--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:50:42 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1813/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -786.73          -790.05
2       -786.83          -790.91
--------------------------------------
TOTAL     -786.78          -790.57
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.894099    0.090495    0.345104    1.482300    0.862708   1232.65   1366.83    1.000
r(A<->C){all}   0.165365    0.018838    0.000004    0.458322    0.131201    224.72    226.45    1.001
r(A<->G){all}   0.180811    0.022424    0.000028    0.480672    0.143756    189.73    211.36    1.001
r(A<->T){all}   0.163228    0.018112    0.000085    0.431733    0.131895    166.20    243.91    1.000
r(C<->G){all}   0.168004    0.019690    0.000048    0.449079    0.132172    158.21    173.33    1.003
r(C<->T){all}   0.173016    0.020604    0.000258    0.467257    0.133306    160.01    220.28    1.003
r(G<->T){all}   0.149577    0.015585    0.000062    0.395052    0.117434    194.05    240.90    1.002
pi(A){all}      0.210923    0.000288    0.179892    0.244932    0.210499   1322.08   1338.43    1.000
pi(C){all}      0.285534    0.000352    0.249148    0.322775    0.285570   1186.86   1211.17    1.000
pi(G){all}      0.280703    0.000355    0.243465    0.315475    0.280325   1262.98   1285.98    1.000
pi(T){all}      0.222840    0.000315    0.188532    0.257229    0.222525   1213.61   1262.62    1.000
alpha{1,2}      0.411411    0.227608    0.000249    1.406530    0.242573   1316.78   1352.43    1.001
alpha{3}        0.456043    0.233509    0.000154    1.421922    0.304782   1171.61   1244.23    1.000
pinvar{all}     0.997119    0.000012    0.990698    0.999998    0.998190    865.64   1115.80    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-749.726351
Model 2: PositiveSelection	-749.726351
Model 0: one-ratio	-749.726597
Model 7: beta	-749.726351
Model 8: beta&w>1	-749.726351


Model 0 vs 1	4.919999998946878E-4

Model 2 vs 1	0.0

Model 8 vs 7	0.0
>C1
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C2
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C3
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C4
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C5
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C6
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=190 

C1              MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C2              MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C3              MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C4              MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C5              MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C6              MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
                **************************************************

C1              EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C2              EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C3              EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C4              EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C5              EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C6              EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
                **************************************************

C1              YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C2              YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C3              YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C4              YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C5              YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C6              YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
                **************************************************

C1              LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C2              LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C3              LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C4              LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C5              LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C6              LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
                ****************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  190 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  190 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5700]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5700]--->[5700]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.478 Mb, Max= 30.731 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C2              MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C3              MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C4              MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C5              MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
C6              MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
                **************************************************

C1              EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C2              EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C3              EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C4              EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C5              EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
C6              EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
                **************************************************

C1              YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C2              YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C3              YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C4              YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C5              YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
C6              YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
                **************************************************

C1              LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C2              LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C3              LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C4              LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C5              LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
C6              LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
                ****************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
C2              ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
C3              ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
C4              ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
C5              ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
C6              ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
                **************************************************

C1              ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
C2              ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
C3              ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
C4              ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
C5              ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
C6              ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
                **************************************************

C1              TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
C2              TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
C3              TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
C4              TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
C5              TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
C6              TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
                **************************************************

C1              GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
C2              GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
C3              GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
C4              GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
C5              GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
C6              GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
                **************************************************

C1              GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
C2              GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
C3              GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
C4              GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
C5              GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
C6              GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
                **************************************************

C1              TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
C2              TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
C3              TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
C4              TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
C5              TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
C6              TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
                **************************************************

C1              TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
C2              TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
C3              TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
C4              TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
C5              TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
C6              TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
                **************************************************

C1              GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
C2              GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
C3              GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
C4              GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
C5              GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
C6              GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
                **************************************************

C1              TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
C2              TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
C3              TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
C4              TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
C5              TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
C6              TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
                **************************************************

C1              TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
C2              TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
C3              TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
C4              TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
C5              TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
C6              TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
                **************************************************

C1              GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
C2              GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
C3              GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
C4              GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
C5              GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
C6              GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
                **************************************************

C1              AAGACGTTAATCGGGCTGAT
C2              AAGACGTTAATCGGGCTGAT
C3              AAGACGTTAATCGGGCTGAT
C4              AAGACGTTAATCGGGCTGAT
C5              AAGACGTTAATCGGGCTGAT
C6              AAGACGTTAATCGGGCTGAT
                ********************



>C1
ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
AAGACGTTAATCGGGCTGAT
>C2
ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
AAGACGTTAATCGGGCTGAT
>C3
ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
AAGACGTTAATCGGGCTGAT
>C4
ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
AAGACGTTAATCGGGCTGAT
>C5
ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
AAGACGTTAATCGGGCTGAT
>C6
ATGACCGGTCAAGATGTTGTCGTTCAGCAACCTCAGACGATTCCCATGCT
ACCGATCTATATTCCGCAAGATGTCGATATGACCGTGGTTAAGTCTGAAG
TCGCCGCGGCCGGGGTCAGTGCGTCACCGGCTGCCATGCCGGGGTTACTC
GAGGTAGTGAGCCATGCGCAGGCCGAGGGTATCAACCTCAAGATCGTGTT
GCTAGACCACAACCTCCCGAACGACACGCCCTTGCGCGATATCGCCACCG
TGGTTGGCGCCGATTACCCAGATGTCACGGTTCTCACGCTTAGCCCTAAC
TACGTCGGCAGCTACAGCACGCATTACCCGCGTGTCACTTTGGAGGCGGG
GGAAGATATCTCCAAGACCGGCAACCCCGTGCAGTCCGCGCAGAATTTCC
TGGGTGAACTAAATGTCCCCGAGTTTCCTTGGACCGTGTTGACCATTGTA
TTGTTGATCGGGGTGCTGGTGGCAGCCATCGGCACTCGGTTTATGCAGCT
GCGCAGCAAGCGATTAGCAACATCATTAGATGCCGCCGGCATCCTGGCAG
AAGACGTTAATCGGGCTGAT
>C1
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C2
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C3
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C4
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C5
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD
>C6
MTGQDVVVQQPQTIPMLPIYIPQDVDMTVVKSEVAAAGVSASPAAMPGLL
EVVSHAQAEGINLKIVLLDHNLPNDTPLRDIATVVGADYPDVTVLTLSPN
YVGSYSTHYPRVTLEAGEDISKTGNPVQSAQNFLGELNVPEFPWTVLTIV
LLIGVLVAAIGTRFMQLRSKRLATSLDAAGILAEDVNRAD


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 570 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579859352
      Setting output file names to "/data/7res/ML1813/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1369769605
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5762428659
      Seed = 772022519
      Swapseed = 1579859352
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1275.687132 -- -24.965149
         Chain 2 -- -1275.687327 -- -24.965149
         Chain 3 -- -1275.687327 -- -24.965149
         Chain 4 -- -1275.687253 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1275.687132 -- -24.965149
         Chain 2 -- -1275.687327 -- -24.965149
         Chain 3 -- -1275.687327 -- -24.965149
         Chain 4 -- -1275.687327 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1275.687] (-1275.687) (-1275.687) (-1275.687) * [-1275.687] (-1275.687) (-1275.687) (-1275.687) 
        500 -- (-799.345) (-800.288) [-796.644] (-797.560) * (-804.019) (-801.742) (-808.539) [-799.991] -- 0:00:00
       1000 -- (-794.446) (-802.688) [-793.580] (-798.951) * (-801.461) (-792.554) (-795.616) [-792.307] -- 0:00:00
       1500 -- (-791.182) (-799.205) [-793.569] (-799.085) * (-797.867) [-796.900] (-797.575) (-804.901) -- 0:00:00
       2000 -- (-801.538) (-792.886) [-795.801] (-799.459) * (-791.937) [-798.992] (-796.432) (-800.104) -- 0:00:00
       2500 -- (-804.867) (-794.809) (-802.738) [-797.191] * (-801.130) (-793.805) (-793.275) [-798.076] -- 0:00:00
       3000 -- [-790.029] (-800.438) (-793.262) (-795.494) * (-806.315) (-804.155) (-796.637) [-798.766] -- 0:00:00
       3500 -- [-792.993] (-796.939) (-799.628) (-798.902) * [-792.397] (-793.753) (-795.750) (-793.929) -- 0:00:00
       4000 -- (-803.239) (-799.357) [-792.099] (-803.007) * [-790.772] (-794.257) (-796.832) (-799.428) -- 0:00:00
       4500 -- [-806.404] (-796.477) (-801.678) (-799.462) * (-792.728) [-797.064] (-800.126) (-798.270) -- 0:00:00
       5000 -- (-801.088) (-801.682) (-795.344) [-799.297] * (-797.202) (-798.820) (-797.314) [-802.877] -- 0:00:00

      Average standard deviation of split frequencies: 0.102138

       5500 -- (-800.084) (-792.575) (-794.518) [-793.745] * [-797.254] (-804.311) (-798.386) (-795.268) -- 0:00:00
       6000 -- (-801.406) (-790.125) [-803.453] (-792.159) * [-795.829] (-793.980) (-795.627) (-793.781) -- 0:00:00
       6500 -- [-785.670] (-802.128) (-797.157) (-797.395) * (-791.784) (-798.126) [-794.710] (-798.768) -- 0:00:00
       7000 -- (-787.047) [-792.200] (-791.563) (-801.271) * [-797.978] (-798.308) (-795.648) (-793.630) -- 0:00:00
       7500 -- (-786.162) (-798.470) (-800.432) [-795.514] * [-798.372] (-809.231) (-803.314) (-805.546) -- 0:00:00
       8000 -- [-787.053] (-800.554) (-796.308) (-804.156) * (-803.761) (-803.026) (-799.335) [-794.351] -- 0:00:00
       8500 -- (-786.243) [-797.524] (-800.070) (-795.895) * (-801.359) (-802.558) [-792.593] (-798.820) -- 0:00:00
       9000 -- (-786.407) (-806.093) (-791.984) [-802.042] * (-796.307) (-801.326) [-791.681] (-797.315) -- 0:00:00
       9500 -- (-787.942) [-793.512] (-795.037) (-792.736) * (-800.462) (-795.042) (-797.869) [-803.501] -- 0:00:00
      10000 -- (-785.619) [-793.340] (-808.219) (-804.528) * (-792.864) (-792.600) [-797.858] (-793.378) -- 0:00:00

      Average standard deviation of split frequencies: 0.068746

      10500 -- (-786.294) [-794.577] (-796.755) (-799.566) * (-791.566) (-797.619) [-794.952] (-801.053) -- 0:01:34
      11000 -- (-787.840) (-794.902) [-795.935] (-798.032) * (-810.448) [-803.082] (-797.967) (-798.010) -- 0:01:29
      11500 -- (-787.032) [-795.643] (-797.410) (-792.355) * (-796.637) (-793.206) [-800.694] (-795.838) -- 0:01:25
      12000 -- (-787.956) (-797.964) [-792.671] (-791.860) * (-794.537) [-795.561] (-798.509) (-798.008) -- 0:01:22
      12500 -- (-790.183) [-793.204] (-797.507) (-795.489) * [-796.581] (-791.725) (-800.731) (-793.090) -- 0:01:19
      13000 -- (-790.620) [-790.712] (-792.536) (-795.468) * (-796.847) (-789.549) (-795.294) [-798.583] -- 0:01:15
      13500 -- (-787.698) [-793.533] (-803.123) (-792.772) * (-800.936) (-792.567) [-800.349] (-802.835) -- 0:01:13
      14000 -- (-787.682) (-791.529) [-792.566] (-799.201) * (-791.936) (-793.891) [-791.751] (-797.346) -- 0:01:10
      14500 -- (-787.220) (-799.228) (-797.520) [-799.787] * (-794.036) [-795.303] (-795.606) (-797.853) -- 0:01:07
      15000 -- (-786.768) (-796.752) [-800.963] (-799.368) * (-802.785) [-796.831] (-795.373) (-798.095) -- 0:01:05

      Average standard deviation of split frequencies: 0.073657

      15500 -- (-791.194) [-793.876] (-801.979) (-797.145) * (-792.738) (-803.665) (-803.036) [-795.897] -- 0:01:03
      16000 -- (-790.103) (-795.057) [-801.303] (-795.063) * (-800.901) [-792.223] (-795.365) (-798.297) -- 0:01:01
      16500 -- (-790.672) [-794.818] (-795.417) (-790.456) * (-808.014) (-792.906) [-798.185] (-804.588) -- 0:00:59
      17000 -- (-787.392) [-799.085] (-801.610) (-801.296) * (-790.371) (-805.804) [-789.605] (-795.536) -- 0:00:57
      17500 -- (-787.991) (-794.191) [-800.453] (-789.228) * [-786.250] (-795.385) (-789.067) (-793.565) -- 0:00:56
      18000 -- (-786.078) (-800.569) [-800.000] (-790.479) * (-786.736) (-797.037) [-786.095] (-804.456) -- 0:00:54
      18500 -- (-785.759) (-805.365) [-790.997] (-793.675) * (-787.628) (-801.639) [-785.780] (-794.540) -- 0:00:53
      19000 -- [-785.759] (-793.562) (-797.933) (-790.090) * (-796.365) [-794.883] (-785.543) (-795.283) -- 0:00:51
      19500 -- (-792.040) (-795.076) [-798.523] (-789.813) * (-792.745) (-795.766) [-785.313] (-795.624) -- 0:00:50
      20000 -- [-790.890] (-797.805) (-793.568) (-788.719) * (-790.742) [-795.236] (-787.334) (-795.692) -- 0:00:49

      Average standard deviation of split frequencies: 0.062727

      20500 -- (-785.735) (-798.330) (-795.943) [-788.029] * (-786.449) [-796.988] (-787.528) (-796.221) -- 0:00:47
      21000 -- [-787.514] (-794.762) (-799.770) (-788.708) * [-787.438] (-791.430) (-786.703) (-797.612) -- 0:00:46
      21500 -- (-786.588) [-805.107] (-804.097) (-786.090) * (-787.906) (-793.240) [-786.611] (-795.905) -- 0:00:45
      22000 -- [-788.042] (-802.662) (-796.463) (-786.226) * [-787.143] (-797.064) (-786.684) (-805.019) -- 0:01:28
      22500 -- (-789.048) (-795.314) [-795.918] (-787.409) * [-788.921] (-794.289) (-786.090) (-802.957) -- 0:01:26
      23000 -- (-788.228) [-795.687] (-799.388) (-786.902) * [-785.869] (-796.356) (-787.476) (-803.357) -- 0:01:24
      23500 -- (-786.495) (-792.424) (-797.861) [-787.669] * [-787.205] (-798.757) (-785.656) (-796.616) -- 0:01:23
      24000 -- [-787.937] (-789.574) (-797.292) (-788.697) * [-788.567] (-801.858) (-789.261) (-794.687) -- 0:01:21
      24500 -- (-785.740) (-794.556) [-795.869] (-785.832) * (-789.638) (-807.942) [-789.532] (-793.978) -- 0:01:19
      25000 -- (-786.017) (-798.042) [-795.690] (-789.261) * (-788.720) (-804.620) (-788.750) [-797.019] -- 0:01:18

      Average standard deviation of split frequencies: 0.050939

      25500 -- (-786.334) [-794.748] (-804.683) (-787.155) * [-788.519] (-801.263) (-787.616) (-796.939) -- 0:01:16
      26000 -- [-786.396] (-796.309) (-799.693) (-787.187) * (-789.104) (-796.321) (-785.063) [-798.486] -- 0:01:14
      26500 -- [-786.503] (-796.921) (-800.198) (-786.257) * (-789.848) (-801.169) (-787.750) [-796.794] -- 0:01:13
      27000 -- (-788.220) (-798.903) [-797.072] (-787.820) * (-785.885) (-791.214) (-787.935) [-797.968] -- 0:01:12
      27500 -- [-788.230] (-790.980) (-817.435) (-786.563) * [-786.235] (-799.292) (-788.344) (-802.759) -- 0:01:10
      28000 -- [-787.743] (-796.042) (-791.900) (-792.124) * [-789.254] (-801.556) (-787.337) (-798.238) -- 0:01:09
      28500 -- (-786.457) (-802.247) (-785.459) [-788.100] * [-786.510] (-801.387) (-786.881) (-797.775) -- 0:01:08
      29000 -- (-785.739) (-795.962) [-786.161] (-788.105) * (-787.376) [-797.999] (-787.235) (-802.797) -- 0:01:06
      29500 -- (-788.457) (-795.122) (-786.942) [-788.426] * (-791.509) (-795.025) (-788.761) [-793.589] -- 0:01:05
      30000 -- (-788.268) [-797.128] (-786.412) (-787.036) * (-788.090) [-797.368] (-787.180) (-794.573) -- 0:01:04

      Average standard deviation of split frequencies: 0.040526

      30500 -- (-787.689) (-791.877) (-788.832) [-786.164] * (-787.502) (-799.371) (-792.546) [-794.777] -- 0:01:03
      31000 -- (-787.242) (-797.000) [-791.050] (-788.634) * (-786.975) (-809.171) [-786.889] (-796.756) -- 0:01:02
      31500 -- (-787.412) [-790.854] (-788.731) (-787.284) * (-786.732) (-796.187) (-786.483) [-790.105] -- 0:01:01
      32000 -- [-787.467] (-792.704) (-792.599) (-789.263) * (-788.875) (-795.148) [-788.728] (-799.471) -- 0:01:00
      32500 -- (-787.813) [-794.598] (-791.125) (-786.279) * (-789.266) (-792.189) (-788.707) [-797.751] -- 0:00:59
      33000 -- [-785.851] (-801.962) (-787.158) (-791.374) * [-791.036] (-799.449) (-792.844) (-793.359) -- 0:00:58
      33500 -- (-789.452) (-794.010) [-787.131] (-787.860) * [-788.040] (-797.692) (-787.057) (-791.482) -- 0:00:57
      34000 -- (-787.411) [-804.576] (-789.267) (-787.313) * (-788.418) (-796.798) (-788.046) [-795.906] -- 0:00:56
      34500 -- (-787.145) (-796.531) [-786.971] (-790.959) * [-787.051] (-801.916) (-787.566) (-790.615) -- 0:00:55
      35000 -- (-786.621) (-802.610) (-786.882) [-788.815] * (-793.428) (-792.574) [-786.999] (-794.618) -- 0:00:55

      Average standard deviation of split frequencies: 0.038629

      35500 -- (-786.894) (-798.974) (-789.879) [-788.004] * (-789.931) (-798.056) (-786.129) [-790.554] -- 0:00:54
      36000 -- (-788.200) (-803.577) (-789.347) [-788.596] * (-787.218) (-793.163) [-787.106] (-797.810) -- 0:01:20
      36500 -- (-789.490) (-792.393) (-789.746) [-786.969] * [-789.108] (-793.014) (-790.497) (-795.931) -- 0:01:19
      37000 -- [-792.763] (-792.481) (-788.730) (-787.476) * (-785.626) (-794.698) [-785.705] (-797.413) -- 0:01:18
      37500 -- (-787.317) [-795.471] (-786.195) (-787.804) * (-789.030) [-795.169] (-787.838) (-808.668) -- 0:01:17
      38000 -- (-787.836) [-797.513] (-785.546) (-787.428) * (-785.551) [-797.530] (-788.505) (-796.980) -- 0:01:15
      38500 -- [-787.176] (-798.224) (-786.441) (-785.704) * (-786.174) (-794.797) (-792.550) [-793.854] -- 0:01:14
      39000 -- (-788.121) (-802.252) (-791.299) [-787.161] * (-785.971) (-793.303) (-789.045) [-797.167] -- 0:01:13
      39500 -- (-786.935) [-799.885] (-785.888) (-788.413) * (-786.615) (-795.311) (-788.088) [-794.169] -- 0:01:12
      40000 -- [-788.134] (-801.751) (-788.457) (-786.625) * [-786.006] (-795.563) (-786.625) (-798.026) -- 0:01:12

      Average standard deviation of split frequencies: 0.033037

      40500 -- (-789.983) [-794.542] (-787.285) (-786.496) * (-786.891) (-791.904) [-785.916] (-799.835) -- 0:01:11
      41000 -- [-787.104] (-800.048) (-794.072) (-787.182) * [-789.148] (-794.974) (-788.986) (-796.454) -- 0:01:10
      41500 -- (-787.362) (-793.572) (-793.011) [-787.181] * (-790.213) (-798.792) (-787.828) [-801.309] -- 0:01:09
      42000 -- (-787.984) (-797.558) (-787.922) [-786.205] * (-788.233) (-802.775) (-791.923) [-796.091] -- 0:01:08
      42500 -- (-787.013) (-797.137) (-787.592) [-786.618] * [-792.151] (-797.324) (-788.386) (-793.801) -- 0:01:07
      43000 -- (-789.294) [-793.849] (-789.262) (-789.114) * (-795.877) (-793.372) (-788.692) [-800.919] -- 0:01:06
      43500 -- (-791.093) [-797.874] (-789.969) (-790.251) * (-792.120) (-801.259) (-790.345) [-794.603] -- 0:01:05
      44000 -- [-788.218] (-797.229) (-789.268) (-789.172) * (-786.934) (-812.897) (-787.358) [-800.615] -- 0:01:05
      44500 -- [-786.993] (-803.521) (-787.033) (-791.118) * (-789.864) (-788.754) [-787.033] (-792.464) -- 0:01:04
      45000 -- [-790.367] (-793.881) (-792.220) (-791.877) * (-786.495) [-785.920] (-793.278) (-796.025) -- 0:01:03

      Average standard deviation of split frequencies: 0.035868

      45500 -- (-787.065) [-791.288] (-790.133) (-788.886) * (-787.751) [-790.347] (-791.474) (-799.823) -- 0:01:02
      46000 -- (-791.033) (-797.230) (-789.716) [-788.693] * (-788.060) [-788.196] (-786.553) (-793.647) -- 0:01:02
      46500 -- (-786.184) (-799.162) (-790.802) [-786.960] * (-786.136) [-788.016] (-786.547) (-794.992) -- 0:01:01
      47000 -- (-791.132) (-799.017) [-789.186] (-786.974) * (-790.757) (-787.668) [-788.456] (-790.588) -- 0:01:00
      47500 -- (-788.946) [-801.256] (-787.629) (-786.049) * (-786.024) [-785.710] (-785.858) (-819.807) -- 0:01:00
      48000 -- [-789.957] (-803.866) (-786.917) (-787.888) * [-787.245] (-787.509) (-789.222) (-788.392) -- 0:00:59
      48500 -- (-785.386) (-789.946) [-788.649] (-790.557) * [-788.116] (-787.466) (-788.111) (-789.902) -- 0:00:58
      49000 -- (-785.452) [-793.777] (-786.573) (-786.638) * (-786.223) (-788.247) [-791.496] (-785.846) -- 0:00:58
      49500 -- (-786.898) [-804.876] (-786.926) (-786.371) * [-787.484] (-785.852) (-789.013) (-786.054) -- 0:00:57
      50000 -- (-790.525) (-799.305) [-788.316] (-785.238) * [-787.734] (-786.767) (-790.468) (-787.625) -- 0:00:57

      Average standard deviation of split frequencies: 0.036370

      50500 -- (-789.524) [-793.027] (-785.956) (-791.039) * (-790.991) (-787.303) (-789.981) [-788.842] -- 0:00:56
      51000 -- (-789.048) (-793.880) (-785.554) [-786.876] * [-786.833] (-786.830) (-787.981) (-787.582) -- 0:00:55
      51500 -- (-789.777) (-798.803) (-785.590) [-785.667] * (-787.970) (-786.779) (-787.721) [-786.200] -- 0:00:55
      52000 -- [-785.608] (-797.186) (-788.755) (-785.565) * (-786.230) (-791.535) (-788.497) [-786.518] -- 0:01:12
      52500 -- [-790.629] (-798.522) (-787.825) (-786.592) * (-788.933) (-791.788) (-786.905) [-785.938] -- 0:01:12
      53000 -- [-787.297] (-801.394) (-786.981) (-788.006) * (-786.940) (-788.106) (-786.794) [-785.901] -- 0:01:11
      53500 -- (-786.478) (-806.743) [-789.660] (-787.671) * (-790.869) [-785.970] (-789.367) (-791.265) -- 0:01:10
      54000 -- [-786.976] (-790.537) (-789.212) (-787.668) * (-791.114) [-788.010] (-789.367) (-791.871) -- 0:01:10
      54500 -- (-789.016) (-804.641) [-785.567] (-787.286) * [-787.969] (-790.239) (-789.019) (-788.978) -- 0:01:09
      55000 -- (-790.020) (-800.350) [-790.902] (-789.026) * (-787.566) (-789.548) (-789.642) [-786.863] -- 0:01:08

