (-786.112) (-786.423) * (-786.565) (-786.873) (-788.758) [-786.843] -- 0:00:16
733000 -- [-787.102] (-788.290) (-787.439) (-788.771) * (-787.332) (-787.724) [-794.572] (-786.703) -- 0:00:17
733500 -- (-786.315) [-787.043] (-786.959) (-789.415) * (-789.534) [-788.423] (-787.295) (-787.292) -- 0:00:17
734000 -- [-787.732] (-786.288) (-787.045) (-789.154) * (-790.358) [-788.142] (-789.023) (-785.707) -- 0:00:17
734500 -- (-785.925) [-787.111] (-788.908) (-788.087) * (-787.446) (-787.527) (-788.862) [-786.591] -- 0:00:16
735000 -- (-790.765) (-788.182) (-786.604) [-786.867] * (-791.774) (-787.103) [-788.213] (-791.027) -- 0:00:16
Average standard deviation of split frequencies: 0.013337
735500 -- (-786.230) (-787.360) (-787.497) [-786.299] * (-793.773) [-787.762] (-787.004) (-791.832) -- 0:00:16
736000 -- [-789.558] (-789.809) (-789.953) (-785.634) * (-794.614) (-788.095) [-786.728] (-789.595) -- 0:00:16
736500 -- (-789.235) (-788.402) (-786.134) [-785.230] * (-789.480) (-788.071) (-785.751) [-789.150] -- 0:00:16
737000 -- (-789.338) [-786.958] (-787.586) (-785.511) * (-791.979) (-790.755) (-786.872) [-787.468] -- 0:00:16
737500 -- (-792.419) (-787.106) [-789.452] (-785.946) * [-786.501] (-788.777) (-785.465) (-786.049) -- 0:00:16
738000 -- [-787.012] (-788.463) (-789.853) (-786.091) * [-787.952] (-788.317) (-787.387) (-788.942) -- 0:00:16
738500 -- [-785.974] (-788.604) (-787.569) (-790.782) * (-789.438) (-787.935) (-789.589) [-787.690] -- 0:00:16
739000 -- (-787.015) (-788.346) [-788.233] (-788.274) * [-789.497] (-790.215) (-791.164) (-792.259) -- 0:00:16
739500 -- [-788.014] (-792.517) (-787.263) (-791.217) * (-788.914) [-790.880] (-788.939) (-789.606) -- 0:00:16
740000 -- (-789.802) (-787.811) [-785.849] (-789.951) * (-786.966) [-792.734] (-790.360) (-789.032) -- 0:00:16
Average standard deviation of split frequencies: 0.013478
740500 -- (-790.219) (-794.048) [-786.404] (-788.494) * (-791.193) (-795.066) (-787.789) [-785.822] -- 0:00:16
741000 -- (-786.560) (-787.004) [-786.884] (-791.411) * (-791.920) [-787.987] (-786.499) (-786.724) -- 0:00:16
741500 -- (-787.272) (-787.510) [-788.945] (-785.471) * (-788.913) [-788.776] (-786.806) (-789.763) -- 0:00:16
742000 -- (-789.076) (-789.303) (-787.830) [-786.963] * (-787.286) [-786.390] (-788.605) (-787.676) -- 0:00:16
742500 -- [-789.275] (-790.085) (-786.080) (-790.808) * (-785.792) (-787.862) (-788.816) [-786.190] -- 0:00:16
743000 -- (-789.159) (-787.884) [-787.644] (-789.761) * [-787.175] (-791.285) (-787.199) (-787.111) -- 0:00:16
743500 -- (-787.205) [-786.060] (-786.766) (-787.423) * (-791.695) (-786.278) (-788.661) [-789.651] -- 0:00:16
744000 -- (-786.650) [-787.293] (-788.466) (-785.759) * [-789.411] (-791.341) (-792.565) (-790.820) -- 0:00:16
744500 -- (-787.298) [-785.973] (-789.154) (-789.937) * (-787.874) [-788.891] (-794.853) (-789.659) -- 0:00:16
745000 -- (-785.804) (-786.204) [-786.235] (-788.423) * [-787.070] (-785.801) (-794.907) (-787.271) -- 0:00:16
Average standard deviation of split frequencies: 0.012861
745500 -- [-786.116] (-787.923) (-787.032) (-786.665) * (-791.696) (-786.527) (-790.241) [-786.666] -- 0:00:16
746000 -- (-786.132) (-790.005) [-788.553] (-787.755) * (-786.303) (-786.047) (-787.383) [-789.052] -- 0:00:16
746500 -- (-788.646) (-791.683) (-790.218) [-789.951] * (-786.677) [-788.911] (-785.886) (-786.530) -- 0:00:15
747000 -- (-787.861) (-787.345) [-788.839] (-786.241) * (-786.202) (-790.846) (-786.419) [-786.641] -- 0:00:15
747500 -- (-786.231) (-791.437) (-791.127) [-785.941] * [-786.393] (-789.439) (-786.506) (-787.374) -- 0:00:15
748000 -- (-786.133) [-789.587] (-787.269) (-789.486) * (-788.926) [-788.167] (-786.248) (-786.586) -- 0:00:15
748500 -- (-785.635) (-788.965) [-788.333] (-790.321) * (-787.218) (-788.434) (-788.735) [-787.444] -- 0:00:15
749000 -- [-787.249] (-788.554) (-789.012) (-791.525) * [-787.964] (-787.470) (-789.425) (-790.148) -- 0:00:15
749500 -- (-786.541) [-787.913] (-785.843) (-795.173) * (-786.570) (-786.309) (-794.761) [-785.542] -- 0:00:16
750000 -- [-788.443] (-785.800) (-786.792) (-789.398) * (-786.589) (-786.050) [-791.482] (-788.122) -- 0:00:16
Average standard deviation of split frequencies: 0.012523
750500 -- (-789.726) (-789.475) (-786.721) [-790.844] * [-789.478] (-792.431) (-790.431) (-787.395) -- 0:00:15
751000 -- [-788.655] (-790.442) (-788.739) (-785.738) * [-787.476] (-796.748) (-787.559) (-787.485) -- 0:00:15
751500 -- [-791.209] (-788.146) (-789.371) (-785.772) * (-788.035) (-793.344) (-786.538) [-785.594] -- 0:00:15
752000 -- (-786.653) (-786.366) (-788.544) [-789.838] * (-786.937) [-789.873] (-787.844) (-785.647) -- 0:00:15
752500 -- (-794.028) [-789.608] (-786.760) (-789.790) * (-787.697) (-791.976) [-787.074] (-786.512) -- 0:00:15
753000 -- [-787.787] (-788.496) (-786.889) (-789.428) * (-789.115) (-787.645) (-786.562) [-787.091] -- 0:00:15
753500 -- (-788.864) (-788.496) [-787.670] (-785.139) * [-788.611] (-790.005) (-787.892) (-788.405) -- 0:00:15
754000 -- (-789.595) (-787.578) (-793.464) [-787.515] * (-787.901) (-789.828) (-787.664) [-787.065] -- 0:00:15
754500 -- (-788.840) (-787.232) (-791.480) [-788.993] * [-785.381] (-787.581) (-787.449) (-789.992) -- 0:00:15
755000 -- (-786.614) (-785.835) [-788.881] (-788.672) * (-787.082) (-789.093) (-791.468) [-788.370] -- 0:00:15
Average standard deviation of split frequencies: 0.012361
755500 -- (-791.088) (-786.668) [-787.249] (-790.036) * (-785.607) [-788.952] (-790.057) (-786.679) -- 0:00:15
756000 -- (-786.095) (-789.142) (-789.828) [-788.421] * (-786.861) [-786.803] (-789.845) (-786.592) -- 0:00:15
756500 -- (-789.509) (-787.976) [-787.062] (-788.889) * (-787.805) [-787.225] (-787.293) (-787.856) -- 0:00:15
757000 -- (-787.017) [-785.377] (-787.147) (-789.932) * (-788.748) [-785.622] (-787.067) (-787.951) -- 0:00:15
757500 -- (-787.733) [-786.650] (-786.624) (-789.779) * (-786.877) (-786.728) (-785.979) [-785.763] -- 0:00:15
758000 -- (-788.736) (-785.924) [-785.515] (-787.962) * (-790.896) (-787.142) (-787.313) [-785.807] -- 0:00:15
758500 -- [-788.034] (-787.420) (-791.100) (-786.680) * [-787.049] (-786.975) (-792.548) (-786.865) -- 0:00:15
759000 -- (-788.817) (-786.696) [-786.976] (-789.948) * (-786.922) (-787.563) (-787.441) [-787.220] -- 0:00:15
759500 -- (-788.388) (-790.110) [-786.096] (-786.872) * (-786.582) (-789.043) (-787.075) [-788.762] -- 0:00:15
760000 -- (-788.640) (-785.784) (-789.048) [-785.907] * (-787.762) [-787.082] (-788.676) (-787.223) -- 0:00:15
Average standard deviation of split frequencies: 0.012162
760500 -- (-787.900) (-785.865) [-786.492] (-787.341) * (-786.682) [-786.784] (-787.629) (-786.815) -- 0:00:15
761000 -- (-787.805) (-792.838) [-785.591] (-789.874) * (-788.439) (-786.060) [-786.253] (-789.025) -- 0:00:15
761500 -- (-787.847) [-788.605] (-786.919) (-786.635) * (-787.230) [-787.939] (-789.199) (-787.161) -- 0:00:15
762000 -- (-786.958) [-786.835] (-786.120) (-786.156) * (-787.696) (-790.459) [-785.400] (-788.468) -- 0:00:14
762500 -- (-786.776) (-786.483) (-789.441) [-786.549] * (-790.550) (-788.876) [-786.998] (-785.870) -- 0:00:14
763000 -- (-787.159) (-789.822) [-786.753] (-789.829) * (-785.939) [-788.162] (-792.542) (-787.979) -- 0:00:14
763500 -- [-788.173] (-787.953) (-788.672) (-787.378) * (-788.549) (-787.572) (-788.011) [-788.720] -- 0:00:14
764000 -- (-787.696) [-786.926] (-786.647) (-787.014) * (-785.690) [-791.544] (-787.157) (-788.922) -- 0:00:14
764500 -- (-793.043) (-786.381) [-787.231] (-786.266) * [-788.022] (-788.208) (-787.023) (-790.955) -- 0:00:14
765000 -- [-785.561] (-788.137) (-786.849) (-785.924) * (-786.190) (-786.955) [-786.557] (-790.278) -- 0:00:14
Average standard deviation of split frequencies: 0.011657
765500 -- (-786.843) (-786.551) [-788.214] (-789.176) * [-786.345] (-787.412) (-788.621) (-788.829) -- 0:00:14
766000 -- (-785.749) (-789.223) (-791.766) [-787.344] * (-788.094) (-791.514) (-786.494) [-787.306] -- 0:00:14
766500 -- (-789.422) [-787.853] (-787.495) (-789.026) * [-786.719] (-787.835) (-786.326) (-787.822) -- 0:00:14
767000 -- (-793.620) (-787.225) [-786.829] (-789.656) * (-786.320) (-787.225) (-786.606) [-788.430] -- 0:00:14
767500 -- (-790.953) [-788.558] (-790.133) (-790.460) * (-787.488) [-786.884] (-786.805) (-791.056) -- 0:00:14
768000 -- (-789.800) (-788.097) [-786.546] (-791.869) * (-787.029) (-790.348) [-787.811] (-788.985) -- 0:00:14
768500 -- (-787.286) (-788.656) (-786.624) [-786.828] * [-786.387] (-788.432) (-789.402) (-786.942) -- 0:00:14
769000 -- [-786.862] (-785.923) (-787.259) (-786.823) * (-786.333) (-788.598) [-788.002] (-787.111) -- 0:00:14
769500 -- [-787.085] (-786.399) (-785.818) (-786.618) * (-787.069) [-785.483] (-787.870) (-787.868) -- 0:00:14
770000 -- (-790.137) (-785.558) [-786.145] (-787.665) * (-787.698) (-789.782) [-791.044] (-787.567) -- 0:00:14
Average standard deviation of split frequencies: 0.011514
770500 -- [-789.810] (-785.335) (-787.162) (-789.671) * (-788.857) [-787.184] (-790.320) (-786.873) -- 0:00:14
771000 -- (-787.253) [-786.379] (-789.164) (-790.733) * (-790.405) [-786.045] (-787.946) (-786.894) -- 0:00:14
771500 -- (-786.986) [-786.099] (-786.670) (-794.750) * (-787.536) (-786.792) [-786.572] (-787.238) -- 0:00:14
772000 -- [-787.794] (-786.847) (-788.954) (-786.760) * (-786.050) (-786.636) [-786.095] (-786.428) -- 0:00:14
772500 -- (-787.205) (-786.721) (-789.166) [-787.039] * [-786.719] (-787.214) (-787.335) (-785.644) -- 0:00:14
773000 -- (-786.855) (-787.219) [-787.473] (-788.699) * [-786.225] (-791.862) (-788.276) (-789.946) -- 0:00:14
773500 -- [-788.791] (-788.093) (-787.187) (-787.585) * (-787.563) (-789.294) [-789.658] (-789.843) -- 0:00:14
774000 -- (-790.263) (-794.251) [-787.908] (-786.291) * (-788.524) (-791.002) [-785.482] (-790.466) -- 0:00:14
774500 -- (-786.096) (-788.836) (-786.020) [-786.604] * (-787.794) (-788.544) [-785.902] (-793.316) -- 0:00:14
775000 -- (-787.703) (-787.215) [-792.508] (-786.620) * (-787.775) [-787.794] (-786.946) (-788.640) -- 0:00:14
Average standard deviation of split frequencies: 0.011757
775500 -- [-789.227] (-786.530) (-788.497) (-786.410) * (-796.869) (-785.744) [-788.276] (-790.055) -- 0:00:14
776000 -- (-788.796) (-793.539) [-788.315] (-786.843) * (-788.047) [-788.905] (-788.223) (-786.745) -- 0:00:14
776500 -- [-787.810] (-786.929) (-787.720) (-787.480) * [-786.790] (-790.609) (-785.994) (-786.928) -- 0:00:14
777000 -- (-790.776) (-786.082) [-787.956] (-787.892) * (-788.067) [-787.003] (-785.531) (-786.720) -- 0:00:14
777500 -- (-786.857) (-787.051) (-788.665) [-787.328] * (-792.101) (-786.909) [-785.452] (-790.533) -- 0:00:14
778000 -- [-786.247] (-790.504) (-789.156) (-788.794) * (-793.579) (-786.109) [-787.540] (-786.972) -- 0:00:13
778500 -- (-786.419) [-785.997] (-788.741) (-786.708) * (-787.991) (-788.602) [-787.176] (-786.281) -- 0:00:13
779000 -- (-786.469) [-790.021] (-792.529) (-787.818) * [-790.361] (-788.055) (-788.001) (-788.478) -- 0:00:13
779500 -- [-786.277] (-793.030) (-794.217) (-786.483) * (-789.549) (-787.762) [-787.258] (-787.320) -- 0:00:13
780000 -- (-786.884) (-786.541) (-792.846) [-788.045] * [-787.370] (-788.614) (-788.681) (-791.863) -- 0:00:13
Average standard deviation of split frequencies: 0.011549
780500 -- (-789.821) (-789.174) (-787.665) [-788.608] * [-786.922] (-788.730) (-789.148) (-793.341) -- 0:00:13
781000 -- (-788.053) [-787.266] (-787.490) (-791.102) * [-791.255] (-789.789) (-787.428) (-788.413) -- 0:00:13
781500 -- (-787.038) (-787.755) [-786.200] (-785.864) * [-788.268] (-787.121) (-789.958) (-785.740) -- 0:00:13
782000 -- [-785.957] (-785.234) (-786.048) (-786.751) * [-788.197] (-787.809) (-788.522) (-786.635) -- 0:00:13
782500 -- (-788.677) (-787.539) [-787.268] (-788.377) * (-787.906) [-786.875] (-785.468) (-791.449) -- 0:00:13
783000 -- (-786.497) (-785.312) (-789.870) [-787.721] * (-787.731) (-787.675) [-785.475] (-789.552) -- 0:00:13
783500 -- [-787.320] (-789.150) (-787.964) (-786.980) * (-787.836) (-788.502) [-786.361] (-787.848) -- 0:00:13
784000 -- (-788.347) [-788.223] (-787.265) (-786.839) * [-788.484] (-787.087) (-787.052) (-785.441) -- 0:00:13
784500 -- (-786.668) (-785.535) (-786.189) [-790.151] * (-791.727) (-785.434) (-789.009) [-787.148] -- 0:00:13
785000 -- (-787.567) (-786.078) (-786.877) [-788.669] * [-787.865] (-786.378) (-786.276) (-785.687) -- 0:00:13
Average standard deviation of split frequencies: 0.011195
785500 -- (-787.661) [-785.287] (-786.135) (-786.539) * (-786.931) [-786.762] (-787.571) (-785.885) -- 0:00:13
786000 -- (-786.657) [-785.274] (-787.118) (-786.895) * [-787.635] (-786.622) (-785.851) (-787.158) -- 0:00:13
786500 -- (-788.012) (-787.912) (-787.943) [-786.338] * (-787.766) (-786.429) [-785.151] (-789.401) -- 0:00:13
787000 -- (-786.472) [-786.539] (-785.731) (-788.591) * (-791.729) [-787.901] (-785.407) (-789.885) -- 0:00:13
787500 -- (-786.472) (-786.792) (-788.894) [-785.793] * (-790.192) (-787.944) [-786.618] (-791.929) -- 0:00:13
788000 -- (-785.775) [-788.576] (-786.171) (-788.834) * [-787.969] (-789.658) (-785.936) (-786.338) -- 0:00:13
788500 -- (-786.390) (-791.452) (-787.204) [-786.968] * (-789.213) (-789.662) [-787.840] (-787.975) -- 0:00:13
789000 -- (-787.458) (-788.836) (-787.677) [-786.876] * (-789.650) (-787.209) (-788.564) [-790.065] -- 0:00:13
789500 -- (-786.770) (-794.578) [-790.743] (-787.088) * (-789.200) (-786.630) (-788.925) [-788.085] -- 0:00:13
790000 -- (-788.728) (-788.443) (-787.357) [-788.632] * (-786.611) (-786.276) [-787.813] (-787.954) -- 0:00:13
Average standard deviation of split frequencies: 0.010592
790500 -- (-791.435) (-791.979) [-787.366] (-787.209) * [-787.943] (-786.277) (-788.990) (-786.547) -- 0:00:13
791000 -- (-788.887) [-789.859] (-788.919) (-787.551) * (-786.928) (-792.396) [-787.031] (-787.274) -- 0:00:13
791500 -- (-789.589) (-785.712) [-787.169] (-789.170) * (-791.516) (-792.770) [-787.422] (-787.812) -- 0:00:13
792000 -- (-785.862) (-787.388) [-787.819] (-790.208) * (-787.471) (-790.024) (-785.844) [-788.177] -- 0:00:13
792500 -- [-786.237] (-790.759) (-786.874) (-786.154) * (-785.954) (-789.031) [-789.978] (-785.528) -- 0:00:13
793000 -- [-787.852] (-787.434) (-787.862) (-785.555) * (-791.310) [-785.956] (-789.076) (-785.466) -- 0:00:13
793500 -- [-786.488] (-787.258) (-790.771) (-787.245) * (-786.194) (-787.411) (-789.330) [-790.489] -- 0:00:13
794000 -- [-790.003] (-787.919) (-786.492) (-787.420) * (-791.178) (-786.770) (-787.612) [-786.635] -- 0:00:12
794500 -- (-790.853) [-787.263] (-788.404) (-787.557) * (-788.888) (-788.738) (-789.122) [-786.963] -- 0:00:12
795000 -- (-787.220) (-785.996) [-785.228] (-787.685) * (-788.194) (-789.903) (-787.628) [-785.961] -- 0:00:12
Average standard deviation of split frequencies: 0.011148
795500 -- (-787.048) [-785.441] (-788.784) (-787.827) * (-790.583) (-791.059) [-794.558] (-786.770) -- 0:00:12
796000 -- [-787.839] (-788.409) (-786.849) (-789.978) * (-790.509) [-787.856] (-788.098) (-786.286) -- 0:00:12
796500 -- (-786.512) (-787.058) [-785.949] (-786.322) * (-789.715) (-787.272) (-787.109) [-786.009] -- 0:00:12
797000 -- (-787.670) (-788.055) (-788.907) [-787.607] * (-787.437) (-786.068) (-786.817) [-786.078] -- 0:00:12
797500 -- [-785.634] (-788.755) (-790.839) (-786.783) * [-788.651] (-786.833) (-786.767) (-785.843) -- 0:00:12
798000 -- (-787.262) (-788.733) (-787.330) [-785.796] * (-787.049) (-787.694) [-791.003] (-787.284) -- 0:00:12
798500 -- [-786.307] (-785.558) (-791.418) (-786.624) * (-786.447) [-785.705] (-790.368) (-788.821) -- 0:00:12
799000 -- (-787.520) [-785.601] (-795.999) (-787.125) * (-787.181) (-785.709) (-787.015) [-787.109] -- 0:00:12
799500 -- (-788.682) (-786.103) (-789.169) [-786.951] * (-790.185) (-786.954) (-791.989) [-792.998] -- 0:00:12
800000 -- (-790.108) (-791.998) (-787.480) [-787.042] * (-791.474) (-786.948) [-788.463] (-786.201) -- 0:00:12
Average standard deviation of split frequencies: 0.011221
800500 -- (-786.613) (-787.020) (-789.640) [-786.522] * [-785.594] (-787.573) (-788.416) (-786.297) -- 0:00:12
801000 -- [-787.153] (-787.049) (-786.389) (-787.148) * (-785.359) [-788.091] (-788.152) (-786.912) -- 0:00:12
801500 -- (-787.440) [-786.469] (-786.582) (-789.438) * (-786.367) [-787.463] (-789.318) (-788.568) -- 0:00:12
802000 -- (-788.556) (-786.021) (-786.834) [-788.248] * (-787.141) (-788.022) (-786.710) [-788.432] -- 0:00:12
802500 -- [-789.718] (-788.182) (-787.215) (-786.333) * (-787.051) [-787.581] (-786.872) (-789.051) -- 0:00:12
803000 -- (-788.097) (-792.910) (-787.531) [-786.932] * [-785.627] (-789.847) (-787.779) (-788.796) -- 0:00:12
803500 -- (-789.839) [-786.991] (-790.442) (-787.957) * [-789.991] (-785.610) (-785.335) (-788.378) -- 0:00:12
804000 -- (-789.182) (-792.662) (-787.000) [-786.690] * (-786.653) (-786.048) [-786.078] (-787.344) -- 0:00:12
804500 -- (-789.936) (-787.242) [-792.823] (-785.949) * [-786.829] (-795.049) (-785.558) (-786.870) -- 0:00:12
805000 -- (-788.058) (-787.210) (-787.479) [-786.831] * (-785.479) [-786.781] (-785.965) (-786.949) -- 0:00:12
Average standard deviation of split frequencies: 0.010803
805500 -- [-786.550] (-786.827) (-788.099) (-786.039) * (-785.656) (-786.205) [-786.102] (-788.797) -- 0:00:12
806000 -- (-788.763) (-786.419) [-789.045] (-786.886) * [-785.784] (-788.426) (-785.966) (-788.006) -- 0:00:12
806500 -- (-794.171) (-787.051) (-787.263) [-787.302] * [-787.453] (-787.004) (-787.111) (-787.758) -- 0:00:12
807000 -- (-788.652) (-788.131) (-788.775) [-793.664] * [-788.125] (-785.403) (-787.342) (-789.004) -- 0:00:12
807500 -- (-789.318) (-785.810) (-787.250) [-791.204] * (-791.268) (-791.382) [-788.065] (-791.458) -- 0:00:12
808000 -- (-786.853) [-787.282] (-789.203) (-786.785) * [-786.746] (-786.157) (-787.534) (-787.754) -- 0:00:12
808500 -- (-789.144) (-787.650) (-790.903) [-787.665] * (-790.439) (-786.165) [-788.865] (-785.371) -- 0:00:12
809000 -- (-786.189) (-787.041) (-786.618) [-785.886] * [-786.661] (-786.671) (-789.804) (-786.544) -- 0:00:12
809500 -- (-787.204) (-786.120) [-786.059] (-790.147) * [-787.617] (-786.567) (-791.546) (-786.959) -- 0:00:12
810000 -- (-786.785) (-790.273) [-787.650] (-786.907) * [-792.682] (-787.194) (-789.459) (-785.342) -- 0:00:11
Average standard deviation of split frequencies: 0.010706
810500 -- (-789.174) [-785.848] (-786.271) (-787.763) * (-788.400) (-788.057) (-786.026) [-785.884] -- 0:00:11
811000 -- (-786.672) [-788.004] (-789.181) (-785.593) * (-788.025) (-787.085) (-785.825) [-787.129] -- 0:00:11
811500 -- (-788.718) (-789.344) (-789.853) [-788.518] * (-786.213) (-788.602) [-785.325] (-787.745) -- 0:00:11
812000 -- (-788.487) (-789.088) [-788.192] (-788.511) * [-787.431] (-787.191) (-785.641) (-789.247) -- 0:00:11
812500 -- (-786.618) (-790.674) (-787.147) [-788.981] * (-790.222) [-788.628] (-788.415) (-789.047) -- 0:00:11
813000 -- [-789.468] (-787.277) (-787.996) (-788.863) * [-790.959] (-788.600) (-789.222) (-790.953) -- 0:00:11
813500 -- (-787.866) [-790.156] (-789.584) (-790.280) * (-789.860) [-787.761] (-791.107) (-787.553) -- 0:00:11
814000 -- (-791.398) [-786.137] (-789.146) (-787.395) * (-785.337) [-786.630] (-790.998) (-786.435) -- 0:00:11
814500 -- (-787.383) (-785.529) [-788.118] (-792.524) * (-787.606) (-786.144) (-791.680) [-787.626] -- 0:00:11
815000 -- (-789.998) (-787.573) (-788.213) [-785.913] * (-789.833) (-789.271) [-785.824] (-786.142) -- 0:00:11
Average standard deviation of split frequencies: 0.010218
815500 -- (-787.852) (-788.072) [-789.278] (-785.404) * (-791.250) [-788.548] (-787.241) (-789.116) -- 0:00:11
816000 -- (-785.943) [-790.343] (-787.783) (-786.280) * (-796.363) (-788.669) [-789.308] (-788.084) -- 0:00:11
816500 -- (-787.012) [-785.757] (-785.396) (-791.085) * [-789.139] (-789.072) (-786.976) (-786.733) -- 0:00:11
817000 -- [-792.238] (-786.879) (-790.880) (-789.886) * (-793.008) [-786.856] (-788.424) (-787.846) -- 0:00:11
817500 -- [-787.785] (-788.224) (-786.474) (-787.659) * (-786.054) (-789.795) (-786.462) [-786.087] -- 0:00:11
818000 -- [-787.107] (-787.239) (-786.903) (-786.806) * [-787.004] (-787.418) (-786.001) (-786.817) -- 0:00:11
818500 -- (-793.469) [-788.620] (-786.375) (-786.398) * (-786.975) (-789.292) [-786.570] (-786.015) -- 0:00:11
819000 -- [-792.336] (-787.781) (-785.544) (-787.789) * (-787.797) [-786.812] (-787.587) (-787.401) -- 0:00:11
819500 -- (-790.785) (-785.906) [-785.494] (-786.075) * (-787.476) [-786.350] (-788.920) (-786.568) -- 0:00:11
820000 -- [-787.437] (-788.812) (-786.442) (-791.544) * (-786.634) [-788.490] (-790.297) (-785.761) -- 0:00:11
Average standard deviation of split frequencies: 0.009837
820500 -- (-786.885) (-788.081) [-787.934] (-789.947) * (-786.429) [-786.286] (-787.282) (-788.520) -- 0:00:11
821000 -- (-785.788) (-790.337) [-785.083] (-788.338) * (-786.903) (-788.397) (-786.495) [-787.255] -- 0:00:11
821500 -- (-785.937) [-788.945] (-786.060) (-787.594) * (-785.644) [-786.585] (-787.811) (-786.341) -- 0:00:11
822000 -- (-786.659) (-788.940) (-787.584) [-787.046] * (-787.934) (-788.640) [-789.027] (-789.021) -- 0:00:11
822500 -- [-785.900] (-785.817) (-787.436) (-786.349) * (-786.566) (-787.353) (-787.577) [-785.853] -- 0:00:11
823000 -- [-785.986] (-786.295) (-786.280) (-786.271) * (-785.739) (-790.621) [-787.600] (-785.381) -- 0:00:11
823500 -- [-786.661] (-786.603) (-786.022) (-787.125) * (-785.739) (-790.202) (-791.878) [-791.489] -- 0:00:11
824000 -- (-787.819) (-786.517) (-786.257) [-786.609] * (-791.195) [-786.993] (-786.629) (-791.132) -- 0:00:11
824500 -- (-789.866) (-791.181) (-786.620) [-786.540] * (-786.588) [-789.121] (-788.764) (-793.766) -- 0:00:11
825000 -- (-791.930) [-785.784] (-787.590) (-786.656) * (-790.872) [-786.843] (-788.921) (-788.896) -- 0:00:11
Average standard deviation of split frequencies: 0.009809
825500 -- [-791.050] (-785.823) (-789.428) (-786.094) * [-797.024] (-787.770) (-790.194) (-787.990) -- 0:00:10
826000 -- (-787.366) (-786.165) (-795.561) [-787.941] * (-797.597) (-788.650) [-788.492] (-787.715) -- 0:00:10
826500 -- (-785.785) (-788.511) [-789.615] (-786.922) * (-786.307) (-788.966) [-785.775] (-790.785) -- 0:00:10
827000 -- (-786.007) (-787.737) [-786.713] (-787.066) * (-786.816) (-787.292) (-786.298) [-788.085] -- 0:00:10
827500 -- [-786.939] (-786.823) (-792.376) (-786.820) * (-786.893) [-786.796] (-790.528) (-791.502) -- 0:00:10
828000 -- (-787.983) (-789.558) [-790.949] (-787.865) * (-787.364) [-789.227] (-789.025) (-792.106) -- 0:00:10
828500 -- (-785.832) (-792.731) (-792.157) [-788.454] * (-789.873) (-788.971) (-786.509) [-788.789] -- 0:00:10
829000 -- (-786.599) [-789.051] (-788.201) (-786.382) * (-786.538) (-786.742) [-787.906] (-788.300) -- 0:00:10
829500 -- (-791.056) [-787.442] (-786.402) (-788.317) * (-788.022) [-790.903] (-785.448) (-790.412) -- 0:00:10
830000 -- [-787.389] (-790.446) (-785.838) (-792.246) * (-787.514) (-788.086) (-785.115) [-787.439] -- 0:00:10
Average standard deviation of split frequencies: 0.009186
830500 -- [-786.446] (-786.079) (-786.536) (-786.338) * [-790.674] (-787.088) (-786.154) (-786.405) -- 0:00:10
831000 -- (-789.959) [-785.740] (-785.332) (-787.014) * (-787.593) (-789.487) [-787.648] (-786.551) -- 0:00:10