      Average standard deviation of split frequencies: 0.034473

      55500 -- (-787.571) [-794.980] (-786.557) (-785.744) * (-788.684) (-787.924) (-790.147) [-786.077] -- 0:01:08
      56000 -- (-787.536) (-792.287) [-787.038] (-785.725) * [-786.427] (-788.836) (-786.692) (-786.887) -- 0:01:07
      56500 -- (-789.846) (-800.640) [-789.157] (-786.217) * (-785.937) [-788.163] (-787.665) (-787.126) -- 0:01:06
      57000 -- (-789.395) (-808.753) (-788.843) [-787.251] * (-786.037) (-787.404) (-786.646) [-787.764] -- 0:01:06
      57500 -- [-792.423] (-795.035) (-789.392) (-787.322) * (-789.378) (-786.420) [-787.546] (-787.274) -- 0:01:05
      58000 -- (-785.980) (-799.581) (-788.263) [-789.077] * (-786.728) (-787.839) [-785.345] (-789.896) -- 0:01:04
      58500 -- (-785.533) (-803.870) (-788.198) [-787.426] * [-788.584] (-789.908) (-785.569) (-789.888) -- 0:01:04
      59000 -- [-791.596] (-791.392) (-786.118) (-786.582) * (-785.594) (-789.132) (-786.949) [-790.083] -- 0:01:03
      59500 -- (-786.131) [-787.435] (-789.866) (-786.306) * (-787.745) [-787.530] (-790.189) (-793.488) -- 0:01:03
      60000 -- (-785.919) (-788.405) [-790.493] (-790.539) * (-785.890) (-789.714) (-789.029) [-786.131] -- 0:01:02

      Average standard deviation of split frequencies: 0.032636

      60500 -- (-785.694) (-786.946) (-791.165) [-787.593] * (-786.804) (-789.495) (-787.824) [-787.028] -- 0:01:02
      61000 -- (-785.993) (-789.287) [-787.048] (-790.955) * (-787.179) (-789.513) (-788.009) [-788.328] -- 0:01:01
      61500 -- (-785.827) [-789.632] (-789.088) (-786.896) * (-787.794) (-787.726) (-788.096) [-786.249] -- 0:01:01
      62000 -- (-788.781) (-787.812) (-791.465) [-789.771] * [-785.738] (-787.306) (-786.769) (-788.410) -- 0:01:00
      62500 -- (-788.407) [-787.782] (-788.897) (-787.199) * (-786.033) (-794.187) (-787.155) [-791.138] -- 0:01:00
      63000 -- (-786.739) [-788.813] (-787.336) (-785.787) * (-786.772) (-786.125) [-790.525] (-788.805) -- 0:00:59
      63500 -- (-786.753) (-787.832) (-785.704) [-785.989] * (-791.514) [-787.318] (-787.919) (-788.505) -- 0:00:58
      64000 -- (-785.921) [-786.770] (-788.130) (-789.594) * (-785.754) (-787.395) [-786.827] (-786.215) -- 0:00:58
      64500 -- (-786.650) (-785.895) [-785.933] (-787.761) * (-787.175) [-787.335] (-787.769) (-788.689) -- 0:00:58
      65000 -- [-786.735] (-786.468) (-785.691) (-786.917) * (-787.182) (-786.677) (-787.635) [-785.938] -- 0:00:57

      Average standard deviation of split frequencies: 0.032791

      65500 -- (-787.982) (-786.277) [-786.530] (-790.780) * [-787.257] (-793.183) (-788.398) (-786.131) -- 0:00:57
      66000 -- [-786.151] (-788.656) (-788.051) (-792.128) * [-786.091] (-786.499) (-786.469) (-786.361) -- 0:00:56
      66500 -- (-786.582) (-786.927) [-785.855] (-786.832) * (-788.521) [-787.042] (-786.852) (-787.549) -- 0:00:56
      67000 -- (-787.126) (-786.378) (-786.654) [-785.555] * (-787.233) (-795.862) [-788.721] (-786.656) -- 0:01:09
      67500 -- (-788.639) (-787.714) (-788.586) [-785.729] * (-786.723) [-787.664] (-786.903) (-789.259) -- 0:01:09
      68000 -- (-788.239) (-786.560) (-790.287) [-789.782] * [-786.856] (-787.984) (-786.418) (-790.341) -- 0:01:08
      68500 -- (-787.682) (-789.753) [-793.798] (-786.208) * [-788.347] (-787.982) (-786.278) (-788.307) -- 0:01:07
      69000 -- (-790.144) (-789.384) [-786.411] (-786.386) * (-786.609) (-786.976) (-787.485) [-785.528] -- 0:01:07
      69500 -- (-790.076) (-787.327) [-788.156] (-788.023) * (-787.646) [-787.542] (-786.194) (-787.425) -- 0:01:06
      70000 -- (-796.790) [-785.300] (-788.338) (-789.244) * (-786.209) (-787.835) [-790.343] (-787.190) -- 0:01:06

      Average standard deviation of split frequencies: 0.030019

      70500 -- (-788.248) (-786.160) (-785.820) [-790.715] * (-789.883) (-787.381) [-787.417] (-786.230) -- 0:01:05
      71000 -- (-788.036) [-790.091] (-785.854) (-786.023) * (-788.092) [-785.824] (-787.707) (-788.632) -- 0:01:05
      71500 -- (-787.067) (-787.215) (-789.411) [-786.514] * (-789.636) (-786.057) (-788.433) [-787.253] -- 0:01:04
      72000 -- [-788.036] (-789.890) (-788.017) (-788.208) * (-789.184) (-787.310) (-787.411) [-789.505] -- 0:01:04
      72500 -- (-786.321) [-789.863] (-787.485) (-788.030) * (-788.415) [-785.492] (-786.576) (-786.912) -- 0:01:03
      73000 -- (-786.201) (-790.315) (-789.147) [-787.763] * (-787.782) (-789.606) (-785.973) [-789.691] -- 0:01:03
      73500 -- (-788.125) [-787.618] (-788.294) (-785.616) * (-787.979) (-785.617) (-786.902) [-787.509] -- 0:01:03
      74000 -- (-786.823) [-785.983] (-787.402) (-788.079) * (-787.025) [-789.695] (-787.208) (-788.503) -- 0:01:02
      74500 -- (-787.770) (-789.449) [-786.868] (-786.355) * (-788.839) (-786.892) (-787.562) [-786.716] -- 0:01:02
      75000 -- (-793.266) (-788.974) [-786.920] (-787.650) * (-787.944) (-787.258) (-788.732) [-788.198] -- 0:01:01

      Average standard deviation of split frequencies: 0.026878

      75500 -- (-785.944) (-791.390) [-786.424] (-787.493) * [-787.012] (-786.529) (-789.773) (-788.986) -- 0:01:01
      76000 -- [-790.869] (-790.913) (-787.941) (-785.331) * (-788.519) (-787.885) (-785.599) [-786.652] -- 0:01:00
      76500 -- (-790.355) (-789.127) [-786.611] (-786.767) * (-790.241) (-790.928) (-787.764) [-787.845] -- 0:01:00
      77000 -- [-787.374] (-786.166) (-785.780) (-786.514) * (-790.388) [-790.395] (-786.715) (-786.461) -- 0:00:59
      77500 -- (-786.549) [-786.184] (-785.851) (-786.745) * (-787.140) (-790.534) [-786.427] (-790.084) -- 0:00:59
      78000 -- [-786.659] (-787.204) (-786.912) (-791.166) * (-787.780) (-785.807) [-785.777] (-787.122) -- 0:00:59
      78500 -- (-790.086) (-786.490) (-787.883) [-788.916] * (-788.232) (-788.035) [-786.419] (-788.205) -- 0:00:58
      79000 -- (-786.908) [-785.950] (-789.421) (-793.845) * (-786.766) (-788.056) [-792.606] (-792.771) -- 0:00:58
      79500 -- [-786.795] (-788.929) (-786.625) (-788.882) * (-790.887) (-786.450) (-792.568) [-787.304] -- 0:00:57
      80000 -- (-786.277) [-788.518] (-787.612) (-791.102) * (-788.438) (-788.200) (-789.632) [-785.925] -- 0:00:57

      Average standard deviation of split frequencies: 0.028157

      80500 -- (-788.106) (-789.773) [-791.261] (-786.003) * (-791.537) [-790.625] (-792.759) (-787.705) -- 0:00:57
      81000 -- [-789.420] (-788.918) (-787.928) (-786.337) * (-792.663) (-787.048) [-793.373] (-785.612) -- 0:00:56
      81500 -- (-791.673) [-789.176] (-791.992) (-785.393) * (-792.194) (-786.277) (-785.890) [-787.675] -- 0:00:56
      82000 -- (-792.237) (-790.451) (-793.500) [-785.349] * [-787.480] (-788.965) (-786.519) (-789.744) -- 0:00:55
      82500 -- (-786.263) (-789.454) [-787.058] (-789.133) * (-786.830) (-786.305) (-790.239) [-786.921] -- 0:00:55
      83000 -- (-786.480) (-789.239) (-788.584) [-788.860] * (-787.624) (-789.898) [-785.993] (-787.840) -- 0:01:06
      83500 -- (-786.488) (-789.074) [-786.411] (-788.137) * (-790.695) [-786.613] (-792.368) (-785.602) -- 0:01:05
      84000 -- (-788.194) (-787.024) (-786.014) [-786.905] * [-787.997] (-788.946) (-786.938) (-786.488) -- 0:01:05
      84500 -- (-789.196) [-788.681] (-788.154) (-787.012) * (-785.909) (-788.978) [-787.434] (-785.554) -- 0:01:05
      85000 -- (-788.941) (-788.107) [-786.505] (-787.930) * (-787.968) (-786.656) (-791.206) [-788.650] -- 0:01:04

      Average standard deviation of split frequencies: 0.028155

      85500 -- [-788.192] (-786.772) (-788.494) (-787.379) * (-788.325) [-788.017] (-789.005) (-786.582) -- 0:01:04
      86000 -- (-791.105) (-788.478) [-786.177] (-787.592) * (-786.140) (-787.695) (-789.441) [-787.196] -- 0:01:03
      86500 -- (-790.279) (-788.192) [-785.393] (-786.227) * (-788.200) [-788.506] (-786.326) (-786.935) -- 0:01:03
      87000 -- (-790.553) [-788.755] (-786.306) (-786.148) * (-788.699) [-787.751] (-787.509) (-786.786) -- 0:01:02
      87500 -- (-786.893) (-792.195) (-785.778) [-789.517] * (-786.268) (-787.108) [-788.295] (-788.479) -- 0:01:02
      88000 -- (-788.060) [-787.376] (-785.962) (-786.551) * [-785.925] (-785.566) (-787.570) (-788.405) -- 0:01:02
      88500 -- (-785.883) (-792.442) [-785.600] (-786.720) * (-789.414) (-787.732) (-790.414) [-785.245] -- 0:01:01
      89000 -- (-789.633) (-790.430) (-787.311) [-788.540] * [-786.581] (-786.880) (-793.303) (-786.560) -- 0:01:01
      89500 -- (-785.185) (-790.400) (-786.577) [-787.148] * (-787.027) [-787.343] (-794.513) (-786.440) -- 0:01:01
      90000 -- [-785.008] (-790.212) (-788.369) (-789.568) * (-786.257) [-786.348] (-793.547) (-785.938) -- 0:01:00

      Average standard deviation of split frequencies: 0.027730

      90500 -- (-787.436) (-786.937) [-793.421] (-786.480) * [-786.878] (-787.430) (-789.535) (-785.461) -- 0:01:00
      91000 -- (-787.525) (-786.219) [-786.732] (-791.900) * [-785.778] (-787.012) (-790.012) (-790.466) -- 0:00:59
      91500 -- (-787.825) (-786.212) (-787.404) [-785.411] * (-785.572) (-791.567) (-789.305) [-789.962] -- 0:00:59
      92000 -- (-787.183) (-786.772) (-789.206) [-786.559] * (-787.549) (-789.629) (-788.485) [-790.242] -- 0:00:59
      92500 -- [-787.225] (-785.617) (-785.741) (-788.042) * (-788.954) (-788.139) [-787.517] (-787.067) -- 0:00:58
      93000 -- (-787.202) (-788.694) (-787.907) [-787.556] * (-787.470) [-788.290] (-785.742) (-787.986) -- 0:00:58
      93500 -- (-787.231) [-787.238] (-787.945) (-786.468) * (-792.529) (-791.076) [-787.766] (-787.554) -- 0:00:58
      94000 -- (-786.648) (-786.653) [-790.785] (-786.843) * (-789.333) (-789.898) [-786.321] (-789.300) -- 0:00:57
      94500 -- [-786.804] (-786.408) (-788.189) (-790.308) * (-787.443) [-787.566] (-787.088) (-788.452) -- 0:00:57
      95000 -- (-788.542) [-789.797] (-787.920) (-786.862) * (-789.031) (-786.113) (-787.537) [-786.804] -- 0:00:57

      Average standard deviation of split frequencies: 0.025020

      95500 -- (-787.693) (-787.621) [-787.173] (-792.998) * (-786.992) [-787.215] (-787.562) (-786.745) -- 0:00:56
      96000 -- (-787.991) (-789.900) [-787.593] (-788.152) * (-786.942) (-787.569) (-788.197) [-788.480] -- 0:00:56
      96500 -- (-787.867) (-796.053) (-789.294) [-790.642] * (-792.820) (-786.983) [-787.215] (-786.654) -- 0:00:56
      97000 -- (-792.474) [-792.747] (-787.918) (-789.498) * [-788.981] (-791.449) (-788.897) (-786.423) -- 0:00:55
      97500 -- [-790.446] (-786.210) (-786.443) (-786.509) * (-787.329) (-788.208) [-788.367] (-785.589) -- 0:00:55
      98000 -- (-787.322) [-785.945] (-786.162) (-791.172) * (-785.990) (-792.779) [-786.304] (-791.612) -- 0:00:55
      98500 -- (-786.246) [-788.991] (-786.768) (-790.698) * (-785.143) [-788.937] (-786.588) (-790.908) -- 0:00:54
      99000 -- (-790.464) [-788.585] (-786.812) (-786.858) * (-786.027) [-788.273] (-788.991) (-788.585) -- 0:01:03
      99500 -- (-787.100) [-789.022] (-785.705) (-787.618) * (-786.303) (-788.381) [-786.213] (-790.188) -- 0:01:03
      100000 -- (-787.498) (-789.578) [-787.512] (-786.608) * (-787.342) (-787.394) (-785.908) [-787.656] -- 0:01:02

      Average standard deviation of split frequencies: 0.024306

      100500 -- (-788.073) (-787.741) [-787.075] (-787.637) * (-787.559) [-788.527] (-786.582) (-788.615) -- 0:01:02
      101000 -- (-787.760) (-787.612) [-790.055] (-787.133) * (-787.291) (-787.120) [-786.000] (-786.950) -- 0:01:02
      101500 -- [-789.142] (-787.717) (-789.059) (-788.348) * (-787.389) (-786.522) (-790.743) [-787.446] -- 0:01:01
      102000 -- (-788.028) [-786.025] (-787.369) (-785.471) * (-790.803) (-785.343) [-787.468] (-787.360) -- 0:01:01
      102500 -- (-786.154) (-792.167) [-787.006] (-787.250) * [-786.497] (-787.911) (-786.743) (-786.758) -- 0:01:01
      103000 -- (-785.751) [-787.495] (-787.810) (-787.036) * (-786.503) [-791.911] (-786.036) (-787.635) -- 0:01:00
      103500 -- (-785.903) (-786.885) (-789.372) [-787.332] * [-787.487] (-790.493) (-789.986) (-789.678) -- 0:01:00
      104000 -- (-786.362) [-785.985] (-789.256) (-789.118) * (-787.831) [-788.001] (-794.074) (-789.206) -- 0:01:00
      104500 -- (-788.353) (-787.199) (-786.491) [-787.669] * (-789.232) (-787.465) [-789.506] (-789.429) -- 0:00:59
      105000 -- [-785.797] (-786.837) (-786.453) (-785.454) * (-786.753) [-785.839] (-787.985) (-787.849) -- 0:00:59

      Average standard deviation of split frequencies: 0.021177

      105500 -- (-787.283) [-791.023] (-790.415) (-788.019) * [-786.774] (-786.251) (-785.812) (-787.651) -- 0:00:59
      106000 -- (-789.963) [-788.010] (-789.814) (-790.441) * (-786.081) (-785.785) [-786.041] (-788.297) -- 0:00:59
      106500 -- (-788.363) [-786.993] (-787.955) (-788.488) * (-786.843) (-786.986) [-788.421] (-788.172) -- 0:00:58
      107000 -- [-789.275] (-788.097) (-787.401) (-788.478) * [-787.601] (-787.317) (-788.136) (-788.417) -- 0:00:58
      107500 -- [-788.525] (-786.921) (-786.315) (-789.427) * (-786.455) (-786.039) [-792.248] (-792.435) -- 0:00:58
      108000 -- (-787.210) (-790.255) [-788.807] (-794.796) * (-787.560) [-787.054] (-787.413) (-787.706) -- 0:00:57
      108500 -- (-787.603) [-787.267] (-787.671) (-789.075) * [-785.380] (-788.317) (-788.929) (-788.175) -- 0:00:57
      109000 -- (-787.189) (-786.462) [-788.293] (-791.435) * [-787.364] (-787.551) (-788.745) (-789.142) -- 0:00:57
      109500 -- (-787.152) [-786.444] (-788.473) (-786.709) * (-786.774) (-788.343) (-788.563) [-785.342] -- 0:00:56
      110000 -- (-785.810) (-786.788) (-788.487) [-787.585] * (-787.674) (-788.030) (-786.547) [-786.309] -- 0:00:56

      Average standard deviation of split frequencies: 0.020020

      110500 -- [-785.473] (-785.567) (-789.606) (-786.809) * (-789.075) [-789.336] (-786.536) (-789.002) -- 0:00:56
      111000 -- (-792.420) (-789.462) [-786.204] (-787.842) * (-787.353) [-787.727] (-788.325) (-785.632) -- 0:00:56
      111500 -- [-786.529] (-786.810) (-790.302) (-789.085) * (-788.287) (-787.209) (-786.941) [-786.437] -- 0:00:55
      112000 -- [-789.047] (-789.106) (-787.216) (-788.573) * (-789.165) [-788.838] (-790.008) (-785.552) -- 0:00:55
      112500 -- (-787.844) (-787.872) (-790.149) [-791.324] * (-788.129) (-790.045) [-790.612] (-786.719) -- 0:00:55
      113000 -- (-787.622) (-786.176) (-791.964) [-789.568] * (-788.082) (-789.845) (-788.132) [-786.840] -- 0:00:54
      113500 -- (-786.603) (-788.616) (-792.753) [-787.533] * (-787.429) (-788.777) [-786.368] (-786.978) -- 0:00:54
      114000 -- (-789.253) [-790.293] (-788.393) (-787.011) * (-787.060) [-787.891] (-786.840) (-787.158) -- 0:00:54
      114500 -- (-790.398) [-787.527] (-789.427) (-791.578) * (-789.292) (-788.696) [-787.548] (-786.513) -- 0:00:54
      115000 -- (-788.238) (-787.746) (-786.581) [-789.371] * (-789.094) [-786.924] (-785.508) (-786.045) -- 0:01:01

      Average standard deviation of split frequencies: 0.021335

      115500 -- [-787.470] (-787.894) (-786.861) (-787.373) * (-787.710) [-787.647] (-791.898) (-786.506) -- 0:01:01
      116000 -- (-787.588) [-788.485] (-788.840) (-788.990) * (-788.396) (-790.171) (-796.343) [-785.954] -- 0:01:00
      116500 -- (-787.200) [-788.114] (-794.191) (-786.955) * (-787.373) (-791.182) [-786.413] (-788.631) -- 0:01:00
      117000 -- (-791.260) [-788.575] (-791.255) (-788.935) * (-787.287) (-788.498) (-788.197) [-789.861] -- 0:01:00
      117500 -- (-790.860) (-788.813) (-786.807) [-786.887] * (-789.175) (-790.178) [-789.445] (-788.595) -- 0:01:00
      118000 -- (-786.895) [-788.736] (-789.055) (-786.896) * (-786.937) [-788.065] (-786.621) (-785.711) -- 0:00:59
      118500 -- (-787.030) (-786.690) [-789.344] (-786.932) * (-786.692) [-789.250] (-786.336) (-786.633) -- 0:00:59
      119000 -- (-786.846) (-787.186) (-788.366) [-788.506] * [-786.745] (-788.034) (-786.411) (-791.008) -- 0:00:59
      119500 -- [-786.912] (-787.034) (-788.570) (-788.007) * (-788.224) (-789.937) (-786.999) [-788.034] -- 0:00:58
      120000 -- (-789.257) (-786.982) (-787.244) [-786.679] * [-787.702] (-790.704) (-786.198) (-786.427) -- 0:00:58

      Average standard deviation of split frequencies: 0.020561

      120500 -- (-793.554) (-787.952) (-790.660) [-785.574] * [-786.186] (-786.260) (-785.758) (-786.056) -- 0:00:58
      121000 -- (-792.309) (-789.753) (-789.430) [-785.571] * [-788.641] (-786.127) (-790.796) (-785.862) -- 0:00:58
      121500 -- [-788.686] (-786.518) (-788.370) (-787.117) * (-789.336) (-790.204) [-786.244] (-787.284) -- 0:00:57
      122000 -- (-786.766) (-786.785) [-786.354] (-786.083) * [-785.813] (-790.459) (-787.239) (-787.467) -- 0:00:57
      122500 -- (-785.165) (-793.308) [-787.446] (-786.070) * [-786.083] (-788.162) (-787.165) (-789.836) -- 0:00:57
      123000 -- [-785.852] (-789.161) (-788.255) (-786.946) * [-786.465] (-788.180) (-787.475) (-787.702) -- 0:00:57
      123500 -- (-785.502) (-790.410) (-787.217) [-789.195] * (-785.965) (-787.556) [-787.032] (-786.694) -- 0:00:56
      124000 -- (-785.186) (-790.981) [-787.183] (-792.341) * (-788.671) (-787.316) [-790.378] (-787.077) -- 0:00:56
      124500 -- (-785.542) (-787.128) [-789.024] (-792.000) * (-789.267) (-787.602) [-787.323] (-788.883) -- 0:00:56
      125000 -- (-785.464) (-787.974) (-787.813) [-786.259] * (-788.060) [-786.469] (-786.078) (-788.573) -- 0:00:56

      Average standard deviation of split frequencies: 0.021379

      125500 -- (-787.143) (-787.203) (-787.507) [-788.132] * (-789.057) (-789.244) [-786.420] (-788.319) -- 0:00:55
      126000 -- (-786.666) (-791.850) (-787.207) [-787.922] * [-785.625] (-787.384) (-788.027) (-788.914) -- 0:00:55
      126500 -- (-786.244) [-786.518] (-786.621) (-787.184) * (-786.131) [-786.007] (-790.980) (-789.911) -- 0:00:55
      127000 -- (-785.322) (-790.495) (-788.400) [-785.930] * (-787.711) [-787.361] (-786.155) (-787.246) -- 0:00:54
      127500 -- (-785.839) (-790.901) (-787.065) [-785.749] * (-788.997) [-787.437] (-785.315) (-787.404) -- 0:00:54
      128000 -- (-789.559) (-792.252) (-788.301) [-786.681] * (-789.275) [-786.965] (-785.258) (-789.769) -- 0:00:54
      128500 -- (-797.225) (-792.691) (-787.213) [-789.295] * (-786.671) (-786.741) [-786.059] (-787.214) -- 0:00:54
      129000 -- (-786.011) (-787.662) [-789.351] (-789.328) * [-789.298] (-787.420) (-788.531) (-786.781) -- 0:00:54
      129500 -- (-787.938) (-787.334) (-786.551) [-788.713] * [-788.104] (-791.862) (-786.371) (-789.353) -- 0:00:53
      130000 -- (-790.168) (-786.192) (-788.303) [-789.969] * (-786.813) [-785.785] (-792.677) (-789.209) -- 0:00:53