831500 -- (-793.223) (-787.080) (-785.317) [-787.386] * (-788.384) [-786.605] (-785.807) (-788.299) -- 0:00:10
832000 -- (-789.384) [-786.020] (-789.319) (-786.651) * (-786.934) (-786.093) [-785.807] (-787.124) -- 0:00:10
832500 -- (-789.378) (-788.138) (-787.223) [-787.742] * (-786.023) [-785.514] (-786.673) (-788.390) -- 0:00:10
833000 -- (-785.849) (-785.639) [-786.826] (-790.353) * (-787.577) (-788.617) [-786.212] (-786.760) -- 0:00:10
833500 -- (-794.839) (-787.795) (-788.144) [-790.154] * [-786.606] (-785.250) (-788.631) (-786.922) -- 0:00:10
834000 -- (-792.671) [-785.940] (-786.008) (-795.576) * (-787.440) (-787.943) [-787.123] (-787.275) -- 0:00:10
834500 -- (-791.464) [-785.286] (-786.543) (-794.293) * (-785.926) (-786.080) (-785.987) [-786.218] -- 0:00:10
835000 -- (-790.088) (-785.089) (-787.866) [-786.119] * (-786.017) [-786.529] (-791.189) (-788.949) -- 0:00:10
Average standard deviation of split frequencies: 0.009022
835500 -- (-787.293) (-786.720) (-791.198) [-785.436] * (-788.027) (-786.934) (-788.038) [-788.079] -- 0:00:10
836000 -- (-789.355) (-785.954) [-790.552] (-789.038) * (-788.670) (-789.668) [-786.807] (-788.435) -- 0:00:10
836500 -- [-786.691] (-787.001) (-791.376) (-785.865) * (-795.121) [-786.837] (-786.770) (-789.156) -- 0:00:10
837000 -- (-791.778) (-787.722) [-795.114] (-785.470) * (-789.854) (-788.434) [-787.010] (-791.794) -- 0:00:10
837500 -- [-790.863] (-789.426) (-785.722) (-786.326) * (-791.923) (-789.623) (-787.086) [-787.932] -- 0:00:10
838000 -- [-787.328] (-790.577) (-786.371) (-785.873) * (-789.321) [-791.980] (-785.770) (-786.804) -- 0:00:10
838500 -- (-790.307) (-787.690) [-788.611] (-788.348) * (-790.429) (-787.969) [-785.935] (-785.455) -- 0:00:10
839000 -- (-787.630) (-788.256) [-785.796] (-786.851) * (-787.310) [-786.603] (-788.243) (-786.089) -- 0:00:10
839500 -- (-785.831) (-788.184) [-787.304] (-790.278) * (-786.447) (-791.072) [-786.689] (-786.454) -- 0:00:10
840000 -- (-785.495) [-788.737] (-787.669) (-788.995) * (-786.652) (-788.387) [-788.344] (-786.567) -- 0:00:10
Average standard deviation of split frequencies: 0.008341
840500 -- (-786.677) [-789.630] (-786.397) (-790.153) * (-785.360) [-788.439] (-786.791) (-786.989) -- 0:00:10
841000 -- (-791.825) [-791.369] (-788.778) (-789.806) * [-786.416] (-789.314) (-786.424) (-786.385) -- 0:00:10
841500 -- (-793.486) (-788.465) [-789.934] (-786.844) * (-793.136) [-790.794] (-786.950) (-786.294) -- 0:00:09
842000 -- (-788.208) (-788.541) (-790.530) [-787.295] * (-788.640) [-788.027] (-786.520) (-786.875) -- 0:00:09
842500 -- [-786.878] (-787.041) (-790.058) (-792.817) * (-788.855) (-786.986) (-786.347) [-789.566] -- 0:00:09
843000 -- (-787.513) (-790.765) [-788.127] (-786.169) * (-788.112) (-786.113) [-786.009] (-785.487) -- 0:00:09
843500 -- (-789.198) (-788.467) (-790.381) [-786.901] * (-786.151) (-787.213) [-785.587] (-785.703) -- 0:00:09
844000 -- (-786.181) [-787.745] (-789.936) (-787.747) * (-787.754) [-787.574] (-785.641) (-791.537) -- 0:00:09
844500 -- (-788.120) (-787.412) (-788.568) [-789.646] * [-786.738] (-785.761) (-786.903) (-791.215) -- 0:00:09
845000 -- (-789.864) (-788.930) (-785.918) [-786.613] * [-786.095] (-785.071) (-788.866) (-791.700) -- 0:00:09
Average standard deviation of split frequencies: 0.008532
845500 -- (-787.833) (-787.593) (-785.918) [-787.943] * (-785.588) [-788.634] (-788.500) (-787.991) -- 0:00:09
846000 -- (-787.436) [-789.286] (-787.664) (-792.973) * (-792.288) [-787.724] (-789.974) (-786.238) -- 0:00:09
846500 -- [-787.017] (-786.657) (-786.629) (-789.868) * [-787.605] (-790.264) (-789.370) (-787.197) -- 0:00:09
847000 -- (-786.500) (-787.918) [-786.925] (-785.567) * (-787.536) (-787.413) [-786.970] (-787.658) -- 0:00:09
847500 -- [-786.631] (-787.191) (-786.469) (-798.326) * [-786.355] (-786.378) (-785.970) (-785.707) -- 0:00:09
848000 -- (-785.696) (-790.036) [-787.125] (-791.394) * (-786.280) [-785.552] (-787.249) (-787.717) -- 0:00:09
848500 -- (-789.790) (-787.343) [-788.155] (-789.173) * (-788.740) (-787.374) (-788.045) [-786.724] -- 0:00:09
849000 -- (-789.302) [-787.582] (-790.221) (-790.232) * (-788.903) [-788.828] (-785.849) (-787.062) -- 0:00:09
849500 -- [-788.868] (-791.219) (-790.133) (-788.970) * [-787.425] (-786.840) (-786.125) (-786.283) -- 0:00:09
850000 -- (-791.300) (-787.414) [-785.273] (-788.461) * (-788.742) [-787.782] (-787.479) (-789.176) -- 0:00:09
Average standard deviation of split frequencies: 0.008638
850500 -- (-789.517) [-785.992] (-785.815) (-787.678) * (-788.757) [-785.963] (-786.800) (-787.514) -- 0:00:09
851000 -- [-786.145] (-787.325) (-786.195) (-786.459) * (-787.639) [-786.501] (-786.355) (-788.074) -- 0:00:09
851500 -- (-789.688) (-785.423) (-787.660) [-787.154] * (-785.285) [-785.700] (-786.134) (-792.815) -- 0:00:09
852000 -- [-788.777] (-786.425) (-790.920) (-788.782) * [-785.310] (-786.367) (-787.502) (-789.313) -- 0:00:09
852500 -- [-786.644] (-785.949) (-787.972) (-790.469) * (-787.646) (-787.307) (-787.340) [-788.301] -- 0:00:09
853000 -- [-786.813] (-786.029) (-786.692) (-789.369) * (-787.597) (-787.142) [-786.616] (-788.049) -- 0:00:09
853500 -- (-785.701) [-786.909] (-787.864) (-786.648) * [-788.642] (-786.176) (-786.692) (-787.723) -- 0:00:09
854000 -- (-791.006) (-788.397) (-787.800) [-785.929] * (-791.463) [-786.027] (-790.798) (-786.750) -- 0:00:09
854500 -- (-790.317) (-787.469) (-788.435) [-790.606] * (-785.885) (-786.095) [-788.189] (-790.297) -- 0:00:09
855000 -- [-787.740] (-789.324) (-787.173) (-788.038) * (-790.318) [-785.907] (-786.329) (-790.933) -- 0:00:09
Average standard deviation of split frequencies: 0.008701
855500 -- (-791.846) (-790.122) (-787.537) [-791.435] * (-789.384) [-786.116] (-786.668) (-788.521) -- 0:00:09
856000 -- (-785.744) [-788.831] (-786.754) (-785.426) * (-790.414) (-788.200) [-788.324] (-787.416) -- 0:00:09
856500 -- [-785.390] (-787.919) (-788.388) (-787.450) * (-789.267) [-785.941] (-786.700) (-788.594) -- 0:00:09
857000 -- (-787.958) (-790.688) (-787.156) [-786.414] * (-788.460) (-787.731) (-786.086) [-788.933] -- 0:00:09
857500 -- (-789.651) (-788.569) (-788.013) [-789.253] * (-787.869) (-785.614) [-786.783] (-788.569) -- 0:00:08
858000 -- [-787.140] (-787.522) (-787.382) (-786.303) * (-785.931) (-786.251) [-788.110] (-785.557) -- 0:00:08
858500 -- (-787.050) (-789.312) (-791.767) [-790.183] * (-787.070) [-787.554] (-787.400) (-789.702) -- 0:00:08
859000 -- [-788.390] (-787.084) (-785.823) (-787.088) * (-786.596) [-786.821] (-787.509) (-789.349) -- 0:00:08
859500 -- (-785.607) (-786.976) (-787.165) [-786.576] * (-787.830) [-786.646] (-787.299) (-786.917) -- 0:00:08
860000 -- (-786.626) (-785.724) [-787.321] (-787.839) * (-786.701) [-785.695] (-788.731) (-789.162) -- 0:00:08
Average standard deviation of split frequencies: 0.008800
860500 -- (-785.859) [-789.994] (-791.862) (-789.619) * (-787.974) (-788.631) (-788.190) [-787.363] -- 0:00:08
861000 -- (-789.929) [-786.121] (-792.303) (-787.588) * (-792.138) [-787.952] (-785.184) (-786.734) -- 0:00:08
861500 -- [-789.602] (-789.184) (-786.388) (-786.759) * (-787.385) (-785.988) [-785.184] (-787.365) -- 0:00:08
862000 -- [-788.564] (-786.076) (-792.544) (-787.069) * [-787.317] (-785.984) (-785.500) (-787.317) -- 0:00:08
862500 -- [-785.898] (-787.236) (-789.300) (-787.123) * (-786.084) (-786.258) (-785.979) [-788.381] -- 0:00:08
863000 -- (-786.575) (-787.386) [-785.938] (-788.454) * (-788.460) [-789.517] (-786.560) (-788.029) -- 0:00:08
863500 -- (-787.498) [-786.320] (-787.652) (-786.861) * (-786.334) (-786.184) (-786.868) [-786.776] -- 0:00:08
864000 -- [-787.587] (-785.902) (-789.466) (-786.717) * (-786.782) (-786.345) (-790.994) [-786.330] -- 0:00:08
864500 -- (-788.470) (-788.752) [-789.397] (-787.630) * (-785.622) (-788.404) [-786.195] (-789.844) -- 0:00:08
865000 -- (-787.528) (-786.803) [-785.659] (-789.035) * [-787.085] (-790.767) (-786.656) (-789.528) -- 0:00:08
Average standard deviation of split frequencies: 0.008964
865500 -- [-786.344] (-786.584) (-787.924) (-787.948) * [-787.564] (-788.322) (-787.199) (-788.729) -- 0:00:08
866000 -- (-787.051) (-790.356) [-788.657] (-788.095) * (-787.452) [-788.933] (-788.758) (-788.404) -- 0:00:08
866500 -- [-785.717] (-792.117) (-791.706) (-788.391) * (-790.874) (-787.639) (-786.537) [-786.786] -- 0:00:08
867000 -- (-786.903) [-789.284] (-790.346) (-785.666) * [-789.433] (-786.818) (-786.128) (-785.215) -- 0:00:08
867500 -- (-786.152) [-787.641] (-790.189) (-786.377) * [-789.057] (-789.896) (-785.801) (-787.219) -- 0:00:08
868000 -- (-787.404) (-787.488) [-788.260] (-786.510) * (-791.066) (-789.277) [-785.994] (-786.055) -- 0:00:08
868500 -- [-787.714] (-790.578) (-788.368) (-788.401) * (-786.783) [-790.551] (-786.325) (-787.637) -- 0:00:08
869000 -- (-789.131) (-785.977) (-786.447) [-786.480] * (-786.609) [-787.688] (-789.236) (-792.024) -- 0:00:08
869500 -- (-786.552) (-788.491) [-785.839] (-791.437) * [-786.731] (-787.312) (-788.906) (-785.375) -- 0:00:08
870000 -- (-787.296) (-787.596) [-787.377] (-786.249) * [-786.066] (-792.970) (-786.850) (-788.537) -- 0:00:08
Average standard deviation of split frequencies: 0.008771
870500 -- (-788.095) (-790.566) (-787.567) [-796.398] * (-787.443) (-786.869) (-786.464) [-788.120] -- 0:00:08
871000 -- (-788.043) [-786.127] (-788.841) (-787.952) * (-785.163) (-785.999) [-788.001] (-789.940) -- 0:00:08
871500 -- [-788.258] (-792.446) (-788.641) (-787.354) * [-785.593] (-788.252) (-790.752) (-790.053) -- 0:00:08
872000 -- [-790.466] (-790.510) (-786.772) (-788.585) * (-785.846) (-786.287) (-787.728) [-786.332] -- 0:00:08
872500 -- (-787.330) (-788.791) (-787.550) [-788.520] * (-788.151) (-785.334) [-788.207] (-786.887) -- 0:00:08
873000 -- [-786.385] (-790.122) (-788.021) (-789.166) * (-785.859) [-785.191] (-787.287) (-790.512) -- 0:00:08
873500 -- [-787.392] (-787.377) (-790.994) (-787.302) * (-789.526) [-785.656] (-786.580) (-793.891) -- 0:00:07
874000 -- [-787.961] (-792.481) (-788.706) (-785.551) * (-787.437) (-786.839) (-786.678) [-795.215] -- 0:00:07
874500 -- (-789.898) (-789.307) (-789.079) [-785.240] * [-787.035] (-787.370) (-787.196) (-789.634) -- 0:00:07
875000 -- (-789.548) (-787.809) (-786.321) [-785.420] * [-785.545] (-788.132) (-786.341) (-787.815) -- 0:00:07
Average standard deviation of split frequencies: 0.008359
875500 -- (-787.300) [-786.645] (-788.576) (-785.696) * (-790.035) (-792.188) [-786.331] (-793.429) -- 0:00:07
876000 -- (-787.527) (-787.008) [-786.380] (-786.444) * (-787.970) (-788.204) [-788.520] (-790.599) -- 0:00:07
876500 -- (-786.688) (-785.282) (-786.496) [-789.808] * [-787.887] (-787.380) (-788.097) (-787.313) -- 0:00:07
877000 -- (-787.066) (-785.747) [-789.904] (-785.775) * [-787.215] (-788.748) (-787.909) (-787.944) -- 0:00:07
877500 -- [-787.982] (-785.860) (-787.223) (-787.228) * (-786.597) [-786.435] (-793.233) (-787.759) -- 0:00:07
878000 -- (-789.531) (-786.697) (-787.175) [-787.205] * (-786.817) [-789.660] (-789.690) (-786.067) -- 0:00:07
878500 -- (-790.107) [-786.002] (-789.002) (-787.515) * [-786.807] (-787.378) (-786.043) (-786.100) -- 0:00:07
879000 -- (-785.339) (-788.660) (-786.191) [-786.971] * (-790.700) (-787.320) [-790.383] (-789.218) -- 0:00:07
879500 -- (-788.156) (-792.012) [-787.556] (-789.688) * (-787.398) (-786.018) [-789.648] (-791.761) -- 0:00:07
880000 -- [-790.476] (-785.620) (-788.859) (-786.194) * (-785.324) [-788.580] (-788.032) (-789.190) -- 0:00:07
Average standard deviation of split frequencies: 0.008243
880500 -- [-787.927] (-787.879) (-790.020) (-790.609) * (-787.445) [-786.707] (-790.660) (-786.065) -- 0:00:07
881000 -- (-786.268) (-786.480) [-786.181] (-790.374) * [-788.333] (-793.868) (-791.318) (-787.591) -- 0:00:07