      Average standard deviation of split frequencies: 0.018580

      130500 -- [-786.300] (-785.501) (-786.270) (-790.395) * (-788.746) (-789.304) (-792.189) [-785.942] -- 0:00:53
      131000 -- (-786.837) (-786.698) [-786.515] (-788.744) * (-787.139) [-788.199] (-789.064) (-785.125) -- 0:00:59
      131500 -- (-787.389) [-785.406] (-786.749) (-785.851) * (-787.960) [-788.266] (-788.495) (-789.559) -- 0:00:59
      132000 -- (-788.213) [-787.860] (-786.786) (-791.509) * (-788.371) (-785.419) (-785.749) [-788.325] -- 0:00:59
      132500 -- (-789.927) (-791.904) (-786.038) [-791.969] * (-785.438) (-786.358) (-786.963) [-785.173] -- 0:00:58
      133000 -- (-791.006) (-791.085) [-785.545] (-793.520) * [-788.957] (-785.826) (-788.775) (-785.574) -- 0:00:58
      133500 -- (-785.994) [-786.303] (-785.385) (-787.325) * [-787.333] (-787.286) (-789.860) (-785.244) -- 0:00:58
      134000 -- (-785.718) (-786.799) [-790.956] (-789.459) * (-786.736) (-791.240) (-788.457) [-785.750] -- 0:00:58
      134500 -- [-785.515] (-786.679) (-791.825) (-788.263) * [-789.333] (-791.418) (-786.528) (-788.076) -- 0:00:57
      135000 -- (-787.735) [-786.444] (-791.108) (-788.941) * [-786.564] (-794.492) (-786.333) (-786.345) -- 0:00:57

      Average standard deviation of split frequencies: 0.018198

      135500 -- [-786.437] (-786.321) (-790.323) (-793.211) * [-785.643] (-792.863) (-786.950) (-788.261) -- 0:00:57
      136000 -- [-786.756] (-785.991) (-790.105) (-789.012) * [-786.285] (-792.615) (-787.614) (-791.012) -- 0:00:57
      136500 -- (-786.642) [-786.297] (-789.233) (-785.850) * [-785.563] (-790.469) (-787.324) (-791.834) -- 0:00:56
      137000 -- (-786.050) (-786.538) [-786.136] (-788.540) * (-785.484) [-789.888] (-787.117) (-789.071) -- 0:00:56
      137500 -- [-786.715] (-786.807) (-785.981) (-785.518) * (-785.524) (-796.178) [-785.655] (-786.231) -- 0:00:56
      138000 -- (-785.793) (-785.675) (-787.831) [-785.324] * [-787.144] (-797.904) (-786.055) (-786.431) -- 0:00:56
      138500 -- (-787.855) (-785.149) (-787.889) [-785.392] * (-787.081) (-786.724) (-786.462) [-786.698] -- 0:00:55
      139000 -- (-786.274) (-786.058) [-787.096] (-786.574) * [-788.560] (-785.952) (-786.008) (-786.216) -- 0:00:55
      139500 -- (-786.066) (-791.260) [-787.791] (-787.028) * (-787.425) (-787.608) [-787.519] (-786.813) -- 0:00:55
      140000 -- (-788.498) [-785.995] (-785.967) (-786.142) * (-786.275) [-789.151] (-786.288) (-789.211) -- 0:00:55

      Average standard deviation of split frequencies: 0.019402

      140500 -- [-786.499] (-785.493) (-785.543) (-788.248) * (-790.209) [-788.135] (-787.797) (-787.818) -- 0:00:55
      141000 -- (-786.488) (-788.934) [-785.330] (-790.933) * (-788.417) [-788.330] (-787.115) (-792.137) -- 0:00:54
      141500 -- (-787.104) [-789.278] (-787.719) (-790.732) * [-786.595] (-787.450) (-786.446) (-793.929) -- 0:00:54
      142000 -- (-787.977) (-793.135) (-787.687) [-788.770] * (-785.785) (-788.903) (-790.604) [-790.119] -- 0:00:54
      142500 -- (-788.357) [-790.422] (-785.174) (-791.095) * [-788.807] (-787.278) (-791.674) (-785.915) -- 0:00:54
      143000 -- [-788.666] (-788.137) (-785.411) (-794.120) * [-786.483] (-788.832) (-788.487) (-786.631) -- 0:00:53
      143500 -- (-786.670) (-785.552) (-787.975) [-786.332] * (-788.875) [-786.334] (-787.146) (-786.599) -- 0:00:53
      144000 -- (-790.206) (-785.804) (-788.506) [-788.766] * (-789.221) (-791.409) [-786.833] (-788.361) -- 0:00:53
      144500 -- (-789.236) (-785.807) [-789.041] (-790.115) * [-787.710] (-787.110) (-786.414) (-788.955) -- 0:00:53
      145000 -- (-786.533) (-787.742) (-788.711) [-788.636] * (-793.859) (-786.566) [-787.159] (-793.424) -- 0:00:53

      Average standard deviation of split frequencies: 0.018727

      145500 -- (-785.906) (-788.912) [-787.857] (-785.937) * (-791.148) (-785.794) [-785.977] (-787.046) -- 0:00:52
      146000 -- [-786.251] (-786.534) (-787.687) (-785.396) * (-792.092) (-788.372) [-785.483] (-788.866) -- 0:00:52
      146500 -- [-787.284] (-785.940) (-786.603) (-788.024) * (-791.176) [-787.948] (-787.001) (-789.039) -- 0:00:52
      147000 -- (-788.627) (-786.757) (-786.219) [-788.320] * [-789.738] (-789.087) (-790.662) (-786.576) -- 0:00:58
      147500 -- [-789.516] (-789.568) (-786.594) (-789.760) * [-787.500] (-785.619) (-788.501) (-787.288) -- 0:00:57
      148000 -- (-788.836) (-788.883) (-787.074) [-790.580] * (-792.047) (-789.974) [-787.303] (-788.326) -- 0:00:57
      148500 -- [-787.601] (-787.470) (-787.302) (-790.547) * (-792.105) (-786.497) (-787.421) [-790.200] -- 0:00:57
      149000 -- [-785.812] (-786.601) (-786.002) (-792.159) * (-789.530) (-785.637) [-787.462] (-786.764) -- 0:00:57
      149500 -- (-786.186) (-787.534) (-789.328) [-786.917] * [-787.121] (-788.384) (-786.378) (-785.507) -- 0:00:56
      150000 -- [-786.517] (-789.772) (-791.372) (-790.100) * (-788.619) (-790.734) (-790.460) [-791.631] -- 0:00:56

      Average standard deviation of split frequencies: 0.019431

      150500 -- [-786.075] (-789.211) (-788.075) (-789.538) * [-787.559] (-787.457) (-788.460) (-786.030) -- 0:00:56
      151000 -- (-786.020) (-786.258) (-789.413) [-788.188] * (-790.475) (-791.148) [-787.714] (-787.901) -- 0:00:56
      151500 -- (-786.539) (-790.136) [-789.124] (-786.787) * [-786.215] (-794.203) (-786.792) (-788.129) -- 0:00:56
      152000 -- (-787.832) (-787.219) [-787.866] (-788.989) * [-786.538] (-786.932) (-787.755) (-788.736) -- 0:00:55
      152500 -- (-786.004) (-788.134) (-789.014) [-787.077] * (-786.831) (-786.854) (-789.245) [-790.150] -- 0:00:55
      153000 -- [-787.962] (-788.529) (-790.915) (-788.454) * (-790.414) [-786.135] (-787.787) (-787.221) -- 0:00:55
      153500 -- (-786.115) (-786.873) (-790.591) [-787.280] * (-789.857) (-790.564) (-788.021) [-787.505] -- 0:00:55
      154000 -- (-788.020) [-791.765] (-787.127) (-787.374) * (-786.989) (-785.693) [-786.991] (-787.055) -- 0:00:54
      154500 -- [-787.722] (-792.859) (-790.974) (-787.282) * [-788.463] (-785.952) (-787.811) (-785.715) -- 0:00:54
      155000 -- [-788.891] (-789.853) (-786.428) (-786.189) * [-785.322] (-786.861) (-789.954) (-785.446) -- 0:00:54

      Average standard deviation of split frequencies: 0.017654

      155500 -- (-788.142) (-790.214) (-788.913) [-787.425] * (-786.433) (-788.732) (-786.411) [-789.655] -- 0:00:54
      156000 -- [-786.486] (-788.816) (-790.869) (-787.025) * (-786.177) (-786.760) [-787.855] (-786.081) -- 0:00:54
      156500 -- [-786.049] (-789.897) (-793.921) (-786.151) * [-786.355] (-791.459) (-787.717) (-786.779) -- 0:00:53
      157000 -- (-790.297) (-789.348) (-793.132) [-785.316] * (-786.661) (-788.500) (-790.771) [-791.803] -- 0:00:53
      157500 -- (-786.104) (-786.101) [-787.574] (-788.629) * [-787.563] (-795.131) (-789.634) (-791.570) -- 0:00:53
      158000 -- (-790.838) (-787.543) (-785.736) [-785.722] * [-791.721] (-799.293) (-791.428) (-787.112) -- 0:00:53
      158500 -- (-787.120) (-786.520) (-790.143) [-786.284] * (-792.888) [-786.302] (-788.105) (-787.690) -- 0:00:53
      159000 -- (-786.286) [-786.447] (-790.746) (-788.450) * (-787.384) [-788.025] (-786.663) (-789.287) -- 0:00:52
      159500 -- (-787.683) [-787.603] (-789.395) (-789.593) * [-787.490] (-787.965) (-786.699) (-785.328) -- 0:00:52
      160000 -- (-788.067) (-789.131) (-790.340) [-788.166] * (-790.980) (-787.972) [-786.335] (-786.239) -- 0:00:52

      Average standard deviation of split frequencies: 0.019457

      160500 -- (-786.708) (-787.350) (-787.148) [-785.220] * [-789.878] (-789.821) (-790.190) (-787.432) -- 0:00:52
      161000 -- [-787.555] (-785.841) (-789.850) (-787.190) * (-786.886) (-786.741) (-786.918) [-786.253] -- 0:00:52
      161500 -- (-785.836) (-786.226) (-786.292) [-785.289] * [-786.260] (-789.081) (-787.021) (-787.037) -- 0:00:51
      162000 -- (-787.132) [-787.985] (-786.310) (-785.187) * (-786.003) (-786.581) (-786.047) [-785.767] -- 0:00:51
      162500 -- (-791.162) (-794.726) [-787.363] (-785.104) * [-786.430] (-787.682) (-790.621) (-792.041) -- 0:00:56
      163000 -- (-787.691) (-791.680) (-786.853) [-785.721] * [-785.813] (-788.891) (-788.155) (-788.118) -- 0:00:56
      163500 -- (-786.443) (-786.577) (-786.759) [-787.491] * (-791.648) [-788.024] (-786.392) (-787.011) -- 0:00:56
      164000 -- [-786.521] (-785.629) (-792.411) (-790.287) * [-790.181] (-786.882) (-788.310) (-786.531) -- 0:00:56
      164500 -- (-787.805) [-787.450] (-793.381) (-786.062) * (-789.137) (-788.550) [-787.979] (-785.579) -- 0:00:55
      165000 -- (-795.434) (-785.917) (-791.488) [-786.414] * (-787.236) (-790.231) (-787.128) [-786.071] -- 0:00:55

      Average standard deviation of split frequencies: 0.017891

      165500 -- (-788.825) (-789.520) (-788.114) [-789.133] * (-786.485) [-785.855] (-792.950) (-787.783) -- 0:00:55
      166000 -- (-786.082) [-787.317] (-785.948) (-786.594) * (-785.679) (-789.285) [-789.307] (-785.859) -- 0:00:55
      166500 -- (-789.536) [-787.938] (-787.364) (-786.943) * (-788.612) (-785.343) [-786.388] (-785.972) -- 0:00:55
      167000 -- (-788.078) (-789.083) (-785.695) [-785.623] * (-786.645) (-786.494) (-786.356) [-786.956] -- 0:00:54
      167500 -- [-788.196] (-786.042) (-796.405) (-786.299) * (-786.855) (-786.033) [-786.013] (-786.133) -- 0:00:54
      168000 -- (-786.318) (-788.221) [-790.130] (-788.047) * (-787.776) (-788.215) (-789.034) [-787.662] -- 0:00:54
      168500 -- [-788.204] (-787.974) (-787.874) (-786.676) * (-790.449) [-785.771] (-786.687) (-788.595) -- 0:00:54
      169000 -- [-791.278] (-787.886) (-787.613) (-788.468) * (-787.291) [-787.477] (-786.365) (-785.342) -- 0:00:54
      169500 -- [-792.336] (-787.830) (-787.766) (-785.836) * (-788.385) [-787.065] (-786.356) (-786.229) -- 0:00:53
      170000 -- [-787.161] (-786.410) (-788.055) (-785.643) * (-789.746) (-787.729) [-790.983] (-787.163) -- 0:00:53

      Average standard deviation of split frequencies: 0.017494

      170500 -- (-788.005) (-787.076) [-787.034] (-787.368) * (-788.269) [-786.375] (-789.027) (-787.795) -- 0:00:53
      171000 -- (-787.207) (-790.452) (-788.835) [-787.036] * (-788.153) (-787.169) [-786.983] (-788.296) -- 0:00:53
      171500 -- (-786.713) (-789.350) (-786.447) [-787.897] * (-789.972) [-787.015] (-785.733) (-791.839) -- 0:00:53
      172000 -- (-787.616) [-788.517] (-787.234) (-790.245) * (-786.269) (-786.058) (-785.836) [-791.838] -- 0:00:52
      172500 -- (-789.099) [-788.195] (-786.778) (-786.604) * [-788.523] (-789.092) (-789.094) (-787.808) -- 0:00:52
      173000 -- (-787.444) (-788.445) [-786.955] (-788.842) * (-786.495) (-788.056) (-790.096) [-786.254] -- 0:00:52
      173500 -- (-787.164) (-785.689) [-787.564] (-786.945) * [-785.411] (-789.336) (-787.248) (-786.747) -- 0:00:52
      174000 -- (-789.646) (-785.907) (-787.594) [-786.447] * (-788.743) [-791.816] (-786.733) (-794.014) -- 0:00:52
      174500 -- (-787.609) (-786.937) [-791.832] (-786.733) * (-787.981) (-787.912) [-786.168] (-793.662) -- 0:00:52
      175000 -- (-786.191) (-786.940) (-789.174) [-787.284] * (-787.698) (-786.249) (-794.369) [-788.531] -- 0:00:51

      Average standard deviation of split frequencies: 0.016666

      175500 -- [-786.543] (-785.784) (-785.626) (-787.332) * (-789.623) [-786.172] (-787.042) (-786.930) -- 0:00:51
      176000 -- (-791.336) (-786.359) (-790.147) [-786.275] * (-786.092) (-790.058) (-786.162) [-786.627] -- 0:00:51
      176500 -- (-790.771) (-789.451) (-788.779) [-786.745] * (-788.498) (-795.311) (-787.064) [-785.834] -- 0:00:51
      177000 -- (-791.129) (-791.447) [-786.124] (-787.913) * (-792.540) (-791.558) (-785.560) [-790.897] -- 0:00:51
      177500 -- [-788.147] (-794.030) (-787.779) (-789.770) * [-788.351] (-788.219) (-787.268) (-786.877) -- 0:00:50
      178000 -- (-785.715) (-791.654) (-786.489) [-788.331] * (-788.378) [-787.427] (-787.686) (-786.244) -- 0:00:50
      178500 -- (-789.560) (-790.256) (-785.527) [-785.949] * (-792.188) [-786.667] (-786.801) (-786.901) -- 0:00:50
      179000 -- (-788.992) (-788.123) (-785.631) [-785.698] * (-786.219) [-789.015] (-790.232) (-785.450) -- 0:00:55
      179500 -- (-786.764) [-787.723] (-785.601) (-786.331) * (-786.129) [-785.376] (-788.568) (-785.455) -- 0:00:54
      180000 -- (-786.941) (-790.344) [-785.962] (-788.304) * (-785.818) [-786.176] (-787.617) (-788.058) -- 0:00:54

      Average standard deviation of split frequencies: 0.014641

      180500 -- (-788.578) (-786.350) (-786.229) [-787.616] * (-788.626) (-785.656) (-789.016) [-786.395] -- 0:00:54
      181000 -- (-785.782) (-788.194) [-786.215] (-787.922) * (-787.103) [-786.097] (-789.915) (-787.783) -- 0:00:54
      181500 -- (-785.782) [-789.020] (-788.713) (-790.457) * (-790.371) [-786.201] (-786.432) (-787.569) -- 0:00:54
      182000 -- (-789.922) (-793.198) (-790.922) [-790.040] * (-785.712) (-786.780) [-787.068] (-792.754) -- 0:00:53
      182500 -- (-789.197) [-786.331] (-787.005) (-788.233) * (-786.851) (-787.788) [-786.399] (-787.245) -- 0:00:53
      183000 -- [-786.861] (-786.050) (-790.491) (-785.440) * (-789.524) (-785.497) [-786.782] (-790.764) -- 0:00:53
      183500 -- (-787.156) (-785.910) (-786.078) [-787.451] * (-786.922) (-785.323) [-786.240] (-789.837) -- 0:00:53
      184000 -- [-788.976] (-786.967) (-788.731) (-789.679) * [-786.472] (-786.292) (-786.663) (-788.620) -- 0:00:53
      184500 -- (-788.593) (-785.459) (-786.691) [-785.763] * (-788.226) (-786.478) (-786.536) [-787.238] -- 0:00:53
      185000 -- (-787.842) (-786.936) [-786.831] (-785.745) * (-790.754) (-786.124) (-788.923) [-787.500] -- 0:00:52

      Average standard deviation of split frequencies: 0.014610

      185500 -- (-787.470) (-788.657) (-786.163) [-785.686] * (-790.360) (-785.335) [-787.056] (-787.574) -- 0:00:52
      186000 -- [-787.978] (-788.310) (-790.098) (-786.470) * (-798.900) (-786.480) [-787.975] (-785.957) -- 0:00:52
      186500 -- [-786.979] (-786.481) (-786.264) (-790.079) * [-790.726] (-785.793) (-787.857) (-787.176) -- 0:00:52
      187000 -- (-786.712) [-786.761] (-785.669) (-786.265) * (-789.208) [-786.836] (-789.779) (-786.933) -- 0:00:52
      187500 -- [-789.012] (-786.040) (-785.874) (-788.739) * [-788.234] (-788.954) (-788.753) (-785.685) -- 0:00:52
      188000 -- (-787.295) (-789.898) [-792.281] (-787.285) * [-786.749] (-787.577) (-786.434) (-786.763) -- 0:00:51
      188500 -- [-787.678] (-787.801) (-788.127) (-789.199) * [-786.442] (-788.716) (-785.884) (-787.057) -- 0:00:51
      189000 -- [-787.769] (-785.720) (-787.310) (-786.856) * (-786.827) (-786.780) (-787.805) [-788.393] -- 0:00:51
      189500 -- (-790.793) (-787.028) (-786.235) [-786.061] * (-787.450) (-787.942) [-785.947] (-787.588) -- 0:00:51
      190000 -- [-788.856] (-788.496) (-788.420) (-786.386) * [-786.390] (-794.047) (-788.028) (-788.522) -- 0:00:51

      Average standard deviation of split frequencies: 0.015796

      190500 -- [-787.706] (-787.828) (-786.374) (-785.434) * (-788.821) (-786.585) [-789.285] (-789.290) -- 0:00:50
      191000 -- [-791.143] (-789.113) (-790.499) (-785.216) * (-786.241) (-786.989) [-787.614] (-787.092) -- 0:00:50
      191500 -- [-787.249] (-786.515) (-790.090) (-786.860) * (-786.817) [-789.848] (-785.660) (-787.108) -- 0:00:50
      192000 -- (-787.692) (-786.891) [-788.227] (-790.982) * [-786.008] (-788.670) (-790.387) (-789.506) -- 0:00:50
      192500 -- (-791.189) (-788.906) (-787.649) [-786.772] * [-790.475] (-790.776) (-791.236) (-788.605) -- 0:00:50
      193000 -- (-786.983) (-789.194) (-786.504) [-786.170] * (-787.800) (-790.186) [-787.887] (-789.566) -- 0:00:50
      193500 -- (-789.155) (-785.340) [-787.197] (-788.545) * (-791.231) (-789.544) (-786.148) [-787.257] -- 0:00:50
      194000 -- [-786.545] (-787.945) (-786.735) (-789.080) * (-787.973) (-787.218) (-786.028) [-786.866] -- 0:00:49
      194500 -- (-789.128) (-787.440) [-787.535] (-788.253) * (-786.590) (-785.934) [-786.881] (-786.790) -- 0:00:49
      195000 -- [-787.662] (-788.491) (-789.914) (-786.387) * (-786.231) (-786.493) [-788.986] (-787.410) -- 0:00:49

      Average standard deviation of split frequencies: 0.014572

      195500 -- (-787.881) [-787.081] (-787.076) (-787.400) * (-787.396) [-786.959] (-785.758) (-788.067) -- 0:00:53
      196000 -- (-787.072) [-788.801] (-790.136) (-790.592) * [-786.200] (-787.096) (-786.130) (-794.820) -- 0:00:53
      196500 -- [-787.824] (-788.794) (-788.952) (-789.273) * (-785.566) (-787.662) (-788.970) [-786.199] -- 0:00:53
      197000 -- (-788.712) (-786.669) (-787.884) [-787.490] * (-786.036) [-786.707] (-786.844) (-786.016) -- 0:00:52
      197500 -- (-786.669) (-788.427) [-786.703] (-786.641) * (-786.001) [-786.269] (-786.106) (-787.440) -- 0:00:52
      198000 -- (-788.094) (-787.985) [-788.175] (-790.141) * (-787.366) (-786.435) [-786.885] (-788.231) -- 0:00:52
      198500 -- (-786.683) [-789.538] (-788.227) (-786.040) * (-787.823) (-787.066) (-786.142) [-786.460] -- 0:00:52
      199000 -- [-788.548] (-790.842) (-789.195) (-785.878) * (-788.460) (-789.388) (-789.067) [-787.687] -- 0:00:52
      199500 -- (-790.236) (-788.467) (-786.474) [-787.427] * (-787.794) (-792.607) (-789.607) [-788.585] -- 0:00:52
      200000 -- (-788.112) (-787.610) [-786.878] (-789.863) * (-785.485) [-786.424] (-791.397) (-787.771) -- 0:00:51

      Average standard deviation of split frequencies: 0.015201

      200500 -- (-791.755) (-785.408) (-787.052) [-788.288] * (-785.456) [-791.506] (-794.164) (-788.312) -- 0:00:51
      201000 -- (-788.769) (-785.648) (-788.232) [-785.158] * (-786.883) [-788.912] (-787.245) (-787.683) -- 0:00:51
      201500 -- (-787.859) (-786.660) (-794.401) [-788.195] * (-787.099) [-787.110] (-786.358) (-787.968) -- 0:00:51
      202000 -- [-787.462] (-787.713) (-789.049) (-789.745) * (-786.802) (-787.521) [-786.862] (-786.760) -- 0:00:51
      202500 -- (-787.095) [-788.557] (-786.995) (-787.928) * (-787.560) (-787.226) [-787.144] (-786.518) -- 0:00:51
      203000 -- (-787.308) [-785.817] (-786.865) (-789.603) * [-787.755] (-787.431) (-785.803) (-786.936) -- 0:00:51
      203500 -- (-787.265) (-785.574) (-787.846) [-788.704] * [-787.844] (-794.345) (-785.509) (-786.095) -- 0:00:50
      204000 -- [-786.634] (-788.711) (-790.070) (-786.089) * (-788.144) (-787.390) (-785.447) [-786.117] -- 0:00:50
      204500 -- (-790.631) (-787.430) (-792.078) [-786.437] * (-789.009) [-787.843] (-785.331) (-788.257) -- 0:00:50
      205000 -- [-787.224] (-786.027) (-786.040) (-787.134) * (-787.983) (-788.816) (-785.291) [-786.979] -- 0:00:50

      Average standard deviation of split frequencies: 0.015510

      205500 -- (-790.214) [-786.538] (-789.053) (-786.952) * (-788.983) [-786.952] (-785.751) (-786.873) -- 0:00:50
      206000 -- (-785.623) (-789.926) (-786.158) [-785.534] * [-786.477] (-787.469) (-788.632) (-789.049) -- 0:00:50
      206500 -- (-786.523) (-790.265) (-787.128) [-785.315] * (-788.713) [-786.553] (-789.290) (-789.884) -- 0:00:49
      207000 -- (-786.313) (-787.263) [-787.799] (-787.416) * (-787.743) (-786.162) [-786.226] (-788.446) -- 0:00:49
      207500 -- (-790.099) [-787.146] (-785.598) (-786.604) * (-786.969) (-786.543) [-786.935] (-790.609) -- 0:00:49
      208000 -- (-800.246) [-787.408] (-787.554) (-786.160) * (-788.005) (-788.245) (-786.712) [-786.815] -- 0:00:49
      208500 -- (-788.713) (-788.181) (-785.342) [-785.478] * (-787.974) (-787.382) [-785.273] (-788.344) -- 0:00:49
      209000 -- (-787.454) (-789.800) (-787.415) [-785.820] * (-787.283) (-787.058) (-787.706) [-787.540] -- 0:00:49
      209500 -- (-788.835) [-788.187] (-786.704) (-786.231) * (-787.076) (-787.964) [-787.776] (-786.714) -- 0:00:49
      210000 -- (-787.882) [-788.361] (-786.626) (-785.925) * [-789.025] (-786.835) (-786.008) (-786.304) -- 0:00:48

      Average standard deviation of split frequencies: 0.014545

      210500 -- (-787.310) (-786.768) (-787.990) [-790.030] * (-785.747) (-786.249) (-786.400) [-785.698] -- 0:00:48
      211000 -- (-786.703) [-786.636] (-786.914) (-785.334) * (-786.732) (-787.434) [-789.129] (-786.458) -- 0:00:48
      211500 -- (-785.686) (-787.558) (-787.001) [-787.316] * (-786.505) (-788.256) (-787.719) [-787.584] -- 0:00:52
      212000 -- (-786.999) [-787.635] (-790.400) (-786.755) * (-790.087) (-787.094) (-787.076) [-789.060] -- 0:00:52
      212500 -- (-787.504) [-787.698] (-790.451) (-787.016) * (-787.401) (-788.499) [-786.561] (-792.016) -- 0:00:51
      213000 -- (-787.088) [-787.104] (-788.780) (-786.815) * (-788.478) (-790.671) (-788.632) [-787.587] -- 0:00:51
      213500 -- (-786.399) (-785.941) [-785.930] (-786.779) * (-786.854) (-788.183) (-787.423) [-789.142] -- 0:00:51
      214000 -- (-788.108) (-785.653) [-785.690] (-785.723) * (-787.037) [-789.138] (-786.800) (-789.015) -- 0:00:51
      214500 -- (-788.871) [-787.208] (-788.541) (-785.978) * (-786.572) (-788.517) [-785.304] (-787.668) -- 0:00:51
      215000 -- (-787.850) [-785.909] (-789.664) (-787.474) * (-787.176) (-786.245) [-788.078] (-787.179) -- 0:00:51

      Average standard deviation of split frequencies: 0.015162

      215500 -- (-786.034) (-785.438) (-787.098) [-786.496] * (-787.140) (-785.915) (-789.359) [-787.095] -- 0:00:50
      216000 -- (-786.114) (-786.842) [-787.083] (-788.363) * (-788.995) (-787.418) [-786.370] (-788.030) -- 0:00:50
      216500 -- (-792.515) [-786.504] (-786.598) (-791.941) * (-787.214) [-786.201] (-786.022) (-790.229) -- 0:00:50
      217000 -- (-786.542) (-786.943) (-789.831) [-790.702] * (-786.977) (-786.149) (-787.674) [-787.738] -- 0:00:50
      217500 -- (-786.356) (-785.964) (-790.924) [-785.969] * (-786.211) (-787.679) (-786.969) [-785.468] -- 0:00:50
      218000 -- [-790.393] (-788.433) (-789.405) (-786.534) * (-795.156) (-788.485) [-788.765] (-786.710) -- 0:00:50
      218500 -- (-791.369) (-785.521) [-787.338] (-787.299) * (-789.225) (-789.127) [-787.484] (-786.311) -- 0:00:50
      219000 -- (-790.338) (-785.456) (-787.878) [-789.844] * [-790.265] (-789.552) (-788.131) (-787.392) -- 0:00:49
      219500 -- (-786.926) (-786.014) (-788.966) [-787.166] * (-789.314) [-788.678] (-790.521) (-787.633) -- 0:00:49
      220000 -- (-788.590) (-786.168) [-786.464] (-786.824) * (-790.327) [-790.197] (-791.325) (-788.349) -- 0:00:49

      Average standard deviation of split frequencies: 0.014703

      220500 -- [-787.957] (-785.393) (-790.959) (-789.078) * (-788.976) (-791.872) (-786.820) [-786.854] -- 0:00:49
      221000 -- (-791.885) (-786.061) [-794.001] (-787.778) * (-786.126) (-790.964) [-786.609] (-788.145) -- 0:00:49
      221500 -- (-787.026) (-786.660) (-787.092) [-787.037] * [-786.323] (-786.055) (-789.094) (-790.319) -- 0:00:49
      222000 -- (-787.443) (-789.861) (-786.761) [-787.264] * (-788.695) (-785.870) (-789.871) [-788.119] -- 0:00:49
      222500 -- [-788.327] (-786.165) (-788.605) (-787.691) * (-787.554) (-789.237) [-791.770] (-788.595) -- 0:00:48
      223000 -- [-789.319] (-785.914) (-789.316) (-788.891) * (-790.642) (-786.559) (-790.840) [-787.002] -- 0:00:48
      223500 -- [-786.695] (-786.995) (-789.721) (-792.975) * (-787.826) [-787.685] (-791.709) (-786.520) -- 0:00:48
      224000 -- [-786.963] (-786.542) (-788.709) (-788.689) * [-787.547] (-788.207) (-790.169) (-791.899) -- 0:00:48
      224500 -- [-786.127] (-787.089) (-790.131) (-786.807) * (-795.002) [-786.457] (-793.342) (-789.632) -- 0:00:48
      225000 -- (-786.540) [-787.025] (-787.257) (-788.457) * (-791.936) [-787.554] (-788.995) (-787.125) -- 0:00:48

      Average standard deviation of split frequencies: 0.014052

      225500 -- (-787.841) [-788.005] (-786.150) (-787.059) * (-787.359) (-786.761) [-788.247] (-787.106) -- 0:00:48
      226000 -- [-787.274] (-786.807) (-786.439) (-786.668) * (-787.380) [-785.549] (-790.515) (-787.102) -- 0:00:47
      226500 -- [-787.532] (-786.664) (-786.602) (-789.462) * (-787.327) (-786.430) [-789.348] (-788.836) -- 0:00:47
      227000 -- (-788.311) (-785.175) [-785.605] (-790.791) * [-786.294] (-786.166) (-785.570) (-788.914) -- 0:00:47
      227500 -- (-791.790) (-786.972) (-788.440) [-789.380] * [-786.126] (-787.227) (-785.930) (-786.849) -- 0:00:50
      228000 -- (-787.407) [-786.818] (-788.177) (-788.735) * [-786.789] (-785.871) (-786.937) (-789.790) -- 0:00:50
      228500 -- (-788.638) (-789.361) [-785.630] (-786.930) * [-786.823] (-786.653) (-786.830) (-789.551) -- 0:00:50
      229000 -- (-789.449) [-788.148] (-788.802) (-786.879) * (-785.799) [-785.733] (-787.340) (-786.758) -- 0:00:50
      229500 -- (-788.836) (-787.318) (-786.479) [-785.890] * [-791.177] (-785.614) (-787.138) (-786.902) -- 0:00:50
      230000 -- (-787.429) [-791.252] (-786.733) (-787.994) * (-785.674) (-786.651) (-787.493) [-789.064] -- 0:00:50

      Average standard deviation of split frequencies: 0.015059

      230500 -- [-790.672] (-786.920) (-786.880) (-787.137) * (-790.434) [-786.060] (-786.500) (-788.423) -- 0:00:50
      231000 -- (-786.282) (-787.594) [-786.174] (-786.179) * (-786.029) (-785.834) (-791.040) [-788.806] -- 0:00:49
      231500 -- (-785.865) (-786.796) (-787.380) [-790.360] * (-786.540) [-787.482] (-786.455) (-786.145) -- 0:00:49
      232000 -- (-791.307) (-787.493) [-788.059] (-788.978) * [-787.182] (-786.112) (-788.302) (-785.869) -- 0:00:49
      232500 -- (-788.086) (-786.944) [-789.632] (-787.156) * (-787.175) [-786.151] (-786.830) (-787.204) -- 0:00:49
      233000 -- (-786.686) [-786.712] (-788.536) (-789.180) * [-786.819] (-786.021) (-786.577) (-787.936) -- 0:00:49
      233500 -- (-786.803) (-790.205) (-787.927) [-787.214] * (-788.418) (-786.385) (-786.673) [-785.891] -- 0:00:49
      234000 -- (-785.937) [-785.211] (-787.023) (-787.169) * (-789.445) [-789.631] (-788.203) (-785.413) -- 0:00:49
      234500 -- (-785.643) [-785.397] (-796.236) (-788.206) * (-790.235) (-790.482) (-788.060) [-786.811] -- 0:00:48
      235000 -- (-786.084) (-785.970) [-785.776] (-787.943) * (-788.651) [-786.767] (-786.290) (-788.331) -- 0:00:48

      Average standard deviation of split frequencies: 0.015454

      235500 -- [-786.064] (-787.628) (-786.446) (-790.227) * [-786.520] (-789.045) (-786.186) (-786.381) -- 0:00:48
      236000 -- (-789.245) (-789.356) (-786.394) [-790.608] * (-786.960) (-789.923) [-785.630] (-787.369) -- 0:00:48
      236500 -- (-791.015) (-787.412) [-785.693] (-795.400) * (-787.929) [-786.513] (-786.627) (-786.807) -- 0:00:48
      237000 -- (-788.896) [-786.798] (-785.699) (-795.263) * (-786.956) [-789.164] (-789.027) (-786.018) -- 0:00:48
      237500 -- (-786.307) (-788.571) [-786.488] (-789.993) * (-788.549) (-786.559) (-789.984) [-786.452] -- 0:00:48
      238000 -- [-786.232] (-786.685) (-789.646) (-787.603) * (-787.760) [-787.021] (-787.281) (-785.416) -- 0:00:48
      238500 -- (-786.710) (-787.782) (-787.079) [-786.878] * (-788.821) (-786.452) [-788.397] (-786.663) -- 0:00:47
      239000 -- (-788.356) [-786.520] (-792.075) (-789.270) * [-789.482] (-788.201) (-786.442) (-787.368) -- 0:00:47
      239500 -- (-786.664) (-787.173) (-788.185) [-785.112] * [-788.988] (-786.406) (-786.173) (-791.586) -- 0:00:47
      240000 -- (-785.302) [-786.744] (-786.402) (-785.114) * [-787.018] (-786.802) (-786.030) (-789.817) -- 0:00:47

      Average standard deviation of split frequencies: 0.014845

      240500 -- (-787.305) (-787.643) (-791.608) [-785.483] * (-788.451) [-787.137] (-785.345) (-786.484) -- 0:00:47
      241000 -- [-789.386] (-786.069) (-791.382) (-785.719) * [-786.343] (-790.249) (-787.036) (-786.952) -- 0:00:47
      241500 -- (-787.200) [-786.330] (-788.175) (-785.467) * (-787.395) (-786.539) [-786.602] (-786.440) -- 0:00:47
      242000 -- (-788.170) (-792.017) (-788.491) [-785.849] * (-786.640) [-786.828] (-786.703) (-789.574) -- 0:00:46
      242500 -- (-788.371) (-790.944) (-787.024) [-785.857] * [-789.825] (-785.754) (-787.571) (-787.889) -- 0:00:46
      243000 -- [-786.686] (-786.749) (-788.320) (-786.231) * (-792.217) [-785.717] (-788.486) (-785.121) -- 0:00:46
      243500 -- (-788.838) (-786.157) [-786.929] (-787.830) * (-786.728) (-786.046) [-787.846] (-785.203) -- 0:00:46
      244000 -- [-787.802] (-785.532) (-785.788) (-786.612) * (-786.706) [-786.151] (-786.258) (-787.573) -- 0:00:49
      244500 -- (-788.211) (-786.231) (-792.563) [-790.028] * [-785.572] (-787.985) (-786.802) (-786.134) -- 0:00:49
      245000 -- [-785.969] (-787.022) (-789.128) (-787.418) * (-786.141) [-785.887] (-789.817) (-785.839) -- 0:00:49

      Average standard deviation of split frequencies: 0.015129

      245500 -- (-787.035) (-787.056) [-786.058] (-785.960) * (-785.413) (-786.581) (-796.387) [-790.699] -- 0:00:49
      246000 -- (-787.009) [-787.321] (-786.183) (-787.623) * (-787.946) [-785.239] (-786.652) (-787.651) -- 0:00:49
      246500 -- [-786.711] (-793.042) (-786.610) (-790.529) * (-788.380) (-785.239) [-786.893] (-787.278) -- 0:00:48
      247000 -- (-791.691) (-787.113) (-786.915) [-787.628] * (-788.382) (-786.715) (-786.162) [-788.439] -- 0:00:48
      247500 -- (-787.282) [-788.116] (-786.099) (-789.702) * (-790.128) [-785.880] (-792.137) (-787.268) -- 0:00:48
      248000 -- (-788.589) (-786.747) [-786.366] (-786.734) * (-787.439) [-787.908] (-787.257) (-786.731) -- 0:00:48
      248500 -- (-786.176) (-790.771) [-789.023] (-787.864) * [-790.317] (-789.605) (-787.783) (-787.580) -- 0:00:48
      249000 -- (-787.155) (-785.795) [-786.730] (-788.767) * (-787.727) (-786.937) (-787.373) [-787.461] -- 0:00:48
      249500 -- (-787.180) [-785.481] (-787.815) (-788.180) * (-786.991) (-787.303) [-785.802] (-787.368) -- 0:00:48
      250000 -- (-787.723) [-786.222] (-787.617) (-786.211) * [-788.850] (-789.867) (-786.919) (-790.901) -- 0:00:48

      Average standard deviation of split frequencies: 0.014522

      250500 -- (-785.771) (-786.944) [-786.668] (-788.486) * (-787.995) [-788.711] (-787.324) (-786.571) -- 0:00:47
      251000 -- [-787.444] (-786.585) (-786.740) (-785.750) * (-788.999) [-788.519] (-787.687) (-789.502) -- 0:00:47
      251500 -- (-787.453) (-785.434) [-788.898] (-785.589) * (-786.699) (-786.679) (-788.803) [-785.155] -- 0:00:47
      252000 -- (-787.430) (-785.734) (-786.228) [-788.604] * [-787.540] (-787.174) (-788.951) (-786.453) -- 0:00:47
      252500 -- (-787.809) (-785.547) (-788.330) [-788.675] * (-786.709) (-786.410) [-790.356] (-787.515) -- 0:00:47
      253000 -- (-787.543) (-785.591) (-789.419) [-789.561] * (-789.075) (-786.334) [-785.959] (-786.327) -- 0:00:47
      253500 -- (-789.571) [-786.798] (-787.602) (-789.036) * (-792.529) (-786.666) [-786.361] (-785.989) -- 0:00:47
      254000 -- (-792.828) [-786.185] (-787.129) (-791.746) * (-786.593) (-788.850) [-796.372] (-785.691) -- 0:00:46
      254500 -- (-789.196) (-787.609) [-786.754] (-792.830) * (-787.390) (-787.735) (-791.618) [-786.517] -- 0:00:46
      255000 -- (-787.016) [-785.641] (-787.819) (-788.487) * (-793.040) (-788.014) (-787.277) [-788.601] -- 0:00:46

      Average standard deviation of split frequencies: 0.015604

      255500 -- (-788.035) (-785.389) (-787.189) [-787.130] * (-790.525) (-786.859) [-788.445] (-787.030) -- 0:00:46
      256000 -- (-787.620) (-786.272) (-790.867) [-786.730] * (-788.360) (-786.038) [-786.968] (-791.101) -- 0:00:46
      256500 -- (-786.413) [-786.493] (-789.242) (-790.291) * (-785.368) (-785.873) [-788.971] (-791.476) -- 0:00:46
      257000 -- (-787.263) (-786.680) [-788.099] (-788.841) * (-785.968) (-789.758) (-787.600) [-788.720] -- 0:00:46
      257500 -- (-794.804) (-785.966) (-786.891) [-788.360] * (-794.702) (-788.551) [-787.106] (-788.435) -- 0:00:46
      258000 -- (-787.932) (-785.525) (-785.532) [-787.413] * [-791.471] (-789.538) (-787.536) (-786.954) -- 0:00:46
      258500 -- (-788.188) [-786.589] (-787.647) (-788.245) * [-787.028] (-786.812) (-793.132) (-786.619) -- 0:00:45
      259000 -- [-792.176] (-788.755) (-787.410) (-787.708) * (-785.487) [-790.763] (-788.370) (-791.497) -- 0:00:45
      259500 -- (-792.057) (-788.198) (-789.275) [-789.187] * (-786.081) [-785.742] (-789.407) (-788.165) -- 0:00:45
      260000 -- (-788.194) [-788.295] (-786.087) (-786.261) * (-785.868) (-788.514) [-789.620] (-787.242) -- 0:00:45

      Average standard deviation of split frequencies: 0.015774

      260500 -- (-787.141) (-788.070) (-785.637) [-788.248] * (-787.595) (-787.214) [-786.483] (-785.180) -- 0:00:48
      261000 -- (-789.660) (-786.938) [-785.584] (-785.248) * (-788.565) (-786.311) (-785.318) [-785.079] -- 0:00:48
      261500 -- [-790.062] (-787.561) (-788.341) (-786.589) * (-788.657) [-787.327] (-786.060) (-785.423) -- 0:00:48
      262000 -- (-793.148) [-786.926] (-786.510) (-790.534) * (-788.126) (-785.541) (-786.107) [-785.843] -- 0:00:47
      262500 -- (-789.428) [-785.512] (-790.587) (-794.187) * (-787.774) [-786.828] (-785.708) (-785.564) -- 0:00:47
      263000 -- (-787.540) (-785.764) (-787.240) [-787.325] * (-787.155) (-786.628) [-788.566] (-787.907) -- 0:00:47
      263500 -- (-792.328) (-785.680) [-786.588] (-786.322) * (-786.379) (-785.661) [-787.665] (-786.679) -- 0:00:47
      264000 -- [-788.080] (-788.139) (-785.761) (-786.515) * [-786.996] (-788.879) (-787.045) (-788.002) -- 0:00:47
      264500 -- (-788.053) (-786.968) (-785.630) [-789.206] * (-786.141) (-788.568) (-786.105) [-787.504] -- 0:00:47
      265000 -- (-789.361) (-785.687) (-786.013) [-786.897] * (-785.903) (-786.743) [-789.343] (-787.284) -- 0:00:47

      Average standard deviation of split frequencies: 0.016203

      265500 -- (-791.116) (-785.444) (-788.502) [-785.250] * [-789.306] (-788.335) (-788.869) (-787.969) -- 0:00:47
      266000 -- (-790.840) [-788.677] (-787.865) (-786.936) * (-788.902) (-789.934) [-785.771] (-788.224) -- 0:00:46
      266500 -- (-788.597) (-791.840) (-786.605) [-787.266] * (-789.451) (-788.949) [-788.625] (-787.865) -- 0:00:46
      267000 -- [-788.442] (-785.713) (-786.088) (-786.264) * (-787.222) (-788.374) (-786.256) [-795.441] -- 0:00:46
      267500 -- [-788.371] (-786.384) (-785.643) (-786.547) * (-788.796) [-787.752] (-786.464) (-788.021) -- 0:00:46
      268000 -- (-787.608) (-790.597) (-786.356) [-785.729] * [-790.239] (-791.802) (-790.856) (-786.677) -- 0:00:46
      268500 -- [-788.205] (-787.198) (-788.054) (-785.625) * (-788.439) (-789.580) (-786.978) [-786.753] -- 0:00:46
      269000 -- (-787.997) (-786.957) (-787.037) [-787.543] * (-786.945) [-788.910] (-789.012) (-790.766) -- 0:00:46
      269500 -- [-787.906] (-788.342) (-787.246) (-789.057) * (-789.321) (-789.686) (-786.530) [-788.611] -- 0:00:46
      270000 -- (-788.028) (-788.992) (-788.992) [-787.117] * (-790.512) (-791.190) (-789.738) [-786.533] -- 0:00:45

      Average standard deviation of split frequencies: 0.016284

      270500 -- (-786.557) (-786.871) (-788.446) [-785.140] * (-787.780) (-788.618) (-786.761) [-786.341] -- 0:00:45
      271000 -- (-794.272) (-789.480) (-790.086) [-789.150] * [-785.613] (-786.999) (-786.089) (-787.542) -- 0:00:45
      271500 -- (-786.685) (-786.096) (-789.506) [-787.098] * (-789.436) (-787.195) [-787.103] (-787.952) -- 0:00:45
      272000 -- (-785.229) (-788.839) (-788.498) [-785.992] * (-791.195) (-791.817) (-789.629) [-788.214] -- 0:00:45
      272500 -- (-786.423) (-786.502) (-786.664) [-786.481] * [-787.657] (-787.282) (-788.834) (-788.852) -- 0:00:45
      273000 -- (-786.377) (-788.136) (-788.585) [-785.278] * (-787.196) (-787.025) [-786.068] (-792.561) -- 0:00:45
      273500 -- [-785.851] (-787.010) (-787.669) (-785.828) * (-787.015) (-787.779) (-785.737) [-786.604] -- 0:00:45
      274000 -- (-786.327) (-786.385) (-794.361) [-785.808] * (-789.840) [-785.339] (-786.738) (-786.534) -- 0:00:45
      274500 -- (-786.433) [-786.334] (-792.315) (-788.615) * (-786.277) [-786.246] (-787.933) (-791.551) -- 0:00:44
      275000 -- (-786.253) [-787.832] (-789.303) (-788.063) * (-786.584) (-786.931) (-789.374) [-786.500] -- 0:00:44

      Average standard deviation of split frequencies: 0.015911

      275500 -- (-785.859) (-788.633) (-785.980) [-787.313] * (-790.390) (-791.382) [-786.072] (-791.021) -- 0:00:44
      276000 -- (-785.675) (-786.896) [-786.063] (-790.062) * (-788.035) (-785.725) (-786.366) [-786.638] -- 0:00:44
      276500 -- [-787.202] (-785.324) (-794.232) (-790.122) * (-786.609) [-785.508] (-786.659) (-790.699) -- 0:00:47
      277000 -- [-787.254] (-787.166) (-788.132) (-789.504) * [-786.792] (-787.165) (-786.513) (-787.675) -- 0:00:46
      277500 -- (-785.784) (-788.145) [-787.613] (-786.040) * [-786.772] (-791.470) (-787.973) (-790.572) -- 0:00:46
      278000 -- (-785.784) (-787.092) [-789.155] (-790.381) * (-786.942) (-792.528) [-791.746] (-786.282) -- 0:00:46
      278500 -- (-787.903) (-785.860) [-791.016] (-790.035) * (-786.898) (-787.154) [-785.178] (-787.875) -- 0:00:46
      279000 -- (-788.156) (-787.243) [-785.815] (-791.677) * (-785.973) (-787.826) [-788.765] (-786.468) -- 0:00:46
      279500 -- [-788.069] (-790.161) (-785.663) (-786.735) * [-786.806] (-790.228) (-787.535) (-785.709) -- 0:00:46
      280000 -- (-787.010) (-790.526) (-785.192) [-786.599] * (-786.252) (-786.457) (-790.290) [-787.729] -- 0:00:46