881500 -- [-786.271] (-795.506) (-788.718) (-786.542) * (-787.113) (-786.967) (-788.840) [-786.906] -- 0:00:07
882000 -- (-786.237) (-787.305) [-786.249] (-786.504) * (-787.675) [-788.635] (-794.833) (-788.239) -- 0:00:07
882500 -- (-786.148) (-785.778) (-788.565) [-792.284] * (-789.724) [-789.019] (-785.714) (-790.358) -- 0:00:07
883000 -- (-788.557) (-790.743) [-787.190] (-785.430) * (-792.374) (-787.331) [-785.919] (-788.793) -- 0:00:07
883500 -- (-786.638) (-786.009) [-791.072] (-789.012) * (-791.295) (-790.161) [-788.032] (-786.214) -- 0:00:07
884000 -- [-787.741] (-787.915) (-786.380) (-787.041) * (-789.832) [-788.361] (-788.618) (-785.668) -- 0:00:07
884500 -- (-789.196) (-786.922) (-787.110) [-786.971] * (-787.141) [-787.065] (-791.027) (-787.281) -- 0:00:07
885000 -- (-787.195) [-787.887] (-790.134) (-786.288) * [-786.911] (-787.735) (-788.044) (-785.510) -- 0:00:07
Average standard deviation of split frequencies: 0.007945
885500 -- (-787.771) (-786.101) [-788.166] (-787.451) * (-789.478) [-786.150] (-786.061) (-788.581) -- 0:00:07
886000 -- (-787.888) (-786.956) [-787.462] (-788.802) * (-787.507) (-788.420) [-786.882] (-789.161) -- 0:00:07
886500 -- (-789.460) (-787.065) [-786.675] (-788.431) * (-787.342) (-785.705) [-787.891] (-789.337) -- 0:00:07
887000 -- [-788.472] (-789.678) (-787.986) (-786.926) * (-787.442) (-790.953) [-786.711] (-789.208) -- 0:00:07
887500 -- (-787.741) [-790.309] (-787.246) (-788.234) * [-789.310] (-787.038) (-786.610) (-789.511) -- 0:00:07
888000 -- (-789.690) [-787.373] (-788.131) (-791.434) * (-785.710) (-788.739) [-787.052] (-786.130) -- 0:00:07
888500 -- (-786.622) [-788.566] (-790.387) (-796.470) * (-789.394) [-787.333] (-786.520) (-785.879) -- 0:00:07
889000 -- [-786.844] (-786.445) (-786.533) (-790.572) * (-790.670) (-787.622) [-785.761] (-786.621) -- 0:00:06
889500 -- (-793.373) (-787.248) (-787.132) [-788.297] * [-791.195] (-785.984) (-785.933) (-785.404) -- 0:00:06
890000 -- [-787.615] (-788.707) (-790.189) (-788.047) * [-790.131] (-791.198) (-786.740) (-786.254) -- 0:00:06
Average standard deviation of split frequencies: 0.007939
890500 -- (-788.816) (-785.890) (-793.829) [-790.340] * (-785.309) (-787.088) [-787.378] (-786.635) -- 0:00:06
891000 -- (-787.402) (-786.339) (-791.468) [-788.631] * (-785.899) (-787.199) (-785.885) [-786.635] -- 0:00:06
891500 -- (-787.163) (-786.372) [-785.458] (-794.514) * [-786.551] (-789.953) (-785.948) (-788.175) -- 0:00:06
892000 -- (-789.290) (-789.422) [-786.184] (-788.376) * (-791.275) (-788.402) [-791.117] (-788.273) -- 0:00:06
892500 -- (-795.288) [-787.275] (-787.345) (-788.154) * (-788.492) [-787.728] (-787.098) (-788.303) -- 0:00:06
893000 -- (-790.078) (-788.087) [-786.793] (-787.403) * (-786.040) (-786.796) [-787.307] (-786.313) -- 0:00:06
893500 -- (-785.539) (-790.021) [-786.927] (-788.952) * [-788.085] (-787.686) (-788.149) (-787.964) -- 0:00:06
894000 -- (-785.629) [-791.986] (-786.706) (-788.442) * (-791.868) (-787.015) [-789.285] (-787.698) -- 0:00:06
894500 -- (-787.509) (-787.907) (-787.966) [-789.146] * (-788.995) (-786.608) (-786.172) [-787.712] -- 0:00:06
895000 -- (-787.503) [-786.068] (-786.567) (-785.337) * [-788.141] (-786.072) (-785.663) (-789.051) -- 0:00:06
Average standard deviation of split frequencies: 0.007857
895500 -- (-791.569) (-786.512) (-786.400) [-787.049] * [-788.521] (-793.727) (-785.887) (-790.778) -- 0:00:06
896000 -- [-787.255] (-788.169) (-787.074) (-786.921) * (-788.268) (-792.413) (-787.367) [-788.661] -- 0:00:06
896500 -- (-786.335) (-789.020) (-785.826) [-786.952] * (-786.330) [-789.374] (-786.469) (-787.401) -- 0:00:06
897000 -- (-785.554) (-787.774) (-786.398) [-787.043] * (-790.650) [-787.770] (-787.221) (-789.217) -- 0:00:06
897500 -- [-785.806] (-789.963) (-786.170) (-786.397) * (-786.505) (-785.720) (-788.360) [-787.196] -- 0:00:06
898000 -- (-787.187) (-789.707) (-787.246) [-786.507] * (-787.902) (-787.918) (-786.509) [-787.782] -- 0:00:06
898500 -- (-788.505) (-787.630) [-786.204] (-785.479) * (-787.488) (-788.306) [-785.818] (-787.133) -- 0:00:06
899000 -- (-786.111) (-786.874) (-788.188) [-787.285] * (-788.681) (-787.317) (-787.694) [-789.990] -- 0:00:06
899500 -- (-786.147) [-787.140] (-790.005) (-787.535) * [-791.599] (-787.105) (-787.300) (-792.210) -- 0:00:06
900000 -- (-786.464) (-789.183) [-786.594] (-788.084) * (-791.512) (-787.538) (-787.108) [-786.124] -- 0:00:06
Average standard deviation of split frequencies: 0.007851
900500 -- (-787.347) [-786.163] (-786.501) (-787.382) * (-787.245) [-786.014] (-786.637) (-788.231) -- 0:00:06
901000 -- (-788.490) [-786.973] (-787.775) (-787.997) * (-786.871) (-786.230) [-790.324] (-789.524) -- 0:00:06
901500 -- (-785.900) (-786.409) [-788.791] (-788.505) * (-788.794) [-786.374] (-789.715) (-789.387) -- 0:00:06
902000 -- (-787.001) (-788.799) [-786.582] (-792.536) * (-791.329) (-788.188) (-788.069) [-786.854] -- 0:00:06
902500 -- (-785.612) (-786.845) (-786.680) [-792.343] * (-786.911) (-785.517) [-788.166] (-786.102) -- 0:00:06
903000 -- (-789.897) [-787.057] (-786.172) (-791.435) * (-786.349) (-789.333) [-787.530] (-786.497) -- 0:00:06
903500 -- (-786.852) [-788.121] (-786.992) (-786.906) * (-789.021) (-790.043) (-786.770) [-787.388] -- 0:00:06
904000 -- [-788.620] (-786.484) (-787.376) (-790.881) * [-786.841] (-786.990) (-787.805) (-788.205) -- 0:00:06
904500 -- [-786.862] (-787.088) (-787.936) (-789.270) * (-787.751) [-791.624] (-787.027) (-789.807) -- 0:00:06
905000 -- (-789.591) [-786.208] (-788.343) (-786.328) * [-787.955] (-789.664) (-786.371) (-787.158) -- 0:00:05
Average standard deviation of split frequencies: 0.007631
905500 -- [-789.205] (-785.446) (-786.993) (-785.728) * [-789.091] (-794.713) (-786.197) (-788.367) -- 0:00:05
906000 -- (-793.114) (-786.025) (-786.634) [-786.746] * (-786.793) (-797.070) (-787.268) [-788.874] -- 0:00:05
906500 -- (-789.256) [-786.793] (-788.686) (-789.973) * [-787.526] (-790.512) (-786.677) (-788.050) -- 0:00:05
907000 -- [-790.213] (-785.920) (-787.707) (-788.344) * (-789.029) (-790.881) [-788.799] (-788.757) -- 0:00:05
907500 -- (-790.230) [-786.646] (-786.520) (-789.609) * (-786.295) [-786.663] (-786.059) (-790.083) -- 0:00:05
908000 -- (-788.137) [-785.347] (-787.406) (-788.260) * (-788.330) [-788.823] (-785.471) (-787.722) -- 0:00:05
908500 -- (-786.453) (-788.564) (-788.826) [-787.603] * (-788.719) [-787.321] (-785.392) (-786.893) -- 0:00:05
909000 -- (-786.178) (-788.773) (-794.105) [-786.167] * (-788.519) (-787.427) (-786.788) [-790.276] -- 0:00:05
909500 -- [-786.175] (-789.534) (-792.251) (-786.385) * (-788.593) (-790.084) [-786.529] (-787.032) -- 0:00:05
910000 -- (-787.564) (-787.122) (-790.726) [-787.015] * (-787.369) (-786.322) [-786.813] (-786.335) -- 0:00:05
Average standard deviation of split frequencies: 0.007282
910500 -- [-788.090] (-786.027) (-788.902) (-789.816) * [-789.067] (-789.546) (-786.895) (-787.924) -- 0:00:05
911000 -- (-789.329) (-786.682) [-790.680] (-785.523) * (-785.587) (-790.831) [-786.965] (-788.021) -- 0:00:05
911500 -- [-787.489] (-788.784) (-788.444) (-785.477) * (-788.256) [-786.298] (-789.401) (-791.689) -- 0:00:05
912000 -- (-787.285) (-786.309) (-789.158) [-789.272] * (-787.415) (-788.234) (-785.268) [-787.033] -- 0:00:05
912500 -- (-789.929) (-785.960) [-786.986] (-787.965) * (-787.356) (-787.194) [-786.502] (-787.265) -- 0:00:05
913000 -- (-787.670) (-785.647) (-789.976) [-788.037] * (-786.085) (-785.989) (-789.558) [-786.559] -- 0:00:05
913500 -- (-789.489) (-786.326) [-787.402] (-787.086) * (-786.902) [-787.809] (-796.146) (-786.571) -- 0:00:05
914000 -- (-787.710) (-787.515) [-786.703] (-788.680) * (-788.610) [-787.834] (-788.016) (-786.742) -- 0:00:05
914500 -- (-785.569) (-785.901) (-787.085) [-786.481] * (-786.086) (-785.617) [-787.811] (-787.374) -- 0:00:05
915000 -- (-787.895) (-787.767) [-787.919] (-786.150) * (-785.785) [-785.113] (-786.654) (-786.592) -- 0:00:05
Average standard deviation of split frequencies: 0.007102
915500 -- [-787.232] (-787.970) (-788.435) (-787.400) * (-786.320) (-785.900) [-787.420] (-788.532) -- 0:00:05
916000 -- [-786.324] (-787.817) (-785.985) (-788.160) * (-788.470) (-787.704) (-791.350) [-785.943] -- 0:00:05
916500 -- (-786.366) (-787.883) [-785.917] (-788.746) * (-788.652) (-788.584) (-790.498) [-788.268] -- 0:00:05
917000 -- (-787.522) (-786.191) [-790.550] (-790.201) * [-790.102] (-787.786) (-789.128) (-786.988) -- 0:00:05
917500 -- (-785.780) [-785.306] (-791.412) (-789.412) * (-791.021) (-791.291) (-788.770) [-788.371] -- 0:00:05
918000 -- (-788.822) (-785.486) [-792.971] (-786.642) * (-788.342) (-790.666) (-789.139) [-788.550] -- 0:00:05
918500 -- (-786.043) (-786.718) [-787.843] (-789.873) * (-790.743) (-788.415) [-786.059] (-788.778) -- 0:00:05
919000 -- [-786.786] (-786.454) (-788.688) (-786.193) * (-789.925) (-787.898) [-786.969] (-791.657) -- 0:00:05
919500 -- (-786.329) (-788.214) (-789.733) [-786.478] * (-788.202) (-786.010) (-785.256) [-788.733] -- 0:00:05
920000 -- [-787.703] (-788.921) (-786.534) (-791.048) * (-788.850) (-789.107) (-786.267) [-788.987] -- 0:00:05
Average standard deviation of split frequencies: 0.007271
920500 -- (-788.761) (-788.851) (-788.548) [-789.009] * [-785.590] (-786.698) (-786.899) (-789.481) -- 0:00:05
921000 -- (-788.607) (-787.880) (-786.067) [-785.663] * (-789.436) [-786.855] (-786.503) (-789.170) -- 0:00:04
921500 -- (-788.706) (-789.452) (-787.289) [-785.983] * (-788.318) (-786.499) [-785.574] (-787.000) -- 0:00:04
922000 -- [-785.533] (-786.374) (-787.252) (-789.811) * [-787.044] (-789.645) (-787.391) (-790.250) -- 0:00:04
922500 -- (-788.694) [-787.199] (-786.713) (-788.253) * (-787.252) [-785.886] (-790.486) (-787.190) -- 0:00:04
923000 -- [-787.657] (-788.221) (-788.558) (-787.812) * (-786.618) (-785.889) [-788.229] (-787.023) -- 0:00:04
923500 -- (-787.121) [-785.523] (-786.348) (-787.129) * (-786.630) (-787.290) (-788.345) [-786.945] -- 0:00:04
924000 -- [-788.033] (-787.154) (-786.505) (-786.908) * (-791.195) [-788.507] (-787.668) (-791.470) -- 0:00:04
924500 -- (-785.963) (-791.779) (-793.720) [-788.202] * (-787.196) (-787.596) (-788.770) [-791.571] -- 0:00:04
925000 -- (-786.668) (-786.730) (-792.454) [-786.712] * (-787.336) (-785.302) (-793.484) [-786.647] -- 0:00:04
Average standard deviation of split frequencies: 0.007534
925500 -- (-785.434) [-785.930] (-788.316) (-787.962) * [-787.225] (-788.793) (-788.771) (-787.448) -- 0:00:04
926000 -- [-785.944] (-786.728) (-789.189) (-788.279) * (-788.490) (-786.533) [-787.565] (-786.552) -- 0:00:04
926500 -- (-786.947) [-788.472] (-795.098) (-788.350) * [-786.997] (-787.179) (-786.119) (-785.531) -- 0:00:04
927000 -- (-788.402) [-786.783] (-786.848) (-786.839) * (-789.105) (-794.161) [-786.868] (-788.591) -- 0:00:04
927500 -- [-788.046] (-787.454) (-790.003) (-793.168) * [-790.338] (-787.875) (-785.985) (-788.284) -- 0:00:04
928000 -- [-789.182] (-788.254) (-790.681) (-786.552) * (-790.637) (-787.803) [-786.495] (-787.064) -- 0:00:04
928500 -- (-788.756) (-786.650) [-790.642] (-788.334) * [-788.186] (-790.015) (-785.819) (-786.940) -- 0:00:04
929000 -- (-788.112) (-788.597) [-790.745] (-789.779) * [-787.019] (-789.551) (-786.674) (-787.213) -- 0:00:04
929500 -- (-789.242) (-790.201) (-796.366) [-785.471] * (-786.793) (-790.837) (-786.810) [-787.126] -- 0:00:04
930000 -- (-787.511) (-787.085) (-791.407) [-788.073] * [-788.440] (-788.281) (-789.443) (-792.351) -- 0:00:04
Average standard deviation of split frequencies: 0.007564
930500 -- [-785.756] (-785.922) (-790.699) (-791.063) * (-786.085) (-788.045) (-787.347) [-789.610] -- 0:00:04