      Average standard deviation of split frequencies: 0.016177

      280500 -- (-787.824) [-785.756] (-785.585) (-787.267) * (-787.549) (-785.471) [-786.333] (-786.842) -- 0:00:46
      281000 -- (-788.395) [-786.038] (-789.202) (-786.389) * (-788.026) (-787.124) [-786.383] (-786.955) -- 0:00:46
      281500 -- [-786.857] (-785.663) (-786.508) (-786.495) * (-785.836) (-787.768) (-789.750) [-787.499] -- 0:00:45
      282000 -- (-786.117) (-788.767) [-787.657] (-787.013) * (-787.486) [-788.791] (-787.582) (-788.780) -- 0:00:45
      282500 -- (-787.261) [-788.156] (-787.190) (-788.484) * (-786.987) [-787.052] (-785.768) (-787.284) -- 0:00:45
      283000 -- (-788.687) [-789.836] (-788.556) (-787.535) * [-788.016] (-792.517) (-788.971) (-788.629) -- 0:00:45
      283500 -- (-786.498) [-789.089] (-786.319) (-788.486) * (-786.173) (-788.158) [-787.124] (-796.312) -- 0:00:45
      284000 -- (-786.986) (-787.711) (-787.674) [-792.096] * (-788.152) (-789.820) [-789.477] (-787.411) -- 0:00:45
      284500 -- [-788.072] (-785.762) (-789.493) (-791.245) * (-788.252) [-788.557] (-787.031) (-785.994) -- 0:00:45
      285000 -- (-790.146) (-787.879) [-788.962] (-789.135) * [-789.276] (-787.207) (-788.308) (-785.593) -- 0:00:45

      Average standard deviation of split frequencies: 0.015494

      285500 -- (-788.717) (-787.523) [-787.620] (-788.995) * [-788.765] (-787.159) (-787.194) (-788.596) -- 0:00:45
      286000 -- (-788.031) (-786.547) (-785.913) [-785.656] * (-787.068) [-790.186] (-787.459) (-786.849) -- 0:00:44
      286500 -- (-786.679) (-787.908) [-789.989] (-786.798) * [-786.393] (-788.622) (-793.141) (-787.261) -- 0:00:44
      287000 -- [-786.191] (-787.628) (-787.689) (-787.718) * [-787.479] (-791.462) (-785.302) (-786.938) -- 0:00:44
      287500 -- (-786.615) (-788.820) (-787.069) [-786.420] * (-786.848) (-787.766) [-786.099] (-789.907) -- 0:00:44
      288000 -- (-786.468) [-786.273] (-789.596) (-787.500) * [-789.186] (-790.139) (-790.007) (-789.899) -- 0:00:44
      288500 -- [-785.265] (-790.204) (-786.755) (-788.067) * (-786.438) (-789.950) (-789.185) [-790.062] -- 0:00:44
      289000 -- [-788.747] (-787.525) (-788.506) (-787.368) * (-789.278) (-785.665) (-787.349) [-787.955] -- 0:00:44
      289500 -- (-789.586) (-787.719) (-787.872) [-786.956] * (-785.839) (-787.452) [-787.263] (-788.432) -- 0:00:44
      290000 -- (-792.667) (-789.391) (-786.475) [-789.027] * (-787.684) (-788.134) [-786.468] (-787.386) -- 0:00:44

      Average standard deviation of split frequencies: 0.015194

      290500 -- (-786.576) [-787.027] (-787.702) (-787.267) * [-785.544] (-796.285) (-790.914) (-787.647) -- 0:00:43
      291000 -- (-786.009) (-787.305) (-786.758) [-786.349] * [-785.320] (-789.694) (-786.762) (-789.272) -- 0:00:43
      291500 -- (-788.042) [-786.003] (-786.141) (-785.568) * (-785.509) (-786.763) (-791.332) [-788.917] -- 0:00:43
      292000 -- (-789.503) (-786.509) (-786.222) [-788.078] * (-791.902) (-785.385) [-787.279] (-787.900) -- 0:00:43
      292500 -- (-785.817) [-786.000] (-789.780) (-788.564) * (-786.567) (-787.720) (-787.252) [-786.388] -- 0:00:43
      293000 -- (-785.950) (-785.844) (-790.556) [-788.658] * (-787.037) (-786.568) [-788.612] (-786.792) -- 0:00:43
      293500 -- (-786.920) (-785.863) (-790.090) [-789.717] * (-786.186) [-785.782] (-791.731) (-786.266) -- 0:00:45
      294000 -- [-789.687] (-786.555) (-786.589) (-786.475) * [-788.690] (-788.546) (-787.072) (-786.020) -- 0:00:45
      294500 -- (-788.196) (-787.725) [-785.705] (-787.333) * (-786.750) [-785.690] (-786.793) (-786.826) -- 0:00:45
      295000 -- (-788.580) (-786.723) [-785.342] (-786.155) * (-789.444) (-785.523) (-789.198) [-790.619] -- 0:00:45

      Average standard deviation of split frequencies: 0.015171

      295500 -- (-789.378) (-787.220) (-787.238) [-787.349] * [-787.476] (-788.464) (-788.757) (-787.642) -- 0:00:45
      296000 -- (-788.943) [-789.656] (-788.235) (-786.124) * (-788.960) (-788.455) (-788.836) [-787.586] -- 0:00:45
      296500 -- (-794.435) (-787.971) [-787.279] (-786.160) * (-791.981) (-785.676) [-788.014] (-788.956) -- 0:00:45
      297000 -- (-787.802) [-787.866] (-787.764) (-787.588) * [-788.697] (-785.878) (-786.412) (-786.732) -- 0:00:44
      297500 -- (-787.246) (-785.576) [-787.736] (-787.919) * (-790.667) [-787.014] (-785.705) (-788.066) -- 0:00:44
      298000 -- (-787.447) [-786.123] (-787.012) (-785.971) * (-790.911) (-789.464) (-787.793) [-786.802] -- 0:00:44
      298500 -- (-786.880) (-786.276) (-788.621) [-785.674] * [-788.913] (-786.353) (-792.133) (-787.898) -- 0:00:44
      299000 -- (-797.452) [-788.891] (-788.446) (-787.584) * (-785.842) [-786.832] (-786.990) (-792.968) -- 0:00:44
      299500 -- (-788.019) [-787.503] (-787.900) (-786.937) * [-785.885] (-786.849) (-787.424) (-788.014) -- 0:00:44
      300000 -- (-787.382) (-788.194) (-786.892) [-785.401] * (-786.081) (-789.181) (-787.715) [-786.754] -- 0:00:44

      Average standard deviation of split frequencies: 0.016724

      300500 -- (-785.918) (-787.231) [-786.285] (-787.106) * (-789.001) (-790.478) (-789.753) [-786.263] -- 0:00:44
      301000 -- [-786.452] (-786.428) (-786.433) (-786.904) * [-786.248] (-787.429) (-787.884) (-785.884) -- 0:00:44
      301500 -- (-786.734) (-786.934) [-788.152] (-788.504) * (-787.571) (-786.955) [-790.255] (-788.919) -- 0:00:44
      302000 -- (-787.773) (-787.447) (-787.551) [-791.654] * (-785.498) [-788.503] (-787.781) (-787.545) -- 0:00:43
      302500 -- (-787.299) [-788.569] (-788.089) (-789.706) * (-788.939) (-785.630) [-785.677] (-792.005) -- 0:00:43
      303000 -- (-787.568) (-787.398) [-788.390] (-788.350) * (-797.278) [-788.285] (-786.234) (-787.829) -- 0:00:43
      303500 -- (-789.840) [-788.612] (-791.861) (-786.005) * [-786.393] (-787.071) (-786.113) (-785.796) -- 0:00:43
      304000 -- (-790.535) (-787.064) (-787.861) [-785.879] * (-788.808) (-789.449) (-788.526) [-787.817] -- 0:00:43
      304500 -- (-791.909) (-789.349) [-785.561] (-786.353) * (-788.568) [-787.570] (-790.275) (-787.066) -- 0:00:43
      305000 -- (-787.171) (-789.909) [-786.228] (-787.701) * (-792.271) (-786.876) [-787.785] (-789.634) -- 0:00:43

      Average standard deviation of split frequencies: 0.016004

      305500 -- (-787.189) (-787.627) [-786.891] (-786.468) * (-792.117) [-786.969] (-787.896) (-786.742) -- 0:00:43
      306000 -- (-790.473) [-787.724] (-788.156) (-788.211) * (-789.925) (-787.274) (-792.481) [-785.980] -- 0:00:43
      306500 -- (-787.639) [-787.336] (-787.334) (-790.363) * [-788.784] (-786.028) (-786.941) (-786.395) -- 0:00:42
      307000 -- (-787.008) (-788.417) (-786.320) [-787.193] * (-788.525) (-787.508) (-788.674) [-788.577] -- 0:00:42
      307500 -- (-788.027) [-786.182] (-786.970) (-786.189) * [-787.229] (-785.323) (-789.613) (-791.556) -- 0:00:42
      308000 -- [-790.721] (-786.781) (-787.330) (-786.019) * [-787.409] (-788.753) (-786.605) (-787.466) -- 0:00:42
      308500 -- (-789.828) (-787.278) (-786.934) [-785.967] * (-788.606) [-789.358] (-790.558) (-788.289) -- 0:00:42
      309000 -- [-787.294] (-786.477) (-787.267) (-786.406) * [-786.475] (-786.018) (-787.607) (-789.318) -- 0:00:42
      309500 -- (-789.240) [-786.336] (-786.939) (-786.533) * (-786.540) (-788.167) [-786.991] (-789.087) -- 0:00:44
      310000 -- (-789.785) [-786.906] (-787.888) (-786.631) * (-787.215) (-787.250) [-788.022] (-788.996) -- 0:00:44

      Average standard deviation of split frequencies: 0.016186

      310500 -- [-789.448] (-786.315) (-786.894) (-785.381) * (-793.403) (-786.813) [-788.048] (-789.128) -- 0:00:44
      311000 -- (-788.359) (-785.695) [-787.558] (-785.624) * (-788.872) (-785.884) (-787.967) [-789.225] -- 0:00:44
      311500 -- (-787.997) (-786.708) (-788.731) [-788.885] * (-787.886) (-789.515) [-786.254] (-786.471) -- 0:00:44
      312000 -- (-793.124) (-786.122) [-787.781] (-790.021) * [-787.785] (-786.546) (-786.900) (-786.104) -- 0:00:44
      312500 -- (-788.112) (-787.112) [-788.267] (-787.651) * [-787.068] (-791.635) (-787.826) (-786.810) -- 0:00:44
      313000 -- (-789.088) [-788.957] (-789.054) (-788.582) * (-788.135) [-791.535] (-786.849) (-787.724) -- 0:00:43
      313500 -- (-789.267) (-786.894) [-788.012] (-791.605) * (-791.011) (-788.513) [-785.406] (-789.940) -- 0:00:43
      314000 -- [-787.064] (-786.165) (-788.730) (-786.642) * [-792.189] (-786.164) (-786.648) (-786.469) -- 0:00:43
      314500 -- (-787.160) (-786.522) (-787.582) [-787.223] * (-789.259) (-785.728) [-789.023] (-785.769) -- 0:00:43
      315000 -- (-788.050) (-787.497) [-787.771] (-790.205) * (-788.656) (-786.326) [-790.785] (-786.364) -- 0:00:43

      Average standard deviation of split frequencies: 0.016990

      315500 -- [-786.819] (-788.417) (-785.976) (-786.256) * [-787.429] (-787.068) (-790.229) (-785.404) -- 0:00:43
      316000 -- [-790.081] (-790.294) (-786.475) (-785.591) * (-786.383) (-786.798) [-788.425] (-788.379) -- 0:00:43
      316500 -- (-787.306) (-785.902) [-786.561] (-785.958) * (-786.156) (-786.639) (-786.334) [-786.431] -- 0:00:43
      317000 -- (-786.950) (-786.909) (-787.484) [-785.753] * [-789.464] (-786.380) (-787.270) (-786.212) -- 0:00:43
      317500 -- (-787.172) (-791.098) (-786.753) [-787.003] * (-792.228) (-788.480) [-786.125] (-791.972) -- 0:00:42
      318000 -- [-788.219] (-788.066) (-785.686) (-789.318) * [-785.558] (-789.229) (-786.256) (-788.114) -- 0:00:42
      318500 -- (-786.772) (-787.249) (-786.015) [-787.248] * [-787.629] (-785.407) (-789.081) (-787.800) -- 0:00:42
      319000 -- (-788.365) (-787.551) [-787.059] (-787.929) * (-787.745) (-786.688) (-787.690) [-788.462] -- 0:00:42
      319500 -- (-786.218) [-788.647] (-787.075) (-786.911) * [-788.228] (-786.410) (-788.332) (-790.316) -- 0:00:42
      320000 -- [-786.509] (-788.050) (-788.736) (-787.273) * (-788.680) (-786.579) (-788.717) [-788.322] -- 0:00:42

      Average standard deviation of split frequencies: 0.018049

      320500 -- (-785.582) [-789.625] (-792.452) (-788.296) * (-788.180) (-787.274) [-785.371] (-787.181) -- 0:00:42
      321000 -- [-786.151] (-785.976) (-788.553) (-789.289) * (-785.150) [-786.760] (-785.675) (-790.954) -- 0:00:42
      321500 -- (-785.417) (-786.315) [-787.168] (-788.386) * (-785.227) [-786.495] (-785.402) (-787.735) -- 0:00:42
      322000 -- [-785.418] (-786.084) (-785.913) (-790.520) * (-786.304) [-788.312] (-787.694) (-791.638) -- 0:00:42
      322500 -- (-787.136) (-785.757) (-786.381) [-787.940] * (-787.803) [-787.538] (-790.223) (-785.550) -- 0:00:42
      323000 -- [-787.882] (-787.259) (-786.822) (-788.388) * (-790.625) (-788.653) (-788.099) [-785.732] -- 0:00:41
      323500 -- [-787.048] (-786.590) (-786.712) (-788.393) * (-788.263) (-787.342) [-786.692] (-787.013) -- 0:00:41
      324000 -- (-787.337) (-790.779) (-787.226) [-792.033] * (-788.797) (-790.030) (-788.426) [-790.360] -- 0:00:41
      324500 -- (-786.945) (-789.530) [-788.759] (-789.305) * (-785.232) (-788.930) (-789.349) [-789.194] -- 0:00:41
      325000 -- (-786.513) [-787.754] (-785.873) (-787.829) * [-787.974] (-786.401) (-786.240) (-788.871) -- 0:00:41

      Average standard deviation of split frequencies: 0.017915

      325500 -- (-788.620) (-787.398) (-787.677) [-786.942] * (-785.935) (-790.013) (-791.422) [-786.639] -- 0:00:41
      326000 -- (-788.210) (-786.572) (-788.082) [-786.776] * (-788.038) (-793.529) [-786.949] (-790.634) -- 0:00:43
      326500 -- [-787.741] (-787.123) (-788.012) (-786.220) * [-788.621] (-788.984) (-788.246) (-789.522) -- 0:00:43
      327000 -- (-791.526) [-788.665] (-788.676) (-787.010) * [-786.505] (-791.934) (-788.588) (-788.377) -- 0:00:43
      327500 -- (-790.727) [-787.779] (-791.442) (-787.690) * (-787.942) (-790.618) [-788.348] (-787.877) -- 0:00:43
      328000 -- (-789.634) (-787.763) (-786.467) [-792.301] * [-786.004] (-787.898) (-788.730) (-790.770) -- 0:00:43
      328500 -- (-786.605) (-790.135) [-787.584] (-786.492) * (-790.456) (-787.918) (-789.047) [-786.366] -- 0:00:42
      329000 -- (-787.150) [-788.420] (-786.718) (-788.916) * (-786.273) (-787.185) (-788.178) [-786.397] -- 0:00:42
      329500 -- (-787.986) (-789.495) [-786.909] (-789.007) * (-787.212) [-786.383] (-790.547) (-788.504) -- 0:00:42
      330000 -- (-786.425) (-790.578) (-785.780) [-787.897] * (-785.318) (-787.183) (-788.811) [-788.352] -- 0:00:42

      Average standard deviation of split frequencies: 0.016957

      330500 -- (-787.428) (-787.939) [-786.048] (-789.432) * (-786.635) [-787.247] (-785.453) (-787.983) -- 0:00:42
      331000 -- [-787.467] (-786.239) (-786.733) (-786.053) * (-786.576) (-786.023) [-787.765] (-787.541) -- 0:00:42
      331500 -- (-791.878) [-785.602] (-785.929) (-785.914) * (-788.264) (-785.831) [-786.235] (-790.384) -- 0:00:42
      332000 -- [-786.110] (-785.709) (-788.765) (-788.205) * (-788.247) [-787.435] (-788.576) (-788.418) -- 0:00:42
      332500 -- (-785.554) (-786.606) (-786.321) [-787.938] * [-786.038] (-787.811) (-788.300) (-788.607) -- 0:00:42
      333000 -- [-785.648] (-787.019) (-790.394) (-789.450) * (-786.022) (-790.359) (-792.222) [-786.979] -- 0:00:42
      333500 -- (-786.758) (-786.721) [-786.255] (-787.869) * (-786.398) (-786.635) (-786.773) [-787.116] -- 0:00:41
      334000 -- (-788.616) (-787.521) [-786.245] (-786.936) * [-785.626] (-787.694) (-788.437) (-789.731) -- 0:00:41
      334500 -- (-786.417) (-785.658) (-791.189) [-788.498] * [-785.306] (-793.330) (-786.694) (-787.614) -- 0:00:41
      335000 -- (-788.123) (-785.609) [-786.625] (-788.518) * [-786.439] (-789.573) (-786.423) (-785.466) -- 0:00:41

      Average standard deviation of split frequencies: 0.017331

      335500 -- (-787.805) [-785.453] (-786.970) (-789.917) * (-787.289) (-786.734) [-786.220] (-785.319) -- 0:00:41
      336000 -- (-787.321) (-787.223) (-788.246) [-785.255] * (-791.124) (-785.797) [-786.949] (-789.428) -- 0:00:41
      336500 -- (-786.197) (-786.397) (-785.519) [-785.285] * (-793.093) (-789.626) [-787.244] (-792.152) -- 0:00:41
      337000 -- (-785.819) [-786.804] (-787.190) (-787.543) * (-788.576) [-788.260] (-788.846) (-786.591) -- 0:00:41
      337500 -- (-786.906) (-786.179) (-789.752) [-791.061] * (-792.116) [-789.282] (-787.731) (-787.790) -- 0:00:41
      338000 -- [-786.838] (-789.866) (-789.081) (-787.814) * (-791.593) (-789.624) [-791.743] (-791.166) -- 0:00:41
      338500 -- [-785.846] (-788.751) (-789.411) (-789.931) * [-786.149] (-790.190) (-787.672) (-789.517) -- 0:00:41
      339000 -- (-789.244) (-787.590) [-785.865] (-786.705) * (-791.307) (-790.533) [-787.188] (-788.758) -- 0:00:40
      339500 -- (-793.329) (-785.246) [-785.991] (-786.820) * (-787.534) [-790.090] (-788.307) (-789.150) -- 0:00:40
      340000 -- (-786.895) (-787.003) [-788.386] (-787.897) * (-786.193) (-797.639) (-786.717) [-789.770] -- 0:00:40

      Average standard deviation of split frequencies: 0.017042

      340500 -- (-786.550) (-786.147) [-786.889] (-788.415) * (-788.892) (-789.061) [-791.345] (-789.802) -- 0:00:40
      341000 -- [-786.445] (-786.403) (-787.846) (-787.749) * (-786.360) [-785.835] (-789.266) (-791.194) -- 0:00:40
      341500 -- (-787.502) (-786.030) [-786.703] (-787.408) * (-788.345) (-786.367) [-785.832] (-790.116) -- 0:00:40
      342000 -- (-787.267) (-788.109) (-788.570) [-788.985] * (-787.987) [-786.014] (-786.854) (-786.452) -- 0:00:40
      342500 -- (-785.890) [-785.992] (-791.218) (-788.596) * (-787.569) [-788.268] (-789.349) (-788.750) -- 0:00:42
      343000 -- [-786.437] (-785.776) (-791.897) (-786.962) * [-787.362] (-787.392) (-790.605) (-786.626) -- 0:00:42
      343500 -- [-785.844] (-786.177) (-786.936) (-787.456) * [-786.816] (-786.949) (-789.198) (-786.029) -- 0:00:42
      344000 -- [-786.800] (-787.605) (-786.266) (-786.587) * (-785.659) (-786.646) [-786.394] (-787.083) -- 0:00:41
      344500 -- (-787.093) [-789.123] (-785.911) (-785.977) * (-786.118) (-785.955) [-787.686] (-785.531) -- 0:00:41
      345000 -- (-786.242) [-786.987] (-786.920) (-786.012) * [-787.495] (-785.363) (-788.229) (-786.573) -- 0:00:41

      Average standard deviation of split frequencies: 0.017066

      345500 -- (-785.663) (-789.056) [-786.177] (-785.966) * (-788.230) [-785.363] (-787.511) (-787.069) -- 0:00:41
      346000 -- [-786.805] (-789.753) (-786.385) (-785.644) * (-787.864) (-786.397) (-790.199) [-787.698] -- 0:00:41
      346500 -- (-785.482) [-789.496] (-786.295) (-788.702) * (-786.960) (-787.117) [-786.800] (-787.136) -- 0:00:41
      347000 -- [-786.189] (-789.680) (-788.019) (-786.531) * (-788.573) (-790.301) (-789.826) [-786.518] -- 0:00:41
      347500 -- (-786.671) (-791.949) [-785.822] (-788.663) * (-786.635) (-788.662) [-786.502] (-785.670) -- 0:00:41
      348000 -- (-788.802) (-787.059) [-785.840] (-788.158) * [-788.644] (-787.104) (-785.822) (-786.972) -- 0:00:41
      348500 -- (-788.498) (-790.849) [-787.111] (-786.633) * (-786.157) (-786.856) (-787.331) [-785.343] -- 0:00:41
      349000 -- [-786.652] (-788.584) (-788.075) (-787.826) * (-786.188) (-786.498) (-785.857) [-786.459] -- 0:00:41
      349500 -- (-788.155) (-792.552) [-786.285] (-786.840) * (-788.395) (-788.886) [-786.034] (-788.934) -- 0:00:40
      350000 -- (-788.965) (-787.856) (-786.839) [-786.413] * (-792.443) (-789.400) (-786.719) [-790.757] -- 0:00:40

      Average standard deviation of split frequencies: 0.016804

      350500 -- (-789.682) [-789.150] (-786.325) (-788.962) * (-793.625) (-787.167) [-787.870] (-786.642) -- 0:00:40
      351000 -- (-791.090) (-787.234) [-788.205] (-789.057) * [-789.813] (-786.016) (-788.542) (-786.236) -- 0:00:40
      351500 -- (-791.660) [-789.801] (-787.494) (-792.089) * (-786.935) (-785.998) [-788.358] (-788.017) -- 0:00:40
      352000 -- (-789.264) [-786.093] (-786.951) (-787.793) * (-786.150) (-786.696) [-788.659] (-789.746) -- 0:00:40
      352500 -- (-785.675) (-787.438) (-790.882) [-785.884] * [-786.541] (-792.149) (-787.357) (-785.648) -- 0:00:40
      353000 -- (-787.321) (-788.715) [-785.677] (-785.605) * (-787.506) (-793.492) [-787.122] (-786.071) -- 0:00:40
      353500 -- (-791.609) (-788.459) (-787.141) [-785.612] * (-786.656) [-789.867] (-787.962) (-790.306) -- 0:00:40
      354000 -- [-791.677] (-790.647) (-786.533) (-788.339) * (-787.509) (-789.611) [-788.701] (-787.854) -- 0:00:40
      354500 -- [-788.228] (-786.845) (-785.963) (-787.369) * (-787.289) (-787.044) [-787.543] (-787.870) -- 0:00:40
      355000 -- (-788.032) (-786.518) (-786.290) [-787.812] * (-786.929) (-788.593) (-786.572) [-786.755] -- 0:00:39