931000 -- [-785.580] (-785.922) (-786.294) (-789.856) * (-788.868) (-788.768) (-789.788) [-788.031] -- 0:00:04
931500 -- (-789.499) (-789.139) (-786.115) [-786.331] * (-788.728) (-785.792) [-788.472] (-790.236) -- 0:00:04
932000 -- (-788.297) (-789.417) (-785.346) [-789.447] * (-790.704) [-786.451] (-789.376) (-787.623) -- 0:00:04
932500 -- (-792.129) [-786.495] (-786.105) (-789.233) * [-789.246] (-786.504) (-788.165) (-785.959) -- 0:00:04
933000 -- [-787.855] (-791.992) (-785.379) (-787.297) * (-788.094) [-787.173] (-788.270) (-786.591) -- 0:00:04
933500 -- [-787.801] (-788.863) (-785.260) (-789.036) * (-787.356) (-787.500) (-788.470) [-786.405] -- 0:00:04
934000 -- (-787.853) (-786.876) (-789.217) [-786.656] * (-786.793) [-786.916] (-785.676) (-786.849) -- 0:00:04
934500 -- (-787.270) (-787.658) (-787.265) [-788.291] * (-787.280) (-786.849) [-788.392] (-787.698) -- 0:00:04
935000 -- (-786.714) [-787.086] (-786.847) (-791.210) * (-788.960) [-787.170] (-786.586) (-790.331) -- 0:00:04
Average standard deviation of split frequencies: 0.007722
935500 -- [-788.327] (-786.551) (-787.795) (-788.566) * (-786.226) [-790.359] (-786.998) (-786.938) -- 0:00:04
936000 -- (-788.148) [-786.842] (-791.130) (-794.805) * (-786.743) (-785.852) [-789.626] (-786.005) -- 0:00:04
936500 -- [-787.818] (-787.753) (-788.983) (-788.467) * [-787.638] (-789.297) (-786.628) (-786.210) -- 0:00:04
937000 -- (-786.157) [-789.292] (-787.477) (-788.186) * (-785.648) [-790.387] (-787.219) (-786.118) -- 0:00:03
937500 -- (-786.118) (-788.224) [-785.502] (-787.139) * [-786.031] (-788.723) (-785.445) (-786.489) -- 0:00:03
938000 -- [-785.720] (-789.407) (-785.768) (-787.766) * (-785.749) [-786.977] (-787.950) (-788.812) -- 0:00:03
938500 -- (-786.436) [-786.007] (-785.620) (-789.115) * (-785.797) (-786.386) (-786.209) [-785.869] -- 0:00:03
939000 -- (-785.292) [-788.041] (-786.473) (-787.001) * (-786.086) [-787.903] (-786.226) (-788.554) -- 0:00:03
939500 -- [-786.190] (-787.632) (-789.856) (-798.358) * [-785.665] (-788.185) (-789.339) (-786.100) -- 0:00:03
940000 -- [-785.283] (-786.754) (-786.165) (-787.195) * [-785.336] (-787.781) (-789.327) (-787.760) -- 0:00:03
Average standard deviation of split frequencies: 0.007216
940500 -- (-786.441) [-789.487] (-789.634) (-787.030) * (-785.505) (-787.120) (-785.642) [-787.157] -- 0:00:03
941000 -- (-786.093) [-789.440] (-790.001) (-786.628) * (-786.181) (-788.825) (-786.020) [-786.034] -- 0:00:03
941500 -- [-785.731] (-787.402) (-788.489) (-791.631) * [-786.117] (-789.248) (-788.549) (-790.268) -- 0:00:03
942000 -- (-786.144) (-788.341) [-787.081] (-789.804) * [-786.676] (-787.884) (-789.000) (-789.700) -- 0:00:03
942500 -- (-786.252) [-786.713] (-786.274) (-787.158) * (-787.859) (-785.841) (-788.277) [-788.801] -- 0:00:03
943000 -- (-786.016) (-788.366) (-785.350) [-785.926] * [-788.880] (-785.690) (-785.698) (-793.830) -- 0:00:03
943500 -- (-786.353) [-790.215] (-787.000) (-785.891) * (-785.955) (-790.082) [-786.542] (-788.706) -- 0:00:03
944000 -- (-787.734) [-788.771] (-788.052) (-787.751) * (-789.237) (-786.293) (-793.114) [-785.389] -- 0:00:03
944500 -- (-788.367) (-788.115) [-786.256] (-787.593) * [-788.645] (-788.139) (-789.246) (-789.861) -- 0:00:03
945000 -- (-786.768) (-785.734) (-787.924) [-786.444] * [-787.228] (-787.881) (-787.959) (-787.595) -- 0:00:03
Average standard deviation of split frequencies: 0.007010
945500 -- (-785.964) (-786.817) (-788.929) [-789.389] * (-787.561) [-787.239] (-787.565) (-788.346) -- 0:00:03
946000 -- [-787.218] (-787.409) (-792.106) (-787.061) * (-793.229) (-788.154) [-788.804] (-787.776) -- 0:00:03
946500 -- (-786.959) (-788.938) (-787.932) [-787.218] * (-786.411) [-789.113] (-789.325) (-788.760) -- 0:00:03
947000 -- [-788.054] (-790.660) (-791.445) (-788.200) * (-790.555) [-787.347] (-787.881) (-788.673) -- 0:00:03
947500 -- (-786.010) (-788.651) [-790.798] (-788.127) * (-787.561) [-786.855] (-786.491) (-790.219) -- 0:00:03
948000 -- [-789.789] (-787.501) (-787.774) (-788.656) * [-786.748] (-786.523) (-787.372) (-787.753) -- 0:00:03
948500 -- (-787.060) [-785.694] (-787.516) (-790.974) * (-786.307) [-786.882] (-787.331) (-786.132) -- 0:00:03
949000 -- (-787.580) (-785.753) [-788.701] (-786.870) * (-786.553) [-786.370] (-791.429) (-790.096) -- 0:00:03
949500 -- (-788.929) (-790.871) [-792.952] (-788.066) * (-785.709) (-786.392) (-789.653) [-787.515] -- 0:00:03
950000 -- (-786.473) (-789.824) [-788.024] (-785.706) * (-787.246) [-786.987] (-785.560) (-787.685) -- 0:00:03
Average standard deviation of split frequencies: 0.006744
950500 -- (-788.682) (-788.771) [-786.462] (-788.022) * (-789.023) [-787.376] (-787.995) (-786.465) -- 0:00:03
951000 -- (-786.834) [-791.501] (-786.488) (-789.464) * (-789.420) [-786.970] (-786.622) (-785.934) -- 0:00:03
951500 -- (-790.835) (-786.417) [-788.690] (-786.415) * (-788.010) (-786.922) (-788.040) [-787.177] -- 0:00:03
952000 -- (-788.660) (-786.386) (-789.936) [-786.690] * (-793.079) (-787.082) [-786.016] (-788.920) -- 0:00:03
952500 -- (-788.840) [-787.218] (-787.561) (-786.236) * [-790.867] (-787.144) (-797.983) (-788.601) -- 0:00:03
953000 -- (-785.718) (-785.732) [-787.747] (-788.339) * [-787.409] (-788.896) (-788.823) (-785.695) -- 0:00:03
953500 -- (-786.082) (-787.698) (-785.888) [-786.817] * (-785.546) (-788.559) (-788.912) [-792.337] -- 0:00:02
954000 -- [-786.530] (-789.787) (-791.105) (-787.536) * (-786.795) [-788.502] (-789.045) (-786.591) -- 0:00:02
954500 -- (-790.414) (-786.338) (-790.550) [-786.701] * [-788.794] (-788.668) (-796.349) (-786.276) -- 0:00:02
955000 -- (-789.995) [-788.638] (-786.009) (-788.897) * (-786.251) [-788.558] (-786.020) (-787.597) -- 0:00:02
Average standard deviation of split frequencies: 0.006542
955500 -- (-789.397) (-789.975) [-787.125] (-786.804) * (-789.653) (-786.186) [-787.141] (-787.005) -- 0:00:02
956000 -- [-788.241] (-785.598) (-785.271) (-790.146) * (-789.381) (-787.420) (-786.517) [-786.685] -- 0:00:02
956500 -- [-785.475] (-790.979) (-785.871) (-791.013) * (-787.820) [-786.354] (-785.535) (-787.160) -- 0:00:02
957000 -- (-786.673) (-786.107) [-786.863] (-786.820) * (-785.990) [-788.217] (-789.934) (-787.298) -- 0:00:02
957500 -- (-788.851) (-787.807) (-787.355) [-787.440] * [-785.422] (-790.324) (-790.155) (-787.716) -- 0:00:02
958000 -- (-788.671) (-788.239) (-786.880) [-787.619] * (-786.355) (-787.112) (-789.215) [-786.082] -- 0:00:02
958500 -- (-787.311) (-788.240) [-786.478] (-790.188) * (-786.659) (-786.865) [-787.753] (-789.525) -- 0:00:02
959000 -- (-787.258) [-785.419] (-794.820) (-789.301) * (-787.910) (-788.442) (-788.137) [-788.513] -- 0:00:02
959500 -- [-787.755] (-785.821) (-787.608) (-785.902) * (-788.148) (-788.153) [-785.304] (-787.055) -- 0:00:02
960000 -- (-788.001) [-787.026] (-785.399) (-785.525) * (-787.811) (-789.727) [-788.824] (-790.937) -- 0:00:02
Average standard deviation of split frequencies: 0.006346
960500 -- (-786.157) [-786.069] (-786.880) (-789.145) * (-789.296) [-791.179] (-788.303) (-789.477) -- 0:00:02
961000 -- (-786.363) (-787.602) [-785.210] (-788.722) * (-788.889) [-786.532] (-789.027) (-790.821) -- 0:00:02
961500 -- [-786.590] (-786.167) (-786.389) (-787.066) * [-786.302] (-785.964) (-788.790) (-787.589) -- 0:00:02
962000 -- (-785.399) (-787.538) [-786.975] (-790.746) * (-788.549) (-786.120) [-788.578] (-790.493) -- 0:00:02
962500 -- (-786.963) (-788.858) [-786.273] (-790.015) * [-785.279] (-788.147) (-787.475) (-787.507) -- 0:00:02
963000 -- (-787.820) (-787.053) (-787.071) [-785.964] * (-787.409) (-786.893) (-788.322) [-789.285] -- 0:00:02
963500 -- (-789.558) (-786.122) (-787.864) [-787.428] * (-786.204) [-786.024] (-788.178) (-790.589) -- 0:00:02
964000 -- [-788.358] (-786.256) (-792.754) (-786.842) * (-790.976) (-785.473) (-789.705) [-787.771] -- 0:00:02
964500 -- (-788.243) (-786.535) (-796.290) [-786.413] * (-788.904) (-785.301) [-788.886] (-786.504) -- 0:00:02
965000 -- (-788.742) [-786.925] (-790.768) (-786.892) * (-789.028) [-787.462] (-786.423) (-787.095) -- 0:00:02
Average standard deviation of split frequencies: 0.006181
965500 -- (-787.237) [-787.647] (-789.988) (-787.252) * (-790.001) (-786.774) [-785.899] (-787.805) -- 0:00:02
966000 -- (-787.996) (-790.636) (-787.944) [-789.308] * (-785.674) (-788.791) [-787.511] (-787.822) -- 0:00:02
966500 -- (-788.970) (-789.465) (-786.032) [-788.040] * [-793.897] (-786.372) (-785.844) (-788.189) -- 0:00:02
967000 -- [-787.035] (-785.716) (-787.211) (-788.980) * (-791.834) [-791.814] (-790.027) (-789.842) -- 0:00:02
967500 -- [-787.339] (-786.267) (-788.215) (-786.592) * (-786.014) (-789.990) [-788.622] (-787.256) -- 0:00:02
968000 -- (-794.269) [-787.433] (-788.485) (-788.674) * [-787.515] (-789.445) (-790.212) (-796.012) -- 0:00:02
968500 -- (-791.039) [-787.847] (-787.036) (-787.662) * (-786.586) (-788.772) [-792.994] (-792.142) -- 0:00:02
969000 -- [-787.026] (-787.500) (-786.339) (-788.407) * (-788.664) [-787.768] (-787.711) (-789.764) -- 0:00:01
969500 -- (-786.934) [-785.935] (-787.506) (-788.869) * (-788.304) [-788.577] (-788.842) (-788.895) -- 0:00:01
970000 -- (-787.703) (-786.555) (-787.865) [-787.161] * (-789.806) [-787.364] (-789.034) (-792.245) -- 0:00:01
Average standard deviation of split frequencies: 0.006184
970500 -- (-787.711) (-790.790) (-786.633) [-786.013] * (-793.886) [-787.208] (-789.060) (-787.815) -- 0:00:01
971000 -- (-786.628) (-786.425) (-788.624) [-787.112] * (-788.343) [-787.084] (-788.613) (-789.961) -- 0:00:01
971500 -- (-786.369) [-785.392] (-785.926) (-790.329) * (-787.558) [-786.091] (-786.545) (-791.015) -- 0:00:01
972000 -- (-786.712) [-786.811] (-785.716) (-790.263) * (-788.520) (-790.579) [-787.401] (-791.561) -- 0:00:01
972500 -- (-787.368) (-786.168) (-785.749) [-787.664] * (-789.537) (-786.129) (-790.779) [-794.697] -- 0:00:01
973000 -- (-789.898) (-786.728) (-787.102) [-792.306] * (-793.741) [-785.853] (-786.809) (-787.572) -- 0:00:01
973500 -- (-789.608) (-788.839) [-786.822] (-787.776) * [-786.314] (-786.216) (-786.415) (-786.283) -- 0:00:01
974000 -- (-787.115) (-788.165) [-787.195] (-789.241) * (-786.340) [-787.771] (-786.857) (-788.380) -- 0:00:01
974500 -- (-787.342) [-788.667] (-787.160) (-788.095) * [-787.987] (-788.088) (-787.792) (-791.176) -- 0:00:01
975000 -- (-788.264) (-786.777) [-785.346] (-787.548) * (-786.970) (-786.729) [-790.529] (-788.316) -- 0:00:01
Average standard deviation of split frequencies: 0.006182
975500 -- [-786.171] (-793.857) (-786.428) (-788.497) * (-786.000) (-788.391) [-788.970] (-788.819) -- 0:00:01
976000 -- [-785.724] (-786.527) (-789.835) (-787.749) * (-788.271) (-793.242) (-786.959) [-786.456] -- 0:00:01
976500 -- (-786.038) (-787.364) (-789.073) [-786.983] * (-787.903) [-788.146] (-786.242) (-787.795) -- 0:00:01
977000 -- (-790.115) (-789.761) [-787.655] (-785.395) * [-789.177] (-788.835) (-786.516) (-786.440) -- 0:00:01
977500 -- (-788.969) (-788.736) [-785.566] (-785.364) * (-789.275) [-787.169] (-786.345) (-786.915) -- 0:00:01
978000 -- (-787.754) [-790.392] (-785.489) (-787.374) * (-788.465) (-786.690) [-788.805] (-789.733) -- 0:00:01
978500 -- (-787.219) (-789.182) (-791.999) [-786.296] * (-786.821) (-788.331) [-786.622] (-790.169) -- 0:00:01
979000 -- [-787.661] (-787.158) (-788.389) (-785.994) * (-788.767) [-787.194] (-786.024) (-790.367) -- 0:00:01
979500 -- [-786.662] (-792.950) (-785.733) (-789.205) * (-792.808) (-791.625) (-789.845) [-789.541] -- 0:00:01
980000 -- (-785.961) [-787.912] (-788.836) (-792.034) * (-786.363) [-788.445] (-794.352) (-787.372) -- 0:00:01
Average standard deviation of split frequencies: 0.006089
980500 -- (-786.310) [-785.947] (-789.068) (-792.855) * (-791.118) [-790.252] (-786.204) (-793.292) -- 0:00:01
981000 -- (-786.792) (-789.492) (-786.693) [-787.808] * (-788.977) (-787.555) [-786.863] (-786.500) -- 0:00:01
981500 -- [-785.496] (-788.552) (-786.859) (-788.788) * [-791.940] (-787.832) (-787.041) (-787.107) -- 0:00:01
982000 -- (-786.716) (-787.336) [-787.320] (-788.821) * (-789.547) (-786.309) (-793.954) [-787.442] -- 0:00:01
982500 -- (-785.821) [-786.114] (-790.044) (-787.856) * [-788.050] (-788.168) (-786.782) (-785.177) -- 0:00:01
983000 -- (-785.713) (-786.126) (-787.622) [-786.646] * [-786.477] (-787.282) (-792.644) (-787.366) -- 0:00:01
983500 -- [-786.319] (-786.666) (-786.655) (-786.190) * [-785.756] (-787.349) (-786.079) (-786.379) -- 0:00:01
984000 -- (-787.207) (-791.795) (-787.299) [-785.159] * (-788.088) (-794.183) [-788.592] (-787.088) -- 0:00:01
984500 -- [-790.222] (-786.343) (-785.928) (-788.289) * (-788.684) (-790.367) (-790.468) [-787.401] -- 0:00:00
985000 -- (-790.733) (-786.303) (-788.298) [-785.969] * (-787.376) [-789.330] (-788.435) (-787.983) -- 0:00:00
Average standard deviation of split frequencies: 0.006024
985500 -- (-790.411) (-789.567) [-786.540] (-786.334) * (-787.586) (-790.208) [-785.448] (-785.845) -- 0:00:00
986000 -- (-788.312) (-786.507) (-788.243) [-785.915] * (-788.043) (-785.317) [-787.766] (-786.824) -- 0:00:00
986500 -- [-787.103] (-787.911) (-787.048) (-792.635) * (-788.506) (-789.363) [-786.072] (-787.107) -- 0:00:00
987000 -- [-787.516] (-787.820) (-787.431) (-789.590) * [-785.792] (-788.084) (-787.761) (-787.352) -- 0:00:00
987500 -- (-788.317) (-789.275) (-785.819) [-787.962] * (-787.630) (-786.580) (-790.220) [-788.144] -- 0:00:00
988000 -- [-789.531] (-786.911) (-785.964) (-787.319) * [-786.296] (-789.255) (-789.948) (-785.239) -- 0:00:00
988500 -- [-788.499] (-794.110) (-787.442) (-785.724) * (-787.836) [-790.034] (-787.719) (-785.861) -- 0:00:00
989000 -- (-787.128) [-787.337] (-787.408) (-787.850) * [-785.515] (-788.172) (-788.825) (-786.124) -- 0:00:00
989500 -- (-786.876) [-786.712] (-786.816) (-794.158) * (-785.976) (-787.706) (-788.065) [-787.092] -- 0:00:00
990000 -- [-788.980] (-787.363) (-786.903) (-786.307) * [-785.913] (-787.353) (-787.607) (-787.932) -- 0:00:00
Average standard deviation of split frequencies: 0.006186
990500 -- (-786.311) (-786.904) (-789.093) [-789.048] * (-787.867) [-787.803] (-788.354) (-787.257) -- 0:00:00
991000 -- (-788.843) (-788.571) [-786.795] (-786.524) * (-790.187) (-787.778) (-786.598) [-785.528] -- 0:00:00
991500 -- (-791.352) (-785.911) (-792.052) [-785.329] * (-788.369) [-789.097] (-787.037) (-785.359) -- 0:00:00
992000 -- (-791.409) (-787.125) [-786.650] (-786.818) * (-787.004) (-786.750) (-787.153) [-786.178] -- 0:00:00
992500 -- (-792.100) (-786.321) [-787.261] (-785.804) * (-796.293) [-789.121] (-790.278) (-787.321) -- 0:00:00
993000 -- (-786.388) (-786.349) [-787.734] (-786.264) * [-787.409] (-791.883) (-786.544) (-788.606) -- 0:00:00
993500 -- (-788.889) (-788.208) [-788.894] (-786.879) * (-787.957) (-791.254) (-788.029) [-786.436] -- 0:00:00
994000 -- [-788.671] (-789.908) (-789.332) (-786.284) * (-787.020) [-790.425] (-786.899) (-787.632) -- 0:00:00
994500 -- (-787.299) (-785.811) [-785.336] (-786.529) * (-787.220) (-789.590) [-787.556] (-790.408) -- 0:00:00
995000 -- (-787.163) [-785.749] (-786.975) (-788.493) * (-786.959) (-789.628) (-788.983) [-786.876] -- 0:00:00
Average standard deviation of split frequencies: 0.006121
995500 -- [-787.752] (-786.572) (-787.890) (-787.062) * [-786.445] (-795.340) (-794.487) (-786.933) -- 0:00:00
996000 -- [-787.609] (-786.357) (-789.012) (-788.807) * (-786.649) (-788.593) (-790.871) [-788.883] -- 0:00:00
996500 -- [-787.066] (-786.150) (-789.026) (-786.943) * [-790.654] (-789.626) (-787.197) (-787.514) -- 0:00:00
997000 -- (-785.992) (-785.860) [-787.499] (-787.355) * (-789.666) (-790.997) (-786.131) [-787.298] -- 0:00:00
997500 -- (-787.195) (-785.342) (-790.814) [-786.421] * [-788.234] (-788.501) (-787.688) (-789.992) -- 0:00:00
998000 -- (-787.485) (-785.580) (-789.989) [-786.360] * [-786.791] (-789.639) (-793.047) (-790.094) -- 0:00:00
998500 -- (-793.018) [-786.113] (-786.821) (-788.186) * [-785.824] (-787.494) (-787.669) (-789.371) -- 0:00:00
999000 -- (-789.925) (-786.819) [-786.737] (-786.424) * (-785.791) (-790.104) (-788.081) [-786.457] -- 0:00:00
999500 -- (-785.612) (-787.145) [-786.182] (-786.155) * (-786.016) (-789.023) [-789.226] (-787.587) -- 0:00:00
1000000 -- (-785.984) [-789.761] (-786.353) (-786.939) * [-786.793] (-786.645) (-789.136) (-786.482) -- 0:00:00
Average standard deviation of split frequencies: 0.006124
Analysis completed in 1 mins 4 seconds
Analysis used 62.76 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -785.01
Likelihood of best state for "cold" chain of run 2 was -785.01
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 61 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.0 % ( 25 %) Dirichlet(Pi{all})
30.9 % ( 23 %) Slider(Pi{all})
79.0 % ( 60 %) Multiplier(Alpha{1,2})
78.2 % ( 51 %) Multiplier(Alpha{3})
22.3 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 88 %) ParsSPR(Tau{all},V{all})
28.0 % ( 25 %) Multiplier(V{all})
97.4 % (100 %) Nodeslider(V{all})
30.5 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.0 % ( 75 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.8 % ( 22 %) Dirichlet(Pi{all})
30.5 % ( 21 %) Slider(Pi{all})
79.3 % ( 57 %) Multiplier(Alpha{1,2})
77.9 % ( 61 %) Multiplier(Alpha{3})
22.9 % ( 31 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 76 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 84 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.3 % ( 17 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166730 0.82 0.67
3 | 166319 166819 0.84
4 | 166409 166638 167085
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166764 0.82 0.67
3 | 166773 166488 0.84
4 | 166547 167062 166366
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -786.66
| 1 2 |
| 1 |
| 21 1 2 1 2 |
| 1 1 2 1 2 2 |
| 1 1 2 2 1 1 1 1 |
| 11 1 1 |
| 1 1 22 2 1 1 1|
| 21 2 1 2 12 1 2 2 |
| 2 2 11 1 2 1 2 11 1 2 121 1 2|
|1 1 21 2 11 222 1 1 2 12 1 1 |
| 21 2 21 22 2 212 1 12 1 2 2 |
| 2 1 1 2 12 1 1 2 2 |
| 22 2 22 |
|2 2 2 2 1 |
| 1 2 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -788.30
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -786.73 -790.05
2 -786.83 -790.91
--------------------------------------
TOTAL -786.78 -790.57
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894099 0.090495 0.345104 1.482300 0.862708 1232.65 1366.83 1.000
r(A<->C){all} 0.165365 0.018838 0.000004 0.458322 0.131201 224.72 226.45 1.001
r(A<->G){all} 0.180811 0.022424 0.000028 0.480672 0.143756 189.73 211.36 1.001
r(A<->T){all} 0.163228 0.018112 0.000085 0.431733 0.131895 166.20 243.91 1.000
r(C<->G){all} 0.168004 0.019690 0.000048 0.449079 0.132172 158.21 173.33 1.003
r(C<->T){all} 0.173016 0.020604 0.000258 0.467257 0.133306 160.01 220.28 1.003
r(G<->T){all} 0.149577 0.015585 0.000062 0.395052 0.117434 194.05 240.90 1.002
pi(A){all} 0.210923 0.000288 0.179892 0.244932 0.210499 1322.08 1338.43 1.000
pi(C){all} 0.285534 0.000352 0.249148 0.322775 0.285570 1186.86 1211.17 1.000
pi(G){all} 0.280703 0.000355 0.243465 0.315475 0.280325 1262.98 1285.98 1.000
pi(T){all} 0.222840 0.000315 0.188532 0.257229 0.222525 1213.61 1262.62 1.000
alpha{1,2} 0.411411 0.227608 0.000249 1.406530 0.242573 1316.78 1352.43 1.001
alpha{3} 0.456043 0.233509 0.000154 1.421922 0.304782 1171.61 1244.23 1.000
pinvar{all} 0.997119 0.000012 0.990698 0.999998 0.998190 865.64 1115.80 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ....**
8 -- .***.*
9 -- .*...*
10 -- .**...
11 -- .****.
12 -- ..**..
13 -- .**.**
14 -- ..*.*.
15 -- ..****
16 -- ...**.
17 -- .*.*..
18 -- ..*..*
19 -- .*.***
20 -- .*..*.
21 -- ...*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 462 0.153897 0.000942 0.153231 0.154564 2
8 457 0.152232 0.005182 0.148568 0.155896 2
9 450 0.149900 0.012248 0.141239 0.158561 2
10 445 0.148235 0.002355 0.146569 0.149900 2
11 444 0.147901 0.002827 0.145903 0.149900 2
12 443 0.147568 0.017430 0.135243 0.159893 2
13 443 0.147568 0.006124 0.143238 0.151899 2
14 438 0.145903 0.007537 0.140573 0.151233 2
15 436 0.145237 0.001884 0.143904 0.146569 2
16 423 0.140906 0.004240 0.137908 0.143904 2
17 412 0.137242 0.004711 0.133911 0.140573 2
18 410 0.136576 0.008480 0.130580 0.142572 2
19 405 0.134910 0.004240 0.131912 0.137908 2
20 402 0.133911 0.006595 0.129247 0.138574 2
21 375 0.124917 0.007066 0.119920 0.129913 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097759 0.009494 0.000014 0.296666 0.067304 1.000 2
length{all}[2] 0.097458 0.009934 0.000006 0.299044 0.066021 1.000 2
length{all}[3] 0.101177 0.010585 0.000028 0.315761 0.067925 1.000 2
length{all}[4] 0.099386 0.009299 0.000145 0.293424 0.069349 1.000 2
length{all}[5] 0.101652 0.010679 0.000055 0.310770 0.069452 1.002 2
length{all}[6] 0.099844 0.010293 0.000004 0.305620 0.070341 1.000 2
length{all}[7] 0.093683 0.009875 0.000132 0.293636 0.060092 1.002 2
length{all}[8] 0.097256 0.010247 0.000090 0.298511 0.064111 0.999 2
length{all}[9] 0.094468 0.008237 0.000259 0.271135 0.062635 0.998 2
length{all}[10] 0.095537 0.008195 0.000245 0.264450 0.068091 0.998 2
length{all}[11] 0.106991 0.013384 0.000060 0.305366 0.075741 1.001 2
length{all}[12] 0.095176 0.009446 0.000060 0.296613 0.065202 0.998 2
length{all}[13] 0.100079 0.008514 0.000408 0.281224 0.074596 0.999 2
length{all}[14] 0.098230 0.009576 0.000027 0.288459 0.069569 0.999 2
length{all}[15] 0.098461 0.009867 0.000218 0.295638 0.069266 1.005 2
length{all}[16] 0.095733 0.009609 0.000234 0.279195 0.060733 0.998 2
length{all}[17] 0.108440 0.011574 0.000174 0.328662 0.075379 1.003 2
length{all}[18] 0.096344 0.009742 0.000068 0.303390 0.064928 1.001 2
length{all}[19] 0.097639 0.009410 0.000030 0.288544 0.069332 1.003 2
length{all}[20] 0.105737 0.011128 0.000234 0.313017 0.071217 1.000 2
length{all}[21] 0.103847 0.008680 0.000509 0.291160 0.081669 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006124
Maximum standard deviation of split frequencies = 0.017430
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 570
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 53 patterns at 190 / 190 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 53 patterns at 190 / 190 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
51728 bytes for conP
4664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.015322 0.063596 0.059065 0.093823 0.097799 0.074655 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -825.265454
Iterating by ming2
Initial: fx= 825.265454
x= 0.01532 0.06360 0.05907 0.09382 0.09780 0.07465 0.30000 1.30000
1 h-m-p 0.0000 0.0001 455.4899 ++ 808.306969 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0062 59.2019 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 416.1493 +++ 767.472080 m 0.0002 45 | 2/8
4 h-m-p 0.0019 0.0097 42.8068 ------------.. | 2/8
5 h-m-p 0.0000 0.0000 374.7505 ++ 764.050780 m 0.0000 77 | 3/8
6 h-m-p 0.0003 0.0180 29.9497 ----------.. | 3/8
7 h-m-p 0.0000 0.0001 324.4426 ++ 757.776697 m 0.0001 107 | 4/8
8 h-m-p 0.0007 0.0249 22.4674 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 265.0900 ++ 750.486638 m 0.0001 138 | 5/8
10 h-m-p 0.0013 0.0476 14.4469 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 188.0095 ++ 749.726597 m 0.0000 169 | 6/8
12 h-m-p 0.0490 8.0000 0.0000 Y 749.726597 0 0.1228 180 | 6/8
13 h-m-p 1.1983 8.0000 0.0000 ---Y 749.726597 0 0.0047 196
Out..