      Average standard deviation of split frequencies: 0.017354

      355500 -- (-789.724) [-786.428] (-786.470) (-786.965) * [-785.740] (-787.304) (-786.084) (-793.824) -- 0:00:39
      356000 -- (-788.968) (-785.885) (-785.689) [-787.094] * (-787.270) (-787.490) (-787.847) [-789.006] -- 0:00:39
      356500 -- (-787.070) (-786.724) (-789.522) [-788.327] * (-788.684) (-785.949) [-785.671] (-786.318) -- 0:00:39
      357000 -- (-786.884) (-786.152) [-786.439] (-788.552) * (-786.565) [-786.667] (-785.668) (-789.863) -- 0:00:39
      357500 -- (-787.050) (-788.228) (-789.717) [-787.596] * [-786.775] (-787.910) (-788.582) (-789.072) -- 0:00:39
      358000 -- (-785.864) [-789.929] (-792.453) (-791.063) * (-786.896) [-788.794] (-790.006) (-787.584) -- 0:00:39
      358500 -- (-785.803) (-792.188) [-787.798] (-785.392) * (-787.619) (-790.131) [-786.544] (-788.272) -- 0:00:39
      359000 -- (-785.937) (-790.203) [-788.090] (-786.844) * (-785.893) [-788.541] (-786.920) (-788.280) -- 0:00:39
      359500 -- (-792.725) [-787.312] (-788.127) (-787.879) * (-789.621) (-786.070) [-787.180] (-787.880) -- 0:00:40
      360000 -- (-788.469) (-785.386) (-791.390) [-786.334] * [-787.538] (-791.775) (-786.689) (-786.886) -- 0:00:40

      Average standard deviation of split frequencies: 0.017473

      360500 -- (-790.354) (-787.769) (-789.632) [-787.216] * (-790.003) [-789.115] (-788.614) (-787.766) -- 0:00:40
      361000 -- (-788.093) [-789.320] (-789.676) (-789.006) * (-789.648) (-788.937) [-789.360] (-790.278) -- 0:00:40
      361500 -- (-788.315) (-787.342) [-787.319] (-789.152) * [-788.760] (-786.139) (-789.001) (-789.991) -- 0:00:40
      362000 -- [-786.836] (-791.019) (-788.331) (-785.829) * (-789.971) [-788.527] (-787.288) (-786.867) -- 0:00:40
      362500 -- (-792.297) (-792.652) [-785.434] (-787.012) * (-787.503) (-787.016) (-785.987) [-791.465] -- 0:00:40
      363000 -- [-787.909] (-796.703) (-787.353) (-787.224) * (-787.891) [-785.964] (-790.041) (-788.605) -- 0:00:40
      363500 -- (-790.841) (-791.402) [-788.908] (-788.075) * (-787.041) (-787.371) (-787.424) [-787.463] -- 0:00:40
      364000 -- (-785.797) [-787.876] (-787.490) (-787.788) * [-786.748] (-792.837) (-786.457) (-787.228) -- 0:00:40
      364500 -- [-788.882] (-789.239) (-789.269) (-786.277) * (-788.050) [-793.500] (-787.793) (-789.701) -- 0:00:40
      365000 -- (-787.502) (-789.364) (-788.866) [-786.276] * (-786.657) (-788.554) [-786.452] (-794.642) -- 0:00:40

      Average standard deviation of split frequencies: 0.016202

      365500 -- [-786.003] (-788.665) (-791.388) (-787.595) * [-787.868] (-789.304) (-787.355) (-785.406) -- 0:00:39
      366000 -- (-786.097) [-788.630] (-785.622) (-793.289) * (-791.659) (-789.288) (-785.211) [-785.764] -- 0:00:39
      366500 -- (-785.749) (-790.283) (-785.942) [-787.345] * (-787.921) (-791.077) (-788.093) [-788.680] -- 0:00:39
      367000 -- (-787.215) [-786.196] (-786.654) (-790.712) * [-786.767] (-785.733) (-788.294) (-788.737) -- 0:00:39
      367500 -- [-787.889] (-791.668) (-787.749) (-790.603) * (-785.865) (-787.654) (-785.878) [-786.543] -- 0:00:39
      368000 -- (-786.629) (-791.106) [-786.612] (-787.259) * (-786.520) [-787.526] (-787.053) (-785.482) -- 0:00:39
      368500 -- (-789.304) [-789.514] (-785.456) (-786.764) * (-786.967) (-786.447) (-786.573) [-792.594] -- 0:00:39
      369000 -- (-787.150) [-788.255] (-786.281) (-788.084) * (-788.239) (-790.106) (-788.123) [-785.570] -- 0:00:39
      369500 -- [-786.894] (-788.255) (-786.903) (-787.759) * (-787.904) (-794.613) (-787.926) [-790.622] -- 0:00:39
      370000 -- (-787.093) [-789.516] (-786.696) (-787.970) * (-786.985) (-790.309) (-788.913) [-787.726] -- 0:00:39

      Average standard deviation of split frequencies: 0.016250

      370500 -- [-789.097] (-789.300) (-788.280) (-787.069) * (-788.137) [-786.693] (-787.827) (-788.690) -- 0:00:39
      371000 -- (-786.046) [-788.308] (-786.893) (-788.333) * [-787.922] (-788.780) (-792.079) (-787.409) -- 0:00:38
      371500 -- [-786.890] (-786.481) (-787.034) (-789.887) * (-788.651) [-787.877] (-793.314) (-787.597) -- 0:00:38
      372000 -- (-787.183) (-788.298) (-787.609) [-787.133] * (-791.292) [-786.694] (-788.839) (-790.476) -- 0:00:38
      372500 -- (-786.346) [-786.536] (-787.249) (-788.133) * (-788.483) (-787.821) [-788.087] (-788.862) -- 0:00:38
      373000 -- (-786.263) (-786.932) [-787.511] (-788.519) * (-788.552) [-786.958] (-786.244) (-786.085) -- 0:00:38
      373500 -- (-786.300) [-785.429] (-791.974) (-786.705) * [-790.123] (-786.895) (-786.345) (-786.707) -- 0:00:38
      374000 -- (-788.308) (-789.158) [-788.244] (-786.326) * (-790.486) [-787.718] (-792.878) (-787.691) -- 0:00:38
      374500 -- (-788.836) [-789.346] (-786.674) (-791.728) * (-790.553) (-786.775) (-794.291) [-786.597] -- 0:00:38
      375000 -- (-788.868) (-795.313) [-786.578] (-788.538) * (-790.359) (-793.510) (-787.865) [-786.152] -- 0:00:38

      Average standard deviation of split frequencies: 0.015309

      375500 -- [-788.346] (-785.960) (-786.489) (-786.803) * [-786.711] (-788.215) (-792.233) (-788.195) -- 0:00:38
      376000 -- (-792.549) (-787.585) (-787.115) [-787.191] * (-786.493) (-790.532) [-790.741] (-791.105) -- 0:00:39
      376500 -- (-786.939) [-786.549] (-787.808) (-786.979) * (-788.985) (-790.314) (-789.277) [-789.716] -- 0:00:39
      377000 -- (-787.493) (-787.922) (-786.556) [-788.639] * (-790.162) (-788.374) [-788.408] (-787.141) -- 0:00:39
      377500 -- (-786.105) (-786.486) (-791.621) [-785.650] * (-787.789) [-787.661] (-786.753) (-788.032) -- 0:00:39
      378000 -- (-787.574) [-786.470] (-790.698) (-786.790) * (-789.894) (-787.554) (-790.313) [-790.626] -- 0:00:39
      378500 -- (-790.775) (-786.620) (-786.851) [-786.369] * [-787.361] (-790.393) (-787.675) (-789.717) -- 0:00:39
      379000 -- (-791.749) [-786.636] (-788.096) (-788.123) * [-786.924] (-787.438) (-788.510) (-786.239) -- 0:00:39
      379500 -- (-789.653) (-788.925) (-787.959) [-787.540] * (-791.821) [-785.502] (-789.431) (-785.634) -- 0:00:39
      380000 -- (-786.266) (-789.422) [-786.133] (-789.780) * (-789.553) [-785.998] (-786.667) (-786.842) -- 0:00:39

      Average standard deviation of split frequencies: 0.014795

      380500 -- (-788.473) (-789.103) [-787.055] (-788.404) * (-788.026) [-789.473] (-790.695) (-788.148) -- 0:00:39
      381000 -- [-787.104] (-786.528) (-788.904) (-787.957) * (-789.654) [-787.113] (-785.471) (-787.749) -- 0:00:38
      381500 -- [-787.697] (-786.575) (-789.451) (-786.197) * (-789.876) [-785.858] (-794.848) (-787.926) -- 0:00:38
      382000 -- [-788.447] (-790.064) (-788.622) (-785.575) * (-791.452) [-788.745] (-787.208) (-787.055) -- 0:00:38
      382500 -- (-787.370) [-788.825] (-787.473) (-785.324) * (-786.960) [-787.553] (-787.300) (-790.436) -- 0:00:38
      383000 -- [-786.223] (-786.515) (-788.209) (-787.567) * [-790.856] (-787.065) (-786.771) (-786.497) -- 0:00:38
      383500 -- (-787.491) [-786.955] (-787.057) (-788.034) * (-787.924) (-786.886) (-792.252) [-786.422] -- 0:00:38
      384000 -- [-786.548] (-787.021) (-786.521) (-787.138) * (-785.966) (-786.763) (-785.606) [-788.551] -- 0:00:38
      384500 -- [-788.625] (-787.387) (-786.405) (-787.018) * (-790.548) (-789.086) (-786.171) [-787.187] -- 0:00:38
      385000 -- (-788.645) (-788.290) [-786.904] (-787.023) * (-787.377) [-788.919] (-790.387) (-790.511) -- 0:00:38

      Average standard deviation of split frequencies: 0.015130

      385500 -- [-788.112] (-787.518) (-791.801) (-788.142) * [-788.903] (-788.518) (-789.001) (-787.023) -- 0:00:38
      386000 -- (-790.044) (-788.907) (-785.780) [-787.540] * (-786.030) (-787.377) (-792.125) [-791.421] -- 0:00:38
      386500 -- (-786.403) (-786.088) (-787.379) [-787.736] * (-790.440) (-786.705) (-786.414) [-787.751] -- 0:00:38
      387000 -- [-785.205] (-787.694) (-786.536) (-788.877) * (-786.964) [-787.976] (-786.414) (-788.700) -- 0:00:38
      387500 -- [-787.879] (-787.593) (-786.359) (-786.630) * (-787.084) [-788.100] (-785.466) (-790.218) -- 0:00:37
      388000 -- (-788.998) (-786.628) [-786.984] (-787.411) * (-785.812) (-792.522) [-786.991] (-789.649) -- 0:00:37
      388500 -- (-787.852) (-787.482) (-788.402) [-787.157] * (-786.564) (-786.361) [-786.417] (-786.765) -- 0:00:37
      389000 -- [-790.192] (-790.447) (-789.651) (-786.310) * (-786.741) [-785.966] (-787.634) (-787.953) -- 0:00:37
      389500 -- (-791.431) (-786.521) [-786.435] (-790.237) * [-789.040] (-791.073) (-787.288) (-788.302) -- 0:00:37
      390000 -- [-785.921] (-785.339) (-786.397) (-786.661) * (-790.256) [-786.493] (-787.548) (-786.526) -- 0:00:39

      Average standard deviation of split frequencies: 0.014346

      390500 -- (-786.273) (-787.901) (-790.937) [-787.645] * [-795.365] (-789.012) (-787.544) (-785.598) -- 0:00:39
      391000 -- (-787.598) (-786.245) (-786.825) [-785.807] * (-786.555) [-787.482] (-787.934) (-788.571) -- 0:00:38
      391500 -- (-788.719) [-787.369] (-786.118) (-793.920) * (-791.617) (-786.253) (-789.969) [-785.688] -- 0:00:38
      392000 -- (-786.128) [-790.197] (-789.559) (-786.430) * (-785.229) (-787.459) [-787.981] (-794.985) -- 0:00:38
      392500 -- [-786.538] (-791.019) (-794.350) (-787.768) * (-786.590) (-787.489) (-790.538) [-786.758] -- 0:00:38
      393000 -- (-786.519) (-786.970) (-789.302) [-785.989] * [-789.411] (-785.965) (-788.165) (-791.622) -- 0:00:38
      393500 -- (-789.750) (-790.844) [-787.049] (-786.518) * [-787.279] (-785.208) (-787.547) (-788.841) -- 0:00:38
      394000 -- (-788.311) [-787.738] (-786.684) (-786.888) * (-787.940) [-788.823] (-787.787) (-787.551) -- 0:00:38
      394500 -- [-787.747] (-791.326) (-786.899) (-786.774) * (-790.077) (-787.111) (-789.674) [-785.837] -- 0:00:38
      395000 -- (-789.445) (-789.141) [-786.107] (-786.894) * [-787.441] (-786.696) (-788.941) (-787.097) -- 0:00:38

      Average standard deviation of split frequencies: 0.014483

      395500 -- (-786.446) (-788.835) (-786.187) [-786.760] * (-787.310) (-791.535) (-786.950) [-789.405] -- 0:00:38
      396000 -- (-789.922) (-791.351) (-785.490) [-787.621] * [-788.355] (-791.316) (-786.705) (-791.905) -- 0:00:38
      396500 -- (-791.556) (-787.842) [-787.601] (-788.117) * (-786.195) (-794.562) (-787.078) [-788.318] -- 0:00:38
      397000 -- (-794.202) (-788.517) (-791.602) [-786.707] * [-786.906] (-788.532) (-787.698) (-787.804) -- 0:00:37
      397500 -- [-790.151] (-785.961) (-788.078) (-790.002) * [-786.363] (-788.999) (-787.865) (-788.528) -- 0:00:37
      398000 -- (-787.771) [-788.004] (-788.172) (-788.769) * [-787.060] (-787.331) (-786.210) (-787.436) -- 0:00:37
      398500 -- (-786.596) (-786.752) (-786.845) [-788.820] * (-788.338) [-790.192] (-788.233) (-786.448) -- 0:00:37
      399000 -- (-790.763) (-787.017) (-791.435) [-787.668] * (-785.566) [-787.258] (-790.076) (-788.401) -- 0:00:37
      399500 -- [-786.579] (-789.075) (-790.117) (-786.412) * (-785.771) (-789.256) (-789.596) [-786.823] -- 0:00:37
      400000 -- (-786.372) (-786.474) [-789.286] (-786.675) * (-787.079) (-787.517) [-789.252] (-785.572) -- 0:00:37

      Average standard deviation of split frequencies: 0.014249

      400500 -- [-786.716] (-787.050) (-791.409) (-785.926) * (-789.770) (-785.305) (-787.848) [-787.300] -- 0:00:37
      401000 -- [-786.721] (-786.736) (-789.698) (-785.502) * [-788.713] (-785.305) (-785.088) (-787.503) -- 0:00:37
      401500 -- (-787.922) [-786.740] (-787.640) (-789.236) * (-789.931) (-789.381) [-787.183] (-789.247) -- 0:00:37
      402000 -- [-787.611] (-787.771) (-787.342) (-786.994) * [-795.208] (-786.520) (-787.531) (-789.441) -- 0:00:37
      402500 -- (-786.331) (-787.639) [-788.268] (-786.963) * (-794.711) (-786.748) (-788.396) [-786.207] -- 0:00:37
      403000 -- [-785.949] (-786.058) (-785.631) (-785.910) * (-786.188) (-786.955) (-787.345) [-789.378] -- 0:00:37
      403500 -- [-788.057] (-788.734) (-786.124) (-789.927) * (-789.379) (-786.584) [-791.403] (-789.222) -- 0:00:38
      404000 -- (-786.393) (-788.903) [-788.138] (-789.766) * (-788.103) [-786.230] (-789.683) (-787.403) -- 0:00:38
      404500 -- (-788.734) (-789.628) (-789.171) [-786.452] * (-790.289) (-786.625) (-787.585) [-786.811] -- 0:00:38
      405000 -- (-789.565) (-787.023) (-787.030) [-788.539] * [-786.077] (-787.260) (-787.388) (-786.031) -- 0:00:38

      Average standard deviation of split frequencies: 0.014239

      405500 -- (-787.993) [-785.730] (-791.347) (-786.126) * [-785.557] (-789.445) (-789.098) (-786.805) -- 0:00:38
      406000 -- (-788.650) [-787.273] (-788.176) (-787.462) * (-792.156) (-790.869) (-790.603) [-787.570] -- 0:00:38
      406500 -- (-788.229) (-790.255) [-790.149] (-787.485) * [-787.078] (-789.853) (-786.329) (-788.757) -- 0:00:37
      407000 -- [-786.112] (-786.445) (-785.763) (-789.552) * (-785.909) [-785.729] (-787.815) (-786.094) -- 0:00:37
      407500 -- (-787.810) (-791.157) [-785.160] (-785.820) * (-789.141) [-787.475] (-791.447) (-786.363) -- 0:00:37
      408000 -- (-787.551) (-786.699) (-786.272) [-786.417] * (-792.157) (-786.485) [-785.932] (-790.323) -- 0:00:37
      408500 -- [-785.675] (-787.060) (-786.797) (-786.129) * [-786.608] (-790.104) (-787.592) (-787.400) -- 0:00:37
      409000 -- (-788.269) (-787.083) (-786.385) [-786.180] * (-786.156) (-790.869) [-786.122] (-786.399) -- 0:00:37
      409500 -- [-788.260] (-787.735) (-786.069) (-786.187) * (-788.292) (-785.809) [-786.234] (-788.503) -- 0:00:37
      410000 -- (-794.075) (-786.865) [-786.046] (-786.488) * [-786.941] (-786.501) (-785.471) (-786.747) -- 0:00:37

      Average standard deviation of split frequencies: 0.013775

      410500 -- (-791.367) (-791.884) [-786.245] (-786.817) * [-788.018] (-787.089) (-789.419) (-787.267) -- 0:00:37
      411000 -- [-787.584] (-791.518) (-785.542) (-787.434) * [-787.907] (-795.382) (-786.607) (-792.396) -- 0:00:37
      411500 -- (-788.475) (-786.280) (-786.408) [-785.543] * [-788.241] (-788.045) (-786.655) (-792.672) -- 0:00:37
      412000 -- (-787.890) [-787.320] (-786.659) (-787.015) * (-789.242) (-791.069) (-788.049) [-789.980] -- 0:00:37
      412500 -- [-785.925] (-790.236) (-788.855) (-786.004) * [-789.282] (-787.679) (-786.720) (-788.490) -- 0:00:37
      413000 -- [-787.618] (-786.514) (-789.392) (-785.397) * [-786.682] (-793.619) (-789.161) (-791.105) -- 0:00:36
      413500 -- (-789.917) (-785.826) [-787.845] (-790.774) * (-787.264) (-788.974) (-789.450) [-785.689] -- 0:00:36
      414000 -- (-786.378) (-785.682) (-787.137) [-788.653] * (-790.234) (-786.090) (-786.782) [-785.819] -- 0:00:36
      414500 -- (-789.800) (-787.198) (-786.913) [-785.999] * (-786.681) (-786.819) [-786.256] (-786.617) -- 0:00:36
      415000 -- (-787.621) (-785.760) [-787.442] (-790.330) * [-786.985] (-789.688) (-788.357) (-790.619) -- 0:00:36

      Average standard deviation of split frequencies: 0.013002

      415500 -- (-788.112) (-785.899) [-786.676] (-787.304) * (-787.037) (-791.404) (-787.130) [-787.239] -- 0:00:37
      416000 -- [-787.254] (-789.326) (-786.105) (-787.807) * (-789.275) (-787.176) (-787.165) [-787.243] -- 0:00:37
      416500 -- [-787.552] (-792.875) (-788.132) (-786.883) * (-786.836) (-785.550) (-795.348) [-787.960] -- 0:00:37
      417000 -- (-788.886) (-792.210) [-787.361] (-786.887) * (-785.635) [-788.246] (-789.079) (-787.312) -- 0:00:37
      417500 -- (-790.906) (-786.537) (-787.867) [-785.726] * (-785.638) (-787.287) [-791.678] (-787.421) -- 0:00:37
      418000 -- (-790.813) (-786.353) [-786.419] (-785.249) * (-786.655) [-786.489] (-789.176) (-789.632) -- 0:00:37
      418500 -- (-785.964) (-787.129) (-789.245) [-787.445] * (-785.853) [-786.357] (-787.451) (-787.289) -- 0:00:37
      419000 -- (-788.643) [-785.985] (-789.532) (-786.509) * (-786.654) [-785.339] (-787.150) (-788.534) -- 0:00:37
      419500 -- (-786.762) (-787.835) [-787.162] (-789.538) * (-787.547) (-787.599) [-786.933] (-789.693) -- 0:00:37
      420000 -- (-787.351) [-791.022] (-788.222) (-789.183) * (-788.156) (-787.755) [-785.413] (-786.649) -- 0:00:37

      Average standard deviation of split frequencies: 0.012327

      420500 -- (-787.991) (-785.971) (-788.326) [-787.891] * [-789.048] (-786.353) (-786.019) (-788.374) -- 0:00:37
      421000 -- [-788.053] (-790.220) (-788.321) (-792.529) * (-786.473) (-792.276) (-788.202) [-787.113] -- 0:00:37
      421500 -- (-786.999) [-786.118] (-789.720) (-788.220) * [-787.627] (-790.298) (-788.158) (-786.193) -- 0:00:37
      422000 -- (-785.716) (-787.654) [-791.921] (-789.594) * (-786.218) (-788.139) (-786.426) [-786.198] -- 0:00:36
      422500 -- [-787.992] (-787.613) (-787.110) (-788.344) * (-788.080) (-790.072) (-789.334) [-785.746] -- 0:00:36
      423000 -- (-791.301) (-787.359) [-788.145] (-791.438) * (-790.930) (-788.565) [-787.925] (-791.937) -- 0:00:36
      423500 -- [-788.456] (-792.682) (-791.349) (-789.040) * (-787.088) [-788.009] (-787.358) (-785.948) -- 0:00:36
      424000 -- [-788.813] (-792.158) (-789.041) (-789.839) * [-787.875] (-786.521) (-790.031) (-785.948) -- 0:00:36
      424500 -- (-788.464) [-787.983] (-786.216) (-786.246) * [-786.258] (-787.458) (-789.136) (-785.846) -- 0:00:36
      425000 -- (-786.146) (-788.126) [-787.069] (-786.535) * (-787.287) (-786.354) [-790.258] (-787.590) -- 0:00:36

      Average standard deviation of split frequencies: 0.012697

      425500 -- [-785.318] (-790.199) (-785.584) (-786.326) * [-787.956] (-785.803) (-788.267) (-786.908) -- 0:00:36
      426000 -- [-787.535] (-786.941) (-786.605) (-785.990) * (-786.705) (-787.515) (-788.998) [-787.057] -- 0:00:36
      426500 -- (-790.464) (-787.424) [-787.281] (-787.015) * (-787.474) (-791.229) (-788.310) [-787.047] -- 0:00:36
      427000 -- (-788.994) (-786.386) (-789.330) [-788.856] * [-786.618] (-789.278) (-787.827) (-787.917) -- 0:00:37
      427500 -- (-789.356) [-787.017] (-790.849) (-789.132) * [-789.704] (-787.075) (-785.713) (-786.375) -- 0:00:37
      428000 -- (-786.059) (-789.328) (-791.032) [-787.984] * (-787.268) [-787.154] (-791.133) (-785.504) -- 0:00:37
      428500 -- (-785.886) [-789.334] (-786.923) (-788.237) * (-786.371) (-787.535) [-791.618] (-786.491) -- 0:00:37
      429000 -- [-787.221] (-786.916) (-785.403) (-787.630) * (-789.642) (-786.752) (-786.586) [-792.009] -- 0:00:37
      429500 -- (-789.415) (-786.195) [-785.905] (-787.263) * (-785.453) (-786.179) (-789.493) [-788.696] -- 0:00:37
      430000 -- (-791.524) [-790.328] (-788.612) (-788.051) * (-786.299) (-785.625) [-787.578] (-790.256) -- 0:00:37