lnL = -749.726597
197 lfun, 197 eigenQcodon, 1182 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.051985 0.080596 0.071538 0.049216 0.043605 0.077898 0.299890 0.549833 0.537065
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.434280
np = 9
lnL0 = -818.812418
Iterating by ming2
Initial: fx= 818.812418
x= 0.05199 0.08060 0.07154 0.04922 0.04361 0.07790 0.29989 0.54983 0.53707
1 h-m-p 0.0000 0.0002 444.7544 +++ 770.973091 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0002 197.0370 ++ 765.719250 m 0.0002 27 | 2/9
3 h-m-p 0.0000 0.0000 17175.0965 ++ 763.585899 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 33456.6099 ++ 752.547343 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 3140.6086 ++ 750.210646 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 17970.8301 ++ 749.726564 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0002 ++ 749.726563 m 8.0000 87 | 6/9
8 h-m-p 0.0051 0.9361 0.3435 ++++ 749.726533 m 0.9361 104 | 7/9
9 h-m-p 0.5761 6.7239 0.1392 -----------C 749.726533 0 0.0000 130 | 7/9
10 h-m-p 0.0160 8.0000 0.0003 +++++ 749.726532 m 8.0000 147 | 7/9
11 h-m-p 0.0044 0.4758 0.6153 ---------Y 749.726532 0 0.0000 170 | 7/9
12 h-m-p 0.0160 8.0000 0.0001 -------N 749.726532 0 0.0000 191 | 7/9
13 h-m-p 0.0160 8.0000 0.0005 +++++ 749.726532 m 8.0000 208 | 7/9
14 h-m-p 0.0133 2.2297 0.3289 -----------Y 749.726532 0 0.0000 233 | 7/9
15 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
16 h-m-p 0.0160 8.0000 0.0002 +++++ 749.726531 m 8.0000 275 | 7/9
17 h-m-p 0.0045 2.2193 0.3235 ----------C 749.726531 0 0.0000 299 | 7/9
18 h-m-p 0.0160 8.0000 0.0156 +++++ 749.726503 m 8.0000 316 | 7/9
19 h-m-p 0.3458 2.2494 0.3603 -------------Y 749.726503 0 0.0000 343 | 7/9
20 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
21 h-m-p 0.0160 8.0000 0.0003 +++++ 749.726503 m 8.0000 385 | 7/9
22 h-m-p 0.0083 3.0812 0.2714 -------------.. | 7/9
23 h-m-p 0.0160 8.0000 0.0003 +++++ 749.726502 m 8.0000 427 | 7/9
24 h-m-p 0.0083 3.0920 0.2711 ----------Y 749.726502 0 0.0000 451 | 7/9
25 h-m-p 0.0160 8.0000 0.0005 +++++ 749.726501 m 8.0000 468 | 7/9
26 h-m-p 0.0121 1.4245 0.3135 -------------.. | 7/9
27 h-m-p 0.0160 8.0000 0.0003 +++++ 749.726500 m 8.0000 510 | 7/9
28 h-m-p 0.0086 3.1436 0.2684 ----------Y 749.726500 0 0.0000 534 | 7/9
29 h-m-p 0.0160 8.0000 0.0003 +++++ 749.726500 m 8.0000 551 | 7/9
30 h-m-p 0.0160 8.0000 0.6533 -------------.. | 7/9
31 h-m-p 0.0160 8.0000 0.0003 +++++ 749.726499 m 8.0000 593 | 7/9
32 h-m-p 0.0087 3.1657 0.2672 ----------Y 749.726499 0 0.0000 617 | 7/9
33 h-m-p 0.0160 8.0000 0.0001 +++++ 749.726499 m 8.0000 634 | 7/9
34 h-m-p 0.0073 3.6416 0.3192 ----------Y 749.726499 0 0.0000 658 | 7/9
35 h-m-p 0.0160 8.0000 0.0056 +++++ 749.726485 m 8.0000 675 | 7/9
36 h-m-p 0.1494 3.3786 0.2973 -------------Y 749.726485 0 0.0000 702 | 7/9
37 h-m-p 0.0160 8.0000 0.0003 -------C 749.726485 0 0.0000 723 | 7/9
38 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
39 h-m-p 0.0160 8.0000 0.0003 +++++ 749.726484 m 8.0000 765 | 7/9
40 h-m-p 0.0112 3.5478 0.2487 ----------C 749.726484 0 0.0000 789 | 7/9
41 h-m-p 0.0160 8.0000 0.0057 +++++ 749.726467 m 8.0000 806 | 7/9
42 h-m-p 0.1616 3.8050 0.2833 ---------------.. | 7/9
43 h-m-p 0.0160 8.0000 0.0004 +++++ 749.726466 m 8.0000 850 | 7/9
44 h-m-p 0.0147 4.0048 0.2293 ------------Y 749.726466 0 0.0000 876 | 7/9
45 h-m-p 0.0025 1.2599 0.1292 +++++ 749.726359 m 1.2599 893 | 8/9
46 h-m-p 0.4722 8.0000 0.1464 ------------C 749.726359 0 0.0000 919 | 8/9
47 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/9
48 h-m-p 0.0160 8.0000 0.0003 +++++ 749.726359 m 8.0000 959 | 8/9
49 h-m-p 0.0160 8.0000 0.7319 -----------C 749.726359 0 0.0000 983 | 8/9
50 h-m-p 0.0160 8.0000 0.0000 +++++ 749.726359 m 8.0000 999 | 8/9
51 h-m-p 0.0160 8.0000 0.8063 -------------.. | 8/9
52 h-m-p 0.0160 8.0000 0.0003 +++++ 749.726358 m 8.0000 1039 | 8/9
53 h-m-p 0.0160 8.0000 0.7222 -------------.. | 8/9
54 h-m-p 0.0160 8.0000 0.0003 +++++ 749.726357 m 8.0000 1079 | 8/9
55 h-m-p 0.0160 8.0000 0.7298 -------------.. | 8/9
56 h-m-p 0.0160 8.0000 0.0003 +++++ 749.726356 m 8.0000 1119 | 8/9
57 h-m-p 0.0160 8.0000 0.7209 -----------C 749.726356 0 0.0000 1143 | 8/9
58 h-m-p 0.0160 8.0000 0.0001 -------------.. | 8/9
59 h-m-p 0.0160 8.0000 0.0003 +++++ 749.726356 m 8.0000 1183 | 8/9
60 h-m-p 0.0160 8.0000 0.7263 -------------.. | 8/9
61 h-m-p 0.0160 8.0000 0.0003 +++++ 749.726355 m 8.0000 1223 | 8/9
62 h-m-p 0.0160 8.0000 0.7190 ------------Y 749.726355 0 0.0000 1248 | 8/9
63 h-m-p 0.0160 8.0000 0.0000 ---Y 749.726355 0 0.0001 1264 | 8/9
64 h-m-p 0.0160 8.0000 0.0000 +++++ 749.726355 m 8.0000 1280 | 8/9
65 h-m-p 0.0160 8.0000 0.6929 -------------.. | 8/9
66 h-m-p 0.0160 8.0000 0.0003 +++++ 749.726354 m 8.0000 1320 | 8/9
67 h-m-p 0.0160 8.0000 0.7230 ------------C 749.726354 0 0.0000 1345 | 8/9
68 h-m-p 0.0160 8.0000 0.0000 +++++ 749.726354 m 8.0000 1361 | 8/9
69 h-m-p 0.0160 8.0000 0.6897 -------------.. | 8/9
70 h-m-p 0.0160 8.0000 0.0003 +++++ 749.726353 m 8.0000 1401 | 8/9
71 h-m-p 0.0160 8.0000 0.7277 ------------Y 749.726353 0 0.0000 1426 | 8/9
72 h-m-p 0.0160 8.0000 0.0000 +++++ 749.726353 m 8.0000 1442 | 8/9
73 h-m-p 0.0160 8.0000 0.8283 -----------C 749.726353 0 0.0000 1466 | 8/9
74 h-m-p 0.0160 8.0000 0.0001 --------C 749.726353 0 0.0000 1487 | 8/9
75 h-m-p 0.0160 8.0000 0.0000 +++++ 749.726353 m 8.0000 1503 | 8/9
76 h-m-p 0.0160 8.0000 1.5024 ------------C 749.726353 0 0.0000 1528 | 8/9
77 h-m-p 0.0160 8.0000 0.0000 +++++ 749.726353 m 8.0000 1543 | 8/9
78 h-m-p 0.0026 1.2783 0.0051 +++++ 749.726351 m 1.2783 1559 | 9/9
79 h-m-p 0.0160 8.0000 0.0000 Y 749.726351 0 0.0160 1572 | 9/9
80 h-m-p 0.0160 8.0000 0.0000 Y 749.726351 0 0.0160 1584
Out..
lnL = -749.726351
1585 lfun, 4755 eigenQcodon, 19020 P(t)
Time used: 0:05
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.041228 0.031183 0.086638 0.108295 0.044720 0.078773 0.000100 1.465974 0.173877 0.169725 1.443464
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 14.014451
np = 11
lnL0 = -815.932918
Iterating by ming2
Initial: fx= 815.932918
x= 0.04123 0.03118 0.08664 0.10829 0.04472 0.07877 0.00011 1.46597 0.17388 0.16972 1.44346
1 h-m-p 0.0000 0.0000 381.6171 ++ 815.709036 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 318.8870 +++ 784.518009 m 0.0005 31 | 2/11
3 h-m-p 0.0000 0.0001 315.2606 ++ 777.297435 m 0.0001 45 | 3/11
4 h-m-p 0.0000 0.0002 115.8133 ++ 775.084386 m 0.0002 59 | 4/11
5 h-m-p 0.0000 0.0000 389.6540 ++ 772.182015 m 0.0000 73 | 5/11
6 h-m-p 0.0005 0.0061 22.4947 ++ 770.600738 m 0.0061 87 | 6/11
7 h-m-p 0.0001 0.0006 107.2901 ++ 765.344478 m 0.0006 101 | 7/11
8 h-m-p 0.0004 0.0065 122.5153 +++ 749.726503 m 0.0065 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0001 ++ 749.726503 m 8.0000 130 | 8/11
10 h-m-p 0.0160 8.0000 1.2419 -----------N 749.726503 0 0.0000 158 | 8/11
11 h-m-p 0.0160 8.0000 0.0007 +++++ 749.726502 m 8.0000 175 | 8/11
12 h-m-p 0.0160 8.0000 4.2880 -------------.. | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 749.726502 m 8.0000 220 | 8/11
14 h-m-p 0.0018 0.9100 2.9012 +++++ 749.726368 m 0.9100 240 | 9/11
15 h-m-p 1.6000 8.0000 0.8727 ++ 749.726351 m 8.0000 254 | 9/11
16 h-m-p 1.6000 8.0000 0.0067 ++ 749.726351 m 8.0000 270 | 9/11
17 h-m-p 0.0693 8.0000 0.7764 ++++ 749.726351 m 8.0000 288 | 9/11
18 h-m-p 1.6000 8.0000 0.1214 ++ 749.726351 m 8.0000 304 | 9/11
19 h-m-p 1.6000 8.0000 0.3877 ++ 749.726351 m 8.0000 320 | 9/11
20 h-m-p 1.6000 8.0000 0.0000 N 749.726351 0 1.6000 336 | 9/11
21 h-m-p 0.0160 8.0000 0.0000 N 749.726351 0 0.0160 352
Out..
lnL = -749.726351
353 lfun, 1412 eigenQcodon, 6354 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -749.764312 S = -749.727117 -0.014325
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:06
did 20 / 53 patterns 0:06
did 30 / 53 patterns 0:06
did 40 / 53 patterns 0:06
did 50 / 53 patterns 0:06
did 53 / 53 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.027415 0.057540 0.079921 0.102285 0.067350 0.098862 0.000100 1.186559 1.657746
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.979825
np = 9
lnL0 = -826.672497
Iterating by ming2
Initial: fx= 826.672497
x= 0.02742 0.05754 0.07992 0.10229 0.06735 0.09886 0.00011 1.18656 1.65775
1 h-m-p 0.0000 0.0000 418.1548 ++ 826.401887 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0180 52.9031 +++++ 793.218672 m 0.0180 29 | 2/9
3 h-m-p 0.0001 0.0006 84.8248 ++ 785.992007 m 0.0006 41 | 3/9
4 h-m-p 0.0001 0.0017 265.9605 ++ 763.766286 m 0.0017 53 | 4/9
5 h-m-p 0.0000 0.0002 206.3822 ++ 762.863412 m 0.0002 65 | 5/9
6 h-m-p 0.0000 0.0000 30937.4625 ++ 760.430193 m 0.0000 77 | 6/9
7 h-m-p 0.0007 0.0034 61.5253 ++ 759.357430 m 0.0034 89 | 7/9
8 h-m-p 0.0066 3.0969 31.3208
QuantileBeta(0.15, 0.00500, 2.24771) = 1.162377e-160 2000 rounds
------------.. | 7/9
9 h-m-p 0.0000 0.0003 167.1936 +++ 749.726351 m 0.0003 124 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 +N 749.726351 0 4.0000 137 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 N 749.726351 0 1.6000 150
Out..
lnL = -749.726351
151 lfun, 1661 eigenQcodon, 9060 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.092663 0.072249 0.056876 0.071990 0.101331 0.028876 0.000100 0.900000 0.998196 1.619179 1.299881
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.821265
np = 11
lnL0 = -823.575983
Iterating by ming2
Initial: fx= 823.575983
x= 0.09266 0.07225 0.05688 0.07199 0.10133 0.02888 0.00011 0.90000 0.99820 1.61918 1.29988
1 h-m-p 0.0000 0.0000 402.3840 ++ 823.326219 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0014 159.0683 ++++ 793.642783 m 0.0014 32 | 2/11
3 h-m-p 0.0000 0.0002 523.9908 ++ 769.092065 m 0.0002 46 | 3/11
4 h-m-p 0.0011 0.0057 50.7128 ++ 760.263620 m 0.0057 60 | 4/11
5 h-m-p 0.0000 0.0000 43542.8428 ++ 760.141222 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0000 103216.9181 ++ 752.298916 m 0.0000 88 | 6/11
7 h-m-p 0.0000 0.0000 97870.6498 ++ 749.726550 m 0.0000 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0001 ++ 749.726550 m 8.0000 116 | 7/11
9 h-m-p 0.0064 3.1993 0.2630 ---------C 749.726550 0 0.0000 143 | 7/11
10 h-m-p 0.0160 8.0000 0.0144 +++++ 749.726519 m 8.0000 164 | 7/11
11 h-m-p 0.3943 3.4326 0.2928 ---------------.. | 7/11
12 h-m-p 0.0160 8.0000 0.0004 +++++ 749.726518 m 8.0000 216 | 7/11
13 h-m-p 0.0188 5.1025 0.1669 ----------C 749.726518 0 0.0000 244 | 7/11
14 h-m-p 0.0160 8.0000 0.0006 +++++ 749.726517 m 8.0000 265 | 7/11
15 h-m-p 0.0206 6.8328 0.2266 -----------C 749.726517 0 0.0000 294 | 7/11
16 h-m-p 0.0160 8.0000 0.0006 +++++ 749.726516 m 8.0000 315 | 7/11
17 h-m-p 0.0123 3.1018 0.4091 -------------.. | 7/11
18 h-m-p 0.0160 8.0000 0.0004 +++++ 749.726515 m 8.0000 365 | 7/11
19 h-m-p 0.0202 5.2772 0.1626 -------------.. | 7/11
20 h-m-p 0.0160 8.0000 0.0004 +++++ 749.726513 m 8.0000 415 | 7/11
21 h-m-p 0.0209 5.3556 0.1609 ------------C 749.726513 0 0.0000 445 | 7/11
22 h-m-p 0.0160 8.0000 0.0162 +++++ 749.726422 m 8.0000 466 | 7/11
23 h-m-p 0.6429 4.8723 0.2010 ----------------.. | 7/11
24 h-m-p 0.0160 8.0000 0.0012 +++++ 749.726410 m 8.0000 519 | 7/11
25 h-m-p 0.1002 8.0000 0.0961 -------------Y 749.726410 0 0.0000 550 | 7/11
26 h-m-p 0.0073 3.6684 0.0071 +++++ 749.726373 m 3.6684 571 | 8/11
27 h-m-p 0.2648 8.0000 0.0592 ------------N 749.726373 0 0.0000 601 | 8/11
28 h-m-p 0.0160 8.0000 0.0017 +++++ 749.726368 m 8.0000 621 | 8/11
29 h-m-p 0.0413 8.0000 0.3289 ------------N 749.726368 0 0.0000 650 | 8/11
30 h-m-p 0.0037 1.8592 0.0259 +++++ 749.726351 m 1.8592 670 | 9/11
31 h-m-p 1.6000 8.0000 0.0000 Y 749.726351 0 1.6000 687 | 9/11
32 h-m-p 0.0599 8.0000 0.0002 -N 749.726351 0 0.0037 704 | 9/11
33 h-m-p 0.0771 8.0000 0.0000 ---Y 749.726351 0 0.0003 723
Out..