      Average standard deviation of split frequencies: 0.012098

      430500 -- (-789.739) (-789.353) (-786.018) [-787.708] * (-788.531) [-785.752] (-790.766) (-788.468) -- 0:00:37
      431000 -- (-789.237) [-787.812] (-785.798) (-786.867) * [-787.427] (-785.715) (-789.233) (-790.923) -- 0:00:36
      431500 -- (-788.134) [-786.815] (-788.556) (-785.942) * [-787.716] (-786.737) (-790.061) (-786.964) -- 0:00:36
      432000 -- (-788.768) [-788.193] (-786.030) (-789.083) * (-789.125) (-786.142) [-789.373] (-786.667) -- 0:00:36
      432500 -- (-786.700) (-788.569) (-785.911) [-791.109] * [-785.834] (-786.329) (-787.770) (-786.901) -- 0:00:36
      433000 -- [-786.238] (-791.160) (-787.091) (-786.784) * (-787.968) (-789.146) (-786.443) [-789.795] -- 0:00:36
      433500 -- (-785.645) (-789.571) [-787.623] (-785.803) * [-786.745] (-791.031) (-785.936) (-790.761) -- 0:00:36
      434000 -- (-787.096) [-786.350] (-788.568) (-790.504) * (-787.116) [-786.424] (-786.636) (-786.726) -- 0:00:36
      434500 -- (-787.750) [-787.780] (-789.369) (-789.512) * (-786.543) [-786.631] (-787.496) (-788.288) -- 0:00:36
      435000 -- (-786.570) (-787.710) [-788.571] (-788.576) * [-785.952] (-786.384) (-791.955) (-785.750) -- 0:00:36

      Average standard deviation of split frequencies: 0.011953

      435500 -- (-786.101) (-789.743) (-788.838) [-790.376] * (-786.673) (-786.783) [-787.405] (-785.297) -- 0:00:36
      436000 -- (-786.140) (-788.185) (-785.358) [-787.554] * (-786.075) (-786.147) [-790.680] (-790.151) -- 0:00:36
      436500 -- (-788.782) [-785.049] (-785.955) (-787.685) * (-787.423) (-787.173) (-787.070) [-786.533] -- 0:00:36
      437000 -- (-785.717) (-789.065) [-785.524] (-789.593) * [-790.142] (-786.875) (-787.522) (-786.431) -- 0:00:36
      437500 -- [-787.530] (-787.592) (-788.102) (-788.354) * (-789.537) [-786.844] (-789.428) (-788.758) -- 0:00:36
      438000 -- (-786.769) (-789.582) (-786.839) [-787.852] * (-787.040) (-785.497) [-787.748] (-788.995) -- 0:00:35
      438500 -- (-786.371) (-788.576) [-786.109] (-789.033) * (-786.033) (-786.816) (-793.597) [-787.560] -- 0:00:35
      439000 -- [-786.382] (-788.970) (-786.911) (-787.138) * (-788.363) (-785.501) (-790.461) [-787.007] -- 0:00:35
      439500 -- (-786.958) [-790.094] (-789.868) (-789.548) * (-786.916) (-786.399) (-792.106) [-787.215] -- 0:00:35
      440000 -- (-786.750) (-788.731) (-786.246) [-787.700] * (-787.002) (-789.490) (-787.976) [-786.509] -- 0:00:35

      Average standard deviation of split frequencies: 0.012540

      440500 -- (-789.811) (-785.742) (-785.958) [-785.906] * [-785.869] (-790.115) (-788.964) (-789.935) -- 0:00:35
      441000 -- (-790.563) [-785.878] (-793.502) (-788.881) * (-785.897) [-788.913] (-788.152) (-788.845) -- 0:00:35
      441500 -- (-788.032) [-785.897] (-786.355) (-787.688) * (-786.040) (-787.152) [-788.072] (-787.378) -- 0:00:35
      442000 -- (-786.835) [-791.471] (-787.236) (-788.175) * (-786.689) [-787.223] (-786.349) (-786.792) -- 0:00:35
      442500 -- [-787.163] (-787.344) (-785.508) (-786.638) * (-787.687) (-788.026) [-788.096] (-786.552) -- 0:00:35
      443000 -- (-786.093) (-787.354) [-786.020] (-788.662) * (-786.280) [-789.691] (-792.088) (-787.572) -- 0:00:35
      443500 -- [-785.900] (-785.463) (-786.085) (-790.292) * [-788.220] (-787.421) (-791.687) (-788.272) -- 0:00:36
      444000 -- (-785.425) (-788.351) [-786.472] (-787.150) * [-786.563] (-786.143) (-793.316) (-788.899) -- 0:00:36
      444500 -- (-785.859) [-787.399] (-789.099) (-788.044) * (-788.124) (-786.772) [-785.636] (-792.362) -- 0:00:36
      445000 -- (-785.718) [-786.208] (-789.507) (-785.489) * (-788.559) (-790.345) [-785.793] (-787.099) -- 0:00:36

      Average standard deviation of split frequencies: 0.012373

      445500 -- [-786.045] (-785.670) (-788.826) (-790.121) * (-786.445) [-787.443] (-787.772) (-790.150) -- 0:00:36
      446000 -- (-786.033) (-786.801) (-786.309) [-787.379] * (-788.570) (-787.719) [-786.586] (-786.143) -- 0:00:36
      446500 -- [-786.218] (-786.359) (-786.496) (-790.678) * (-792.362) [-788.373] (-790.900) (-787.563) -- 0:00:35
      447000 -- (-786.088) [-785.964] (-789.827) (-790.110) * (-789.770) (-787.789) [-786.047] (-785.900) -- 0:00:35
      447500 -- [-785.579] (-786.436) (-789.306) (-789.833) * (-789.654) [-786.956] (-786.427) (-788.061) -- 0:00:35
      448000 -- [-788.130] (-790.826) (-786.398) (-786.336) * (-785.359) (-788.407) [-792.324] (-787.548) -- 0:00:35
      448500 -- (-787.274) (-788.983) [-785.755] (-790.609) * (-787.097) (-790.023) (-789.016) [-787.336] -- 0:00:35
      449000 -- [-786.417] (-785.910) (-785.954) (-787.353) * (-788.959) [-786.637] (-787.357) (-787.955) -- 0:00:35
      449500 -- [-787.006] (-786.059) (-787.461) (-786.063) * (-788.929) [-789.045] (-786.134) (-785.730) -- 0:00:35
      450000 -- (-785.813) [-787.942] (-787.039) (-787.557) * (-787.690) (-792.454) [-786.554] (-788.573) -- 0:00:35

      Average standard deviation of split frequencies: 0.012675

      450500 -- [-786.563] (-785.787) (-787.867) (-787.404) * (-785.718) (-789.842) (-785.562) [-787.531] -- 0:00:35
      451000 -- (-787.643) (-788.869) (-790.448) [-787.350] * (-790.131) (-786.403) (-792.617) [-788.453] -- 0:00:35
      451500 -- (-787.802) (-788.893) (-787.643) [-786.929] * [-787.570] (-786.979) (-787.537) (-788.999) -- 0:00:35
      452000 -- [-785.727] (-791.896) (-786.354) (-790.528) * (-787.779) [-788.867] (-787.175) (-786.306) -- 0:00:35
      452500 -- (-787.841) [-790.402] (-787.187) (-792.314) * (-788.693) (-787.311) [-786.312] (-787.459) -- 0:00:35
      453000 -- [-792.223] (-787.133) (-788.663) (-789.668) * (-789.215) (-786.880) (-789.552) [-788.218] -- 0:00:35
      453500 -- (-788.215) (-786.480) [-786.931] (-788.942) * [-787.256] (-787.858) (-788.391) (-786.139) -- 0:00:34
      454000 -- [-787.084] (-787.618) (-786.951) (-790.983) * (-787.001) [-787.651] (-789.038) (-791.889) -- 0:00:34
      454500 -- (-787.735) (-787.040) [-787.600] (-790.973) * (-789.453) (-788.421) [-786.727] (-786.975) -- 0:00:34
      455000 -- (-786.050) (-787.926) (-794.053) [-786.383] * [-786.154] (-787.291) (-788.132) (-786.892) -- 0:00:34

      Average standard deviation of split frequencies: 0.013318

      455500 -- [-786.007] (-786.111) (-786.208) (-786.703) * (-790.271) (-790.404) [-786.589] (-786.412) -- 0:00:34
      456000 -- (-786.692) (-787.102) (-787.791) [-789.711] * (-788.446) (-786.183) [-786.407] (-786.235) -- 0:00:34
      456500 -- (-787.489) [-791.144] (-788.191) (-794.408) * (-791.880) [-786.891] (-786.642) (-788.368) -- 0:00:34
      457000 -- [-785.657] (-786.601) (-787.130) (-787.587) * (-789.832) [-787.635] (-787.104) (-788.796) -- 0:00:34
      457500 -- (-789.711) (-785.667) [-791.418] (-786.575) * (-786.884) (-789.766) [-786.372] (-789.477) -- 0:00:34
      458000 -- (-789.395) (-786.162) (-789.515) [-786.233] * (-785.937) (-788.547) [-789.275] (-787.083) -- 0:00:34
      458500 -- (-788.544) (-785.462) (-785.350) [-785.446] * [-787.498] (-788.344) (-787.375) (-787.952) -- 0:00:34
      459000 -- (-786.159) (-788.390) (-791.238) [-786.663] * [-791.573] (-786.566) (-789.673) (-787.825) -- 0:00:34
      459500 -- (-786.881) (-786.275) (-787.178) [-787.291] * (-790.428) (-787.341) [-790.794] (-787.683) -- 0:00:34
      460000 -- [-787.966] (-787.687) (-785.760) (-787.847) * (-787.328) [-791.061] (-789.455) (-785.949) -- 0:00:35

      Average standard deviation of split frequencies: 0.013062

      460500 -- [-791.741] (-795.921) (-786.071) (-787.846) * (-787.511) [-787.054] (-788.824) (-789.380) -- 0:00:35
      461000 -- (-789.018) (-791.941) (-786.071) [-789.713] * (-788.860) (-786.696) [-789.683] (-787.040) -- 0:00:35
      461500 -- (-790.162) [-786.390] (-788.006) (-788.790) * [-786.272] (-788.907) (-789.399) (-785.710) -- 0:00:35
      462000 -- (-793.102) [-787.626] (-789.217) (-788.281) * (-785.832) (-790.644) [-786.296] (-787.063) -- 0:00:34
      462500 -- (-787.956) [-785.912] (-788.888) (-786.200) * (-786.778) (-786.249) [-786.958] (-788.913) -- 0:00:34
      463000 -- (-786.333) (-787.670) [-786.735] (-786.272) * (-786.054) [-788.938] (-787.469) (-789.111) -- 0:00:34
      463500 -- (-787.514) [-787.264] (-786.598) (-786.668) * (-786.984) (-789.029) [-786.675] (-788.502) -- 0:00:34
      464000 -- [-787.560] (-788.198) (-787.375) (-790.765) * [-787.671] (-788.336) (-787.047) (-787.354) -- 0:00:34
      464500 -- [-787.853] (-785.778) (-788.103) (-787.142) * (-786.453) [-787.169] (-787.619) (-786.115) -- 0:00:34
      465000 -- (-785.674) (-786.926) [-787.319] (-786.857) * (-788.380) (-787.708) [-786.297] (-787.656) -- 0:00:34

      Average standard deviation of split frequencies: 0.013329

      465500 -- (-789.189) (-786.140) (-787.925) [-786.464] * [-787.477] (-790.725) (-787.715) (-786.746) -- 0:00:34
      466000 -- (-787.321) [-785.858] (-787.922) (-786.366) * (-792.756) (-789.697) (-786.240) [-789.059] -- 0:00:34
      466500 -- [-787.980] (-785.780) (-786.553) (-787.708) * (-787.117) (-791.092) [-786.292] (-787.776) -- 0:00:34
      467000 -- (-787.400) [-787.184] (-790.018) (-787.944) * [-787.231] (-794.041) (-786.596) (-787.694) -- 0:00:34
      467500 -- (-787.392) (-787.027) [-788.878] (-787.508) * (-791.525) [-790.595] (-786.319) (-788.157) -- 0:00:34
      468000 -- [-785.661] (-786.414) (-787.802) (-787.202) * (-789.948) [-785.979] (-789.135) (-788.805) -- 0:00:34
      468500 -- (-785.400) (-786.703) [-788.045] (-788.116) * [-790.164] (-788.893) (-787.600) (-793.877) -- 0:00:34
      469000 -- (-785.651) [-786.896] (-790.452) (-786.989) * [-787.430] (-788.865) (-786.134) (-791.096) -- 0:00:33
      469500 -- (-787.336) (-786.690) (-786.660) [-786.136] * [-788.208] (-788.726) (-794.070) (-788.294) -- 0:00:33
      470000 -- (-785.942) (-789.079) (-788.984) [-785.889] * [-786.691] (-789.855) (-788.053) (-787.025) -- 0:00:33

      Average standard deviation of split frequencies: 0.013551

      470500 -- (-790.381) (-786.051) (-788.350) [-789.116] * (-786.205) (-786.723) [-788.996] (-786.838) -- 0:00:33
      471000 -- (-786.818) (-786.373) [-789.368] (-788.800) * (-786.696) (-787.588) (-788.816) [-786.193] -- 0:00:33
      471500 -- [-788.202] (-786.771) (-789.169) (-787.709) * (-787.521) (-788.427) [-787.504] (-786.949) -- 0:00:33
      472000 -- (-788.223) (-785.631) [-789.733] (-787.355) * [-787.263] (-788.385) (-787.247) (-786.953) -- 0:00:33
      472500 -- (-789.062) (-785.559) [-788.540] (-787.826) * (-786.380) [-786.930] (-790.423) (-786.510) -- 0:00:33
      473000 -- (-786.602) [-790.455] (-789.208) (-788.488) * (-786.470) (-785.856) (-786.329) [-788.736] -- 0:00:33
      473500 -- [-789.004] (-787.165) (-792.808) (-788.978) * (-786.478) (-786.227) (-791.646) [-789.746] -- 0:00:33
      474000 -- [-791.282] (-785.990) (-789.506) (-786.748) * [-786.317] (-795.666) (-789.504) (-793.322) -- 0:00:33
      474500 -- (-792.071) [-788.474] (-786.415) (-787.733) * [-787.107] (-786.324) (-787.746) (-790.792) -- 0:00:33
      475000 -- (-787.148) (-787.908) (-786.162) [-786.373] * (-787.574) (-786.819) (-786.962) [-786.519] -- 0:00:33

      Average standard deviation of split frequencies: 0.012998

      475500 -- (-789.114) (-785.601) [-787.810] (-787.822) * (-788.974) [-786.280] (-790.320) (-790.601) -- 0:00:33
      476000 -- (-789.659) (-786.024) [-787.700] (-787.389) * [-790.295] (-786.878) (-789.297) (-788.801) -- 0:00:33
      476500 -- (-788.894) [-786.549] (-786.864) (-787.306) * (-787.744) (-788.316) (-789.377) [-787.409] -- 0:00:32
      477000 -- (-787.271) [-787.156] (-787.235) (-787.145) * (-785.482) (-792.400) [-786.639] (-787.081) -- 0:00:33
      477500 -- (-786.255) [-788.764] (-785.258) (-786.128) * (-785.584) [-787.701] (-787.153) (-787.297) -- 0:00:33
      478000 -- (-787.170) (-785.465) [-785.258] (-787.624) * (-787.695) (-788.775) (-788.260) [-788.143] -- 0:00:33
      478500 -- (-786.479) (-787.494) [-787.514] (-785.622) * (-790.084) [-790.036] (-787.496) (-786.233) -- 0:00:33
      479000 -- (-787.403) (-786.201) [-789.181] (-786.738) * (-789.679) (-791.068) [-786.077] (-786.945) -- 0:00:33
      479500 -- (-789.131) (-785.614) (-787.806) [-786.795] * (-787.011) (-790.514) [-787.667] (-785.318) -- 0:00:33
      480000 -- [-786.510] (-787.582) (-787.301) (-788.486) * [-789.878] (-789.748) (-790.960) (-786.480) -- 0:00:33

      Average standard deviation of split frequencies: 0.013788

      480500 -- (-787.549) (-787.483) (-786.952) [-789.682] * (-788.688) (-787.881) [-789.182] (-786.046) -- 0:00:33
      481000 -- [-788.961] (-785.555) (-788.985) (-792.466) * (-786.693) [-790.990] (-787.244) (-788.514) -- 0:00:33
      481500 -- (-787.569) (-786.885) (-790.704) [-787.515] * (-787.250) [-788.848] (-787.308) (-788.468) -- 0:00:33
      482000 -- (-791.780) (-789.972) (-787.568) [-787.947] * [-786.431] (-790.669) (-786.625) (-787.343) -- 0:00:33
      482500 -- (-788.802) (-785.926) (-786.284) [-785.780] * (-790.267) (-786.362) [-786.035] (-786.035) -- 0:00:33
      483000 -- (-791.205) (-787.451) (-786.636) [-786.588] * (-787.371) (-785.836) (-786.758) [-789.051] -- 0:00:33
      483500 -- [-787.840] (-787.070) (-788.013) (-792.651) * (-787.282) [-790.161] (-787.616) (-785.718) -- 0:00:33
      484000 -- (-789.380) (-786.268) [-786.514] (-787.704) * (-785.507) (-789.576) [-786.773] (-787.315) -- 0:00:33
      484500 -- (-786.245) (-786.256) [-792.376] (-787.969) * [-787.478] (-788.283) (-787.357) (-785.513) -- 0:00:32
      485000 -- (-787.778) (-786.960) (-786.583) [-787.984] * [-786.833] (-787.202) (-790.176) (-789.386) -- 0:00:32

      Average standard deviation of split frequencies: 0.014264

      485500 -- (-787.871) [-786.960] (-786.961) (-786.536) * (-788.022) (-786.584) (-787.106) [-787.064] -- 0:00:32
      486000 -- (-792.217) (-787.221) (-787.687) [-786.431] * [-787.326] (-790.174) (-787.649) (-789.042) -- 0:00:32
      486500 -- (-786.248) (-792.883) [-786.172] (-788.555) * (-786.711) (-788.728) (-786.166) [-787.403] -- 0:00:32
      487000 -- (-792.744) (-786.831) [-787.947] (-786.131) * [-790.561] (-791.187) (-786.264) (-786.619) -- 0:00:32
      487500 -- (-788.171) (-787.020) [-788.231] (-787.757) * [-787.225] (-788.667) (-788.725) (-786.461) -- 0:00:32
      488000 -- (-792.953) (-786.761) (-786.384) [-788.153] * (-788.422) [-789.194] (-791.563) (-787.271) -- 0:00:32
      488500 -- (-789.696) (-786.329) (-793.950) [-787.887] * [-785.788] (-787.609) (-787.556) (-789.999) -- 0:00:32
      489000 -- (-790.163) (-788.777) (-790.211) [-785.908] * (-788.868) (-788.967) [-786.650] (-790.474) -- 0:00:32
      489500 -- (-788.700) (-789.288) (-787.959) [-787.141] * (-787.046) (-794.695) [-788.066] (-795.377) -- 0:00:32
      490000 -- [-793.519] (-786.621) (-786.469) (-786.900) * (-787.217) (-788.493) [-786.802] (-792.590) -- 0:00:32

      Average standard deviation of split frequencies: 0.014471

      490500 -- (-793.475) (-786.306) (-785.787) [-786.467] * (-788.330) (-788.656) (-786.776) [-786.596] -- 0:00:32
      491000 -- (-792.701) (-786.039) [-785.646] (-788.776) * (-785.933) (-785.790) [-786.241] (-787.727) -- 0:00:32
      491500 -- [-789.382] (-786.512) (-787.636) (-789.330) * (-788.177) [-786.581] (-787.169) (-792.174) -- 0:00:32
      492000 -- (-787.883) (-790.372) [-788.652] (-787.523) * (-789.363) (-790.676) [-787.989] (-791.824) -- 0:00:33
      492500 -- (-789.882) (-787.064) [-785.147] (-786.453) * [-785.637] (-787.398) (-787.377) (-786.747) -- 0:00:32
      493000 -- [-787.287] (-788.467) (-786.543) (-786.336) * [-785.706] (-786.831) (-786.734) (-786.982) -- 0:00:32
      493500 -- (-786.692) (-787.071) (-790.287) [-786.168] * (-787.798) (-785.161) (-793.400) [-786.818] -- 0:00:32
      494000 -- (-791.654) (-785.752) [-787.360] (-785.710) * (-785.815) (-787.071) [-790.444] (-786.576) -- 0:00:32
      494500 -- (-786.455) [-785.624] (-786.654) (-786.464) * (-787.580) (-788.061) (-785.037) [-787.491] -- 0:00:32
      495000 -- (-786.309) (-786.544) (-788.947) [-788.042] * [-786.073] (-786.784) (-786.910) (-787.557) -- 0:00:32

      Average standard deviation of split frequencies: 0.014137

      495500 -- (-786.909) (-789.318) (-790.300) [-791.976] * (-785.954) (-786.235) (-786.161) [-788.537] -- 0:00:32
      496000 -- (-788.522) (-787.819) (-786.728) [-787.851] * (-787.569) (-786.905) (-790.233) [-789.319] -- 0:00:32
      496500 -- (-789.235) (-788.169) [-787.430] (-788.479) * [-788.699] (-787.459) (-788.413) (-789.051) -- 0:00:32
      497000 -- (-787.560) [-791.307] (-788.626) (-788.153) * (-786.133) (-785.753) (-790.960) [-785.270] -- 0:00:32
      497500 -- (-789.273) (-788.067) (-790.406) [-788.227] * [-785.449] (-788.161) (-793.767) (-786.110) -- 0:00:32
      498000 -- (-791.758) (-789.565) [-788.020] (-786.689) * [-786.863] (-786.382) (-788.652) (-788.999) -- 0:00:32
      498500 -- [-793.585] (-789.161) (-787.109) (-787.584) * (-785.709) (-787.378) (-789.852) [-789.015] -- 0:00:32
      499000 -- (-788.546) (-787.342) [-791.140] (-793.547) * [-789.094] (-791.841) (-788.350) (-787.964) -- 0:00:32
      499500 -- (-787.329) [-785.744] (-791.024) (-785.817) * (-786.809) (-791.538) [-791.778] (-786.414) -- 0:00:32
      500000 -- (-788.324) [-790.252] (-786.270) (-787.940) * (-790.046) [-785.822] (-786.950) (-789.572) -- 0:00:32

      Average standard deviation of split frequencies: 0.014182

      500500 -- (-785.783) (-787.338) [-787.179] (-788.648) * (-785.611) (-789.546) (-786.994) [-787.741] -- 0:00:31
      501000 -- (-787.147) (-786.766) [-786.172] (-789.853) * (-787.787) (-790.332) (-788.061) [-787.022] -- 0:00:31
      501500 -- (-786.229) [-787.857] (-787.597) (-787.927) * (-788.303) (-789.406) (-788.822) [-785.919] -- 0:00:31
      502000 -- (-786.598) [-788.206] (-788.004) (-788.258) * (-785.751) [-787.259] (-788.919) (-786.409) -- 0:00:31
      502500 -- (-785.927) (-786.453) (-789.367) [-787.128] * (-787.810) [-787.593] (-786.147) (-786.104) -- 0:00:31
      503000 -- (-785.974) [-789.190] (-789.670) (-789.055) * (-788.071) [-786.548] (-787.016) (-787.186) -- 0:00:31
      503500 -- [-786.840] (-788.930) (-791.132) (-791.783) * [-789.922] (-786.419) (-786.613) (-792.264) -- 0:00:31
      504000 -- (-787.188) [-788.569] (-790.781) (-796.678) * [-789.009] (-786.710) (-788.368) (-786.712) -- 0:00:31
      504500 -- (-790.527) (-787.006) [-785.831] (-787.331) * (-790.819) [-789.617] (-789.253) (-786.642) -- 0:00:31
      505000 -- (-787.992) (-787.810) [-786.591] (-789.017) * [-788.608] (-789.555) (-789.268) (-786.405) -- 0:00:31