lnL = -749.726351
724 lfun, 8688 eigenQcodon, 47784 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -749.775527 S = -749.727117 -0.021448
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:20
did 20 / 53 patterns 0:21
did 30 / 53 patterns 0:21
did 40 / 53 patterns 0:21
did 50 / 53 patterns 0:21
did 53 / 53 patterns 0:21
Time used: 0:21
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=190
NC_011896_1_WP_010908555_1_1935_MLBR_RS09185 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
NC_002677_1_NP_302234_1_1106_ML1813 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
NZ_LVXE01000020_1_WP_010908555_1_887_A3216_RS07310 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
NZ_LYPH01000025_1_WP_010908555_1_1043_A8144_RS04970 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
NZ_CP029543_1_WP_010908555_1_1964_DIJ64_RS10000 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
NZ_AP014567_1_WP_010908555_1_2013_JK2ML_RS10245 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
**************************************************
NC_011896_1_WP_010908555_1_1935_MLBR_RS09185 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
NC_002677_1_NP_302234_1_1106_ML1813 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
NZ_LVXE01000020_1_WP_010908555_1_887_A3216_RS07310 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
NZ_LYPH01000025_1_WP_010908555_1_1043_A8144_RS04970 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
NZ_CP029543_1_WP_010908555_1_1964_DIJ64_RS10000 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
NZ_AP014567_1_WP_010908555_1_2013_JK2ML_RS10245 EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
**************************************************
NC_011896_1_WP_010908555_1_1935_MLBR_RS09185 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
NC_002677_1_NP_302234_1_1106_ML1813 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
NZ_LVXE01000020_1_WP_010908555_1_887_A3216_RS07310 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
NZ_LYPH01000025_1_WP_010908555_1_1043_A8144_RS04970 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
NZ_CP029543_1_WP_010908555_1_1964_DIJ64_RS10000 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
NZ_AP014567_1_WP_010908555_1_2013_JK2ML_RS10245 YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
**************************************************
NC_011896_1_WP_010908555_1_1935_MLBR_RS09185 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
NC_002677_1_NP_302234_1_1106_ML1813 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
NZ_LVXE01000020_1_WP_010908555_1_887_A3216_RS07310 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
NZ_LYPH01000025_1_WP_010908555_1_1043_A8144_RS04970 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
NZ_CP029543_1_WP_010908555_1_1964_DIJ64_RS10000 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
NZ_AP014567_1_WP_010908555_1_2013_JK2ML_RS10245 LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
****************************************
>NC_011896_1_WP_010908555_1_1935_MLBR_RS09185 ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG AAGACGTTAATCGGGCTGAT >NC_002677_1_NP_302234_1_1106_ML1813 ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG AAGACGTTAATCGGGCTGAT >NZ_LVXE01000020_1_WP_010908555_1_887_A3216_RS07310 ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG AAGACGTTAATCGGGCTGAT >NZ_LYPH01000025_1_WP_010908555_1_1043_A8144_RS04970 ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG AAGACGTTAATCGGGCTGAT >NZ_CP029543_1_WP_010908555_1_1964_DIJ64_RS10000 ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG AAGACGTTAATCGGGCTGAT >NZ_AP014567_1_WP_010908555_1_2013_JK2ML_RS10245 ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG AAGACGTTAATCGGGCTGAT
>NC_011896_1_WP_010908555_1_1935_MLBR_RS09185 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD >NC_002677_1_NP_302234_1_1106_ML1813 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD >NZ_LVXE01000020_1_WP_010908555_1_887_A3216_RS07310 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD >NZ_LYPH01000025_1_WP_010908555_1_1043_A8144_RS04970 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD >NZ_CP029543_1_WP_010908555_1_1964_DIJ64_RS10000 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD >NZ_AP014567_1_WP_010908555_1_2013_JK2ML_RS10245 MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
#NEXUS
[ID: 5762428659]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908555_1_1935_MLBR_RS09185
NC_002677_1_NP_302234_1_1106_ML1813
NZ_LVXE01000020_1_WP_010908555_1_887_A3216_RS07310
NZ_LYPH01000025_1_WP_010908555_1_1043_A8144_RS04970
NZ_CP029543_1_WP_010908555_1_1964_DIJ64_RS10000
NZ_AP014567_1_WP_010908555_1_2013_JK2ML_RS10245
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908555_1_1935_MLBR_RS09185,
2 NC_002677_1_NP_302234_1_1106_ML1813,
3 NZ_LVXE01000020_1_WP_010908555_1_887_A3216_RS07310,
4 NZ_LYPH01000025_1_WP_010908555_1_1043_A8144_RS04970,
5 NZ_CP029543_1_WP_010908555_1_1964_DIJ64_RS10000,
6 NZ_AP014567_1_WP_010908555_1_2013_JK2ML_RS10245
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06730397,2:0.06602062,3:0.06792506,4:0.06934934,5:0.06945191,6:0.07034061);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06730397,2:0.06602062,3:0.06792506,4:0.06934934,5:0.06945191,6:0.07034061);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -786.73 -790.05
2 -786.83 -790.91
--------------------------------------
TOTAL -786.78 -790.57
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894099 0.090495 0.345104 1.482300 0.862708 1232.65 1366.83 1.000
r(A<->C){all} 0.165365 0.018838 0.000004 0.458322 0.131201 224.72 226.45 1.001
r(A<->G){all} 0.180811 0.022424 0.000028 0.480672 0.143756 189.73 211.36 1.001
r(A<->T){all} 0.163228 0.018112 0.000085 0.431733 0.131895 166.20 243.91 1.000
r(C<->G){all} 0.168004 0.019690 0.000048 0.449079 0.132172 158.21 173.33 1.003
r(C<->T){all} 0.173016 0.020604 0.000258 0.467257 0.133306 160.01 220.28 1.003
r(G<->T){all} 0.149577 0.015585 0.000062 0.395052 0.117434 194.05 240.90 1.002
pi(A){all} 0.210923 0.000288 0.179892 0.244932 0.210499 1322.08 1338.43 1.000
pi(C){all} 0.285534 0.000352 0.249148 0.322775 0.285570 1186.86 1211.17 1.000
pi(G){all} 0.280703 0.000355 0.243465 0.315475 0.280325 1262.98 1285.98 1.000
pi(T){all} 0.222840 0.000315 0.188532 0.257229 0.222525 1213.61 1262.62 1.000
alpha{1,2} 0.411411 0.227608 0.000249 1.406530 0.242573 1316.78 1352.43 1.001
alpha{3} 0.456043 0.233509 0.000154 1.421922 0.304782 1171.61 1244.23 1.000
pinvar{all} 0.997119 0.000012 0.990698 0.999998 0.998190 865.64 1115.80 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1813/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 190
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 2 2 2 2 2 2 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0
Leu TTA 3 3 3 3 3 3 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 6 6 6 6 6 6 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 3 3 3 3 3 3 | His CAT 2 2 2 2 2 2 | Arg CGT 1 1 1 1 1 1
CTC 4 4 4 4 4 4 | CCC 4 4 4 4 4 4 | CAC 1 1 1 1 1 1 | CGC 2 2 2 2 2 2
CTA 3 3 3 3 3 3 | CCA 1 1 1 1 1 1 | Gln CAA 3 3 3 3 3 3 | CGA 1 1 1 1 1 1
CTG 4 4 4 4 4 4 | CCG 6 6 6 6 6 6 | CAG 6 6 6 6 6 6 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 2 2 2 2 2 2 | Asn AAT 3 3 3 3 3 3 | Ser AGT 1 1 1 1 1 1
ATC 8 8 8 8 8 8 | ACC 6 6 6 6 6 6 | AAC 5 5 5 5 5 5 | AGC 5 5 5 5 5 5
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 5 5 5 5 5 5 | ACG 5 5 5 5 5 5 | AAG 4 4 4 4 4 4 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 6 6 6 6 6 6 | Ala GCT 2 2 2 2 2 2 | Asp GAT 9 9 9 9 9 9 | Gly GGT 3 3 3 3 3 3
GTC 8 8 8 8 8 8 | GCC 9 9 9 9 9 9 | GAC 3 3 3 3 3 3 | GGC 5 5 5 5 5 5
GTA 2 2 2 2 2 2 | GCA 3 3 3 3 3 3 | Glu GAA 4 4 4 4 4 4 | GGA 0 0 0 0 0 0
GTG 8 8 8 8 8 8 | GCG 5 5 5 5 5 5 | GAG 4 4 4 4 4 4 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908555_1_1935_MLBR_RS09185
position 1: T:0.12105 C:0.23158 A:0.25263 G:0.39474
position 2: T:0.33684 C:0.27368 A:0.25789 G:0.13158
position 3: T:0.21053 C:0.35263 A:0.12105 G:0.31579
Average T:0.22281 C:0.28596 A:0.21053 G:0.28070
#2: NC_002677_1_NP_302234_1_1106_ML1813
position 1: T:0.12105 C:0.23158 A:0.25263 G:0.39474
position 2: T:0.33684 C:0.27368 A:0.25789 G:0.13158
position 3: T:0.21053 C:0.35263 A:0.12105 G:0.31579
Average T:0.22281 C:0.28596 A:0.21053 G:0.28070
#3: NZ_LVXE01000020_1_WP_010908555_1_887_A3216_RS07310
position 1: T:0.12105 C:0.23158 A:0.25263 G:0.39474
position 2: T:0.33684 C:0.27368 A:0.25789 G:0.13158
position 3: T:0.21053 C:0.35263 A:0.12105 G:0.31579
Average T:0.22281 C:0.28596 A:0.21053 G:0.28070
#4: NZ_LYPH01000025_1_WP_010908555_1_1043_A8144_RS04970
position 1: T:0.12105 C:0.23158 A:0.25263 G:0.39474
position 2: T:0.33684 C:0.27368 A:0.25789 G:0.13158
position 3: T:0.21053 C:0.35263 A:0.12105 G:0.31579
Average T:0.22281 C:0.28596 A:0.21053 G:0.28070
#5: NZ_CP029543_1_WP_010908555_1_1964_DIJ64_RS10000
position 1: T:0.12105 C:0.23158 A:0.25263 G:0.39474
position 2: T:0.33684 C:0.27368 A:0.25789 G:0.13158
position 3: T:0.21053 C:0.35263 A:0.12105 G:0.31579
Average T:0.22281 C:0.28596 A:0.21053 G:0.28070
#6: NZ_AP014567_1_WP_010908555_1_2013_JK2ML_RS10245
position 1: T:0.12105 C:0.23158 A:0.25263 G:0.39474
position 2: T:0.33684 C:0.27368 A:0.25789 G:0.13158
position 3: T:0.21053 C:0.35263 A:0.12105 G:0.31579
Average T:0.22281 C:0.28596 A:0.21053 G:0.28070
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 6 | TCC 12 | TAC 24 | TGC 0
Leu L TTA 18 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 36 | TCG 0 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 18 | His H CAT 12 | Arg R CGT 6
CTC 24 | CCC 24 | CAC 6 | CGC 12
CTA 18 | CCA 6 | Gln Q CAA 18 | CGA 6
CTG 24 | CCG 36 | CAG 36 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 12 | Asn N AAT 18 | Ser S AGT 6
ATC 48 | ACC 36 | AAC 30 | AGC 30
ATA 0 | ACA 6 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 30 | ACG 30 | AAG 24 | AGG 0
------------------------------------------------------------------------------
Val V GTT 36 | Ala A GCT 12 | Asp D GAT 54 | Gly G GGT 18
GTC 48 | GCC 54 | GAC 18 | GGC 30
GTA 12 | GCA 18 | Glu E GAA 24 | GGA 0
GTG 48 | GCG 30 | GAG 24 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12105 C:0.23158 A:0.25263 G:0.39474
position 2: T:0.33684 C:0.27368 A:0.25789 G:0.13158
position 3: T:0.21053 C:0.35263 A:0.12105 G:0.31579
Average T:0.22281 C:0.28596 A:0.21053 G:0.28070
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -749.726597 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299890 1.299881
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908555_1_1935_MLBR_RS09185: 0.000004, NC_002677_1_NP_302234_1_1106_ML1813: 0.000004, NZ_LVXE01000020_1_WP_010908555_1_887_A3216_RS07310: 0.000004, NZ_LYPH01000025_1_WP_010908555_1_1043_A8144_RS04970: 0.000004, NZ_CP029543_1_WP_010908555_1_1964_DIJ64_RS10000: 0.000004, NZ_AP014567_1_WP_010908555_1_2013_JK2ML_RS10245: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29989
omega (dN/dS) = 1.29988
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 433.0 137.0 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 433.0 137.0 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 433.0 137.0 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 433.0 137.0 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 433.0 137.0 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 433.0 137.0 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -749.726351 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908555_1_1935_MLBR_RS09185: 0.000004, NC_002677_1_NP_302234_1_1106_ML1813: 0.000004, NZ_LVXE01000020_1_WP_010908555_1_887_A3216_RS07310: 0.000004, NZ_LYPH01000025_1_WP_010908555_1_1043_A8144_RS04970: 0.000004, NZ_CP029543_1_WP_010908555_1_1964_DIJ64_RS10000: 0.000004, NZ_AP014567_1_WP_010908555_1_2013_JK2ML_RS10245: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -749.726351 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908555_1_1935_MLBR_RS09185: 0.000004, NC_002677_1_NP_302234_1_1106_ML1813: 0.000004, NZ_LVXE01000020_1_WP_010908555_1_887_A3216_RS07310: 0.000004, NZ_LYPH01000025_1_WP_010908555_1_1043_A8144_RS04970: 0.000004, NZ_CP029543_1_WP_010908555_1_1964_DIJ64_RS10000: 0.000004, NZ_AP014567_1_WP_010908555_1_2013_JK2ML_RS10245: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908555_1_1935_MLBR_RS09185)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -749.726351 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 2.040781
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908555_1_1935_MLBR_RS09185: 0.000004, NC_002677_1_NP_302234_1_1106_ML1813: 0.000004, NZ_LVXE01000020_1_WP_010908555_1_887_A3216_RS07310: 0.000004, NZ_LYPH01000025_1_WP_010908555_1_1043_A8144_RS04970: 0.000004, NZ_CP029543_1_WP_010908555_1_1964_DIJ64_RS10000: 0.000004, NZ_AP014567_1_WP_010908555_1_2013_JK2ML_RS10245: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 2.04078
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -749.726351 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.983325 2.028021
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908555_1_1935_MLBR_RS09185: 0.000004, NC_002677_1_NP_302234_1_1106_ML1813: 0.000004, NZ_LVXE01000020_1_WP_010908555_1_887_A3216_RS07310: 0.000004, NZ_LYPH01000025_1_WP_010908555_1_1043_A8144_RS04970: 0.000004, NZ_CP029543_1_WP_010908555_1_1964_DIJ64_RS10000: 0.000004, NZ_AP014567_1_WP_010908555_1_2013_JK2ML_RS10245: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.98332
(p1 = 0.00001) w = 2.02802
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 2.02802
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 439.1 130.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908555_1_1935_MLBR_RS09185)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.096 0.097 0.098 0.099 0.100 0.100 0.101 0.102 0.103 0.104
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.097
Time used: 0:21
Model 1: NearlyNeutral -749.726351 Model 2: PositiveSelection -749.726351 Model 0: one-ratio -749.726597 Model 7: beta -749.726351 Model 8: beta&w>1 -749.726351 Model 0 vs 1 4.919999998946878E-4 Model 2 vs 1 0.0 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