      Average standard deviation of split frequencies: 0.013567

      505500 -- (-790.449) [-790.625] (-785.773) (-785.573) * (-788.519) (-790.028) (-790.673) [-786.468] -- 0:00:31
      506000 -- (-792.512) [-787.050] (-785.419) (-785.534) * (-789.025) (-786.896) (-786.601) [-791.577] -- 0:00:31
      506500 -- [-787.129] (-789.348) (-785.542) (-785.856) * (-788.523) [-789.207] (-785.656) (-787.513) -- 0:00:31
      507000 -- (-789.174) (-786.410) [-787.261] (-787.949) * (-785.611) [-785.506] (-790.172) (-786.152) -- 0:00:31
      507500 -- (-788.192) (-786.691) (-786.334) [-786.501] * [-789.290] (-788.932) (-786.804) (-793.617) -- 0:00:31
      508000 -- (-786.772) (-786.603) [-786.720] (-787.169) * [-787.836] (-789.066) (-785.457) (-789.547) -- 0:00:30
      508500 -- (-786.693) [-787.150] (-789.821) (-787.703) * (-788.283) (-790.601) [-785.732] (-787.896) -- 0:00:31
      509000 -- (-789.210) (-787.613) [-786.645] (-787.626) * (-786.202) (-788.020) (-791.539) [-786.505] -- 0:00:31
      509500 -- (-788.247) [-788.276] (-789.162) (-786.166) * (-788.472) (-787.417) (-793.159) [-786.196] -- 0:00:31
      510000 -- [-792.116] (-788.511) (-789.022) (-787.535) * (-787.083) (-786.835) [-789.344] (-786.711) -- 0:00:31

      Average standard deviation of split frequencies: 0.014251

      510500 -- (-790.046) (-785.817) (-788.737) [-787.087] * (-789.340) (-786.566) (-786.516) [-786.293] -- 0:00:31
      511000 -- [-788.621] (-785.834) (-786.126) (-786.481) * (-787.387) [-786.827] (-785.884) (-785.957) -- 0:00:31
      511500 -- [-790.964] (-787.795) (-790.061) (-790.373) * [-788.975] (-790.576) (-790.384) (-787.808) -- 0:00:31
      512000 -- [-786.778] (-788.781) (-790.302) (-788.562) * (-788.789) [-789.057] (-793.076) (-788.635) -- 0:00:31
      512500 -- [-786.011] (-786.693) (-787.425) (-787.473) * (-790.065) [-786.320] (-787.538) (-785.854) -- 0:00:31
      513000 -- (-787.665) [-786.161] (-786.894) (-785.666) * (-789.927) [-786.579] (-790.837) (-787.217) -- 0:00:31
      513500 -- (-789.459) [-788.095] (-787.493) (-788.158) * [-790.588] (-785.665) (-787.249) (-787.459) -- 0:00:31
      514000 -- [-786.767] (-789.042) (-788.589) (-786.754) * (-791.366) (-786.798) (-786.074) [-787.429] -- 0:00:31
      514500 -- (-792.073) (-787.825) [-787.112] (-786.050) * (-786.277) [-790.211] (-787.209) (-787.646) -- 0:00:31
      515000 -- (-793.197) (-787.161) (-787.307) [-786.812] * (-787.957) (-786.286) [-785.199] (-788.837) -- 0:00:31

      Average standard deviation of split frequencies: 0.014218

      515500 -- (-787.024) (-789.439) [-787.386] (-787.243) * (-787.023) (-787.350) [-786.184] (-790.242) -- 0:00:31
      516000 -- (-788.004) (-790.972) (-785.801) [-786.362] * (-789.407) (-787.905) (-787.194) [-788.964] -- 0:00:30
      516500 -- [-787.913] (-789.301) (-786.375) (-786.283) * [-787.252] (-788.884) (-789.827) (-788.737) -- 0:00:30
      517000 -- (-788.698) (-786.893) [-785.847] (-786.028) * (-786.732) (-786.467) [-786.916] (-785.675) -- 0:00:30
      517500 -- [-790.330] (-787.389) (-785.922) (-786.055) * (-789.122) (-790.509) [-785.808] (-786.048) -- 0:00:30
      518000 -- [-789.246] (-788.298) (-785.833) (-788.893) * [-788.624] (-789.966) (-788.484) (-790.789) -- 0:00:30
      518500 -- [-789.735] (-787.700) (-786.628) (-790.955) * (-788.620) (-786.331) (-786.585) [-789.801] -- 0:00:30
      519000 -- (-788.817) (-785.907) (-787.721) [-786.181] * (-788.333) [-785.862] (-787.734) (-788.045) -- 0:00:30
      519500 -- (-788.243) (-786.357) [-787.953] (-787.161) * (-787.137) (-789.136) [-787.842] (-792.845) -- 0:00:30
      520000 -- (-789.857) (-785.996) [-790.053] (-790.587) * (-788.971) (-790.199) [-785.985] (-788.435) -- 0:00:30

      Average standard deviation of split frequencies: 0.014316

      520500 -- [-787.376] (-787.395) (-786.402) (-788.812) * (-788.046) [-787.131] (-786.186) (-793.362) -- 0:00:30
      521000 -- (-786.761) [-785.467] (-793.049) (-787.018) * (-790.527) (-787.760) (-785.307) [-789.209] -- 0:00:30
      521500 -- (-787.106) (-787.268) (-791.696) [-790.746] * [-788.291] (-788.096) (-786.020) (-787.012) -- 0:00:30
      522000 -- (-788.521) (-786.494) [-787.461] (-792.236) * [-785.629] (-786.949) (-787.834) (-788.823) -- 0:00:30
      522500 -- (-790.357) (-787.386) (-787.400) [-787.121] * [-788.603] (-786.034) (-788.462) (-788.495) -- 0:00:30
      523000 -- (-789.566) (-788.064) [-785.712] (-792.323) * (-787.845) (-788.587) (-787.245) [-788.568] -- 0:00:30
      523500 -- (-788.755) (-790.138) [-786.724] (-785.908) * (-787.850) [-788.987] (-786.264) (-791.097) -- 0:00:30
      524000 -- [-788.292] (-789.865) (-789.404) (-791.822) * (-787.210) (-787.240) (-787.248) [-788.733] -- 0:00:30
      524500 -- [-791.136] (-789.425) (-787.861) (-787.266) * (-786.159) (-787.177) [-789.914] (-788.335) -- 0:00:30
      525000 -- (-791.031) (-787.775) [-788.619] (-786.032) * [-791.804] (-787.158) (-786.384) (-787.140) -- 0:00:30

      Average standard deviation of split frequencies: 0.014451

      525500 -- (-787.283) [-788.389] (-788.737) (-791.087) * (-787.052) (-787.983) (-787.877) [-789.640] -- 0:00:30
      526000 -- [-787.584] (-789.299) (-785.849) (-787.079) * (-787.214) (-788.608) (-789.275) [-789.119] -- 0:00:30
      526500 -- (-786.094) (-788.815) (-791.461) [-786.311] * (-790.030) (-788.095) (-789.796) [-787.277] -- 0:00:30
      527000 -- (-788.236) (-796.350) [-790.155] (-787.121) * (-785.533) [-786.992] (-787.026) (-786.837) -- 0:00:30
      527500 -- (-789.460) (-790.514) (-789.445) [-786.669] * [-787.169] (-797.360) (-786.395) (-787.291) -- 0:00:30
      528000 -- (-790.561) [-791.579] (-791.435) (-787.589) * (-791.680) (-790.692) [-786.441] (-786.660) -- 0:00:30
      528500 -- (-787.573) (-786.469) [-790.772] (-786.328) * (-790.715) [-787.099] (-788.485) (-788.739) -- 0:00:30
      529000 -- (-785.959) [-786.707] (-789.963) (-788.216) * (-788.464) [-786.692] (-789.541) (-788.807) -- 0:00:30
      529500 -- (-789.293) [-786.430] (-791.708) (-787.176) * (-788.970) (-789.234) [-787.915] (-795.580) -- 0:00:30
      530000 -- (-787.459) (-788.171) [-789.276] (-787.833) * (-792.834) (-789.025) [-786.563] (-785.882) -- 0:00:30

      Average standard deviation of split frequencies: 0.014380

      530500 -- (-788.397) (-787.285) (-787.617) [-786.613] * (-786.951) (-789.902) (-786.594) [-787.150] -- 0:00:30
      531000 -- (-787.706) (-791.221) [-787.022] (-787.720) * (-788.644) (-789.125) (-785.770) [-786.355] -- 0:00:30
      531500 -- (-790.557) (-789.175) (-788.482) [-786.373] * (-790.312) [-790.356] (-787.291) (-786.340) -- 0:00:29
      532000 -- (-786.531) (-790.570) (-788.290) [-786.514] * (-787.042) (-791.932) [-787.501] (-787.566) -- 0:00:29
      532500 -- (-787.467) (-789.744) (-790.914) [-789.905] * (-788.980) (-790.129) [-787.021] (-787.987) -- 0:00:29
      533000 -- (-787.415) (-790.476) (-789.296) [-786.759] * (-787.555) (-788.333) [-787.271] (-788.767) -- 0:00:29
      533500 -- [-786.488] (-785.629) (-786.060) (-787.046) * (-787.232) (-789.160) (-785.669) [-790.169] -- 0:00:29
      534000 -- [-787.911] (-789.079) (-787.182) (-790.102) * [-787.440] (-787.288) (-786.515) (-792.493) -- 0:00:29
      534500 -- [-788.965] (-786.504) (-787.321) (-786.272) * (-788.414) (-801.186) (-788.042) [-788.137] -- 0:00:29
      535000 -- (-786.078) (-786.859) (-786.474) [-786.419] * (-787.697) (-792.261) [-787.944] (-785.854) -- 0:00:29

      Average standard deviation of split frequencies: 0.014347

      535500 -- (-787.463) [-786.957] (-790.225) (-786.001) * (-786.997) (-786.898) [-787.967] (-787.591) -- 0:00:29
      536000 -- (-788.456) (-788.562) [-786.264] (-787.005) * (-786.158) [-786.990] (-788.482) (-785.372) -- 0:00:29
      536500 -- [-785.995] (-789.924) (-791.329) (-786.006) * (-786.543) [-789.030] (-789.021) (-786.966) -- 0:00:29
      537000 -- (-786.514) (-789.152) [-788.449] (-785.840) * (-791.205) [-787.139] (-788.840) (-788.409) -- 0:00:29
      537500 -- (-787.561) (-789.092) [-787.471] (-786.551) * (-790.806) (-785.757) (-786.498) [-785.752] -- 0:00:29
      538000 -- [-789.043] (-785.970) (-791.548) (-786.953) * [-789.436] (-786.900) (-786.170) (-786.938) -- 0:00:29
      538500 -- (-788.480) (-785.848) (-788.524) [-786.682] * (-787.839) [-788.450] (-786.215) (-786.685) -- 0:00:29
      539000 -- (-788.921) (-791.429) [-786.070] (-788.821) * [-787.495] (-786.788) (-787.968) (-785.754) -- 0:00:29
      539500 -- (-789.480) (-788.370) (-786.485) [-787.507] * (-788.657) [-785.499] (-786.360) (-787.459) -- 0:00:29
      540000 -- (-787.649) (-790.721) (-785.382) [-788.424] * [-789.476] (-791.459) (-786.868) (-791.476) -- 0:00:29

      Average standard deviation of split frequencies: 0.015095

      540500 -- (-788.099) (-792.803) (-786.545) [-789.886] * (-787.419) [-788.712] (-789.901) (-787.054) -- 0:00:29
      541000 -- (-785.463) [-790.513] (-785.915) (-786.463) * (-789.040) (-788.836) (-788.900) [-786.114] -- 0:00:29
      541500 -- (-786.640) (-786.583) [-786.375] (-791.888) * (-790.928) [-788.598] (-786.368) (-786.300) -- 0:00:29
      542000 -- [-785.558] (-787.395) (-785.961) (-787.237) * (-786.956) [-785.632] (-788.693) (-787.844) -- 0:00:29
      542500 -- (-785.994) (-785.616) (-787.897) [-785.702] * (-786.846) (-786.693) [-786.995] (-786.482) -- 0:00:29
      543000 -- (-786.032) [-786.297] (-787.433) (-786.960) * (-788.028) (-788.396) (-788.605) [-790.768] -- 0:00:29
      543500 -- (-786.155) (-786.784) [-788.044] (-785.992) * (-789.639) [-791.496] (-788.237) (-791.649) -- 0:00:29
      544000 -- (-787.743) [-788.382] (-787.456) (-785.677) * [-788.326] (-788.372) (-787.669) (-786.032) -- 0:00:29
      544500 -- [-786.024] (-787.055) (-787.460) (-787.359) * (-786.425) (-787.821) (-786.665) [-786.968] -- 0:00:29
      545000 -- (-785.815) [-787.031] (-788.022) (-791.837) * [-788.803] (-786.807) (-787.745) (-788.003) -- 0:00:29

      Average standard deviation of split frequencies: 0.014300

      545500 -- [-786.595] (-792.498) (-786.784) (-785.958) * [-790.886] (-787.763) (-787.508) (-789.815) -- 0:00:29
      546000 -- (-786.683) (-786.677) [-786.728] (-787.688) * (-790.835) (-789.168) [-787.228] (-785.599) -- 0:00:29
      546500 -- (-786.146) [-788.010] (-790.572) (-789.960) * [-790.711] (-790.849) (-788.540) (-786.691) -- 0:00:29
      547000 -- (-787.142) [-785.163] (-789.426) (-787.475) * (-787.622) [-788.222] (-787.602) (-788.989) -- 0:00:28
      547500 -- (-786.304) (-786.832) (-787.435) [-787.132] * [-788.069] (-787.416) (-787.465) (-787.962) -- 0:00:28
      548000 -- (-789.294) (-788.106) (-786.588) [-787.535] * (-790.524) (-787.372) [-787.586] (-785.558) -- 0:00:28
      548500 -- (-787.853) (-787.079) [-785.902] (-789.348) * (-791.231) [-787.855] (-785.972) (-786.237) -- 0:00:28
      549000 -- (-786.874) (-787.054) (-786.345) [-787.486] * (-788.837) [-788.202] (-788.590) (-787.096) -- 0:00:28
      549500 -- (-789.751) [-788.930] (-793.109) (-787.727) * (-787.950) (-789.131) [-785.546] (-787.260) -- 0:00:28
      550000 -- [-787.181] (-789.293) (-787.700) (-787.901) * (-792.284) (-786.107) [-790.717] (-786.706) -- 0:00:28

      Average standard deviation of split frequencies: 0.014286

      550500 -- (-786.704) (-791.513) (-788.273) [-789.810] * (-791.670) [-786.091] (-786.553) (-790.636) -- 0:00:28
      551000 -- (-789.811) (-788.245) [-786.575] (-788.687) * (-787.505) (-791.067) [-787.443] (-787.527) -- 0:00:28
      551500 -- (-786.548) (-786.121) (-787.992) [-789.287] * (-787.935) (-788.360) (-787.310) [-786.604] -- 0:00:28
      552000 -- (-786.752) [-786.671] (-791.118) (-789.385) * (-789.819) (-785.554) [-786.017] (-788.368) -- 0:00:28
      552500 -- [-785.700] (-785.605) (-787.620) (-791.176) * (-790.598) (-789.149) (-786.304) [-786.945] -- 0:00:28
      553000 -- (-787.179) (-785.481) [-787.787] (-788.929) * [-790.293] (-787.946) (-788.050) (-786.987) -- 0:00:28
      553500 -- (-787.316) (-792.989) [-787.498] (-786.424) * (-788.034) (-786.119) (-786.823) [-788.126] -- 0:00:28
      554000 -- (-788.385) [-787.136] (-787.947) (-790.208) * (-789.687) (-787.018) (-786.157) [-785.860] -- 0:00:28
      554500 -- (-786.396) (-786.150) [-787.250] (-789.595) * (-786.223) (-786.221) [-786.369] (-787.364) -- 0:00:28
      555000 -- (-788.214) (-787.252) [-788.412] (-786.608) * [-786.305] (-788.975) (-787.094) (-785.637) -- 0:00:28

      Average standard deviation of split frequencies: 0.014307

      555500 -- [-787.433] (-786.636) (-787.240) (-786.797) * (-786.832) [-789.157] (-788.378) (-789.883) -- 0:00:28
      556000 -- [-787.595] (-786.781) (-786.652) (-789.584) * (-785.484) (-787.637) (-788.200) [-786.859] -- 0:00:28
      556500 -- (-788.317) (-788.247) [-785.951] (-787.797) * (-785.665) [-787.291] (-786.962) (-787.024) -- 0:00:28
      557000 -- [-787.276] (-791.259) (-785.705) (-786.488) * [-787.796] (-792.727) (-789.714) (-786.804) -- 0:00:28
      557500 -- [-786.717] (-785.992) (-786.403) (-788.063) * (-787.970) [-785.775] (-788.443) (-787.803) -- 0:00:28
      558000 -- (-788.412) (-787.208) (-790.282) [-788.501] * (-787.110) [-785.345] (-786.493) (-788.225) -- 0:00:28
      558500 -- (-788.056) (-787.784) [-786.603] (-789.828) * [-787.453] (-786.493) (-788.313) (-785.201) -- 0:00:28
      559000 -- (-792.755) (-789.290) [-787.709] (-787.645) * [-787.525] (-790.929) (-786.935) (-785.126) -- 0:00:28
      559500 -- (-792.499) (-787.671) (-786.243) [-786.769] * (-787.494) (-787.608) [-787.580] (-786.612) -- 0:00:28
      560000 -- (-793.122) [-786.739] (-789.359) (-787.144) * (-791.100) [-785.769] (-791.866) (-791.711) -- 0:00:28

      Average standard deviation of split frequencies: 0.013978

      560500 -- (-787.078) [-786.889] (-788.741) (-788.765) * (-792.024) [-785.444] (-790.423) (-792.120) -- 0:00:28
      561000 -- (-786.522) [-786.245] (-786.765) (-787.112) * (-790.480) [-786.128] (-788.642) (-789.711) -- 0:00:28
      561500 -- (-785.751) (-785.830) (-787.396) [-785.898] * (-786.585) [-787.173] (-786.203) (-787.123) -- 0:00:28
      562000 -- (-788.336) (-785.634) (-787.498) [-787.712] * (-786.715) (-786.403) (-786.651) [-786.508] -- 0:00:28
      562500 -- (-785.817) [-786.484] (-792.056) (-788.063) * (-794.986) (-787.393) [-788.429] (-786.457) -- 0:00:28
      563000 -- (-785.818) (-786.413) (-789.388) [-785.539] * (-791.840) (-785.122) (-787.613) [-786.448] -- 0:00:27
      563500 -- (-787.611) [-787.123] (-787.276) (-786.022) * (-786.500) [-786.168] (-787.785) (-787.530) -- 0:00:27
      564000 -- (-785.762) (-786.839) [-785.442] (-786.033) * (-786.869) (-785.518) (-787.021) [-789.127] -- 0:00:27
      564500 -- (-786.294) [-786.258] (-786.842) (-788.073) * (-787.742) (-787.251) (-790.288) [-786.974] -- 0:00:27
      565000 -- (-786.912) (-786.784) [-787.531] (-787.953) * (-786.390) (-785.908) (-790.537) [-788.611] -- 0:00:27

      Average standard deviation of split frequencies: 0.014110

      565500 -- (-786.402) [-786.293] (-789.377) (-787.406) * (-788.210) (-788.656) (-789.872) [-786.519] -- 0:00:27
      566000 -- (-787.926) [-785.258] (-787.031) (-787.741) * (-786.229) (-789.261) [-785.746] (-786.829) -- 0:00:27
      566500 -- (-786.560) [-785.801] (-789.134) (-788.076) * (-786.042) [-789.853] (-786.590) (-787.518) -- 0:00:27
      567000 -- (-787.337) (-785.908) (-789.006) [-786.326] * (-787.904) [-786.193] (-785.821) (-789.689) -- 0:00:27
      567500 -- [-791.452] (-789.845) (-790.377) (-786.443) * (-785.370) (-786.775) [-787.496] (-788.432) -- 0:00:27
      568000 -- [-785.983] (-787.360) (-786.514) (-786.357) * (-786.138) (-786.746) [-785.739] (-790.754) -- 0:00:27
      568500 -- [-785.256] (-785.520) (-786.129) (-786.045) * (-785.972) (-787.492) (-787.247) [-788.343] -- 0:00:27
      569000 -- (-787.316) (-786.145) (-786.905) [-785.817] * (-785.992) (-786.125) [-786.717] (-786.989) -- 0:00:27
      569500 -- (-787.051) [-786.294] (-787.701) (-787.649) * (-786.838) [-785.825] (-787.580) (-787.459) -- 0:00:27
      570000 -- (-785.805) (-787.344) [-785.519] (-789.119) * (-787.838) [-786.491] (-793.284) (-787.789) -- 0:00:27

      Average standard deviation of split frequencies: 0.013946

      570500 -- [-785.536] (-787.033) (-785.702) (-789.493) * (-786.407) [-787.572] (-794.059) (-787.964) -- 0:00:27
      571000 -- [-788.945] (-788.308) (-787.888) (-788.572) * (-793.206) (-787.111) (-789.600) [-787.571] -- 0:00:27
      571500 -- (-788.580) [-786.814] (-786.006) (-786.338) * [-787.954] (-790.181) (-788.352) (-788.234) -- 0:00:27
      572000 -- (-786.213) (-787.655) (-792.626) [-786.844] * [-787.291] (-789.072) (-787.574) (-788.928) -- 0:00:27
      572500 -- [-786.460] (-787.104) (-790.886) (-789.206) * (-788.201) (-785.644) [-786.905] (-793.850) -- 0:00:27
      573000 -- (-792.471) [-788.145] (-785.961) (-788.012) * (-788.258) (-789.597) (-786.329) [-785.775] -- 0:00:27
      573500 -- [-786.509] (-789.719) (-785.702) (-786.000) * [-785.934] (-785.826) (-785.228) (-786.606) -- 0:00:27
      574000 -- (-790.275) (-791.766) [-786.297] (-785.131) * (-786.585) [-788.434] (-787.199) (-785.877) -- 0:00:27
      574500 -- (-786.347) (-789.236) [-788.600] (-791.024) * (-788.329) (-788.300) (-787.520) [-786.712] -- 0:00:27
      575000 -- (-790.933) (-785.483) [-786.804] (-787.721) * (-786.510) [-787.956] (-788.552) (-786.181) -- 0:00:27

      Average standard deviation of split frequencies: 0.014424

      575500 -- [-787.911] (-786.561) (-787.342) (-789.157) * (-788.763) (-788.797) (-793.617) [-786.929] -- 0:00:27
      576000 -- [-788.553] (-786.451) (-788.146) (-789.323) * (-787.183) [-787.627] (-787.524) (-786.493) -- 0:00:27
      576500 -- (-791.183) [-789.199] (-787.940) (-786.779) * (-786.316) (-786.314) (-786.036) [-786.798] -- 0:00:27
      577000 -- (-786.080) (-788.483) (-788.289) [-786.956] * [-787.597] (-786.562) (-787.532) (-786.334) -- 0:00:27
      577500 -- (-787.050) (-786.591) (-786.327) [-787.190] * [-785.997] (-787.336) (-785.753) (-788.598) -- 0:00:27
      578000 -- (-785.899) (-785.924) [-787.076] (-790.411) * [-787.717] (-786.587) (-794.149) (-785.922) -- 0:00:27
      578500 -- [-786.425] (-787.300) (-787.207) (-788.077) * (-793.688) [-786.983] (-787.607) (-789.065) -- 0:00:26
      579000 -- [-786.937] (-786.903) (-787.059) (-788.946) * (-788.968) (-788.666) (-786.339) [-785.104] -- 0:00:26
      579500 -- [-788.304] (-786.836) (-787.928) (-788.454) * (-787.455) (-786.622) [-789.631] (-785.733) -- 0:00:26
      580000 -- (-790.987) (-786.074) (-785.513) [-790.700] * (-787.369) (-787.600) (-786.893) [-786.150] -- 0:00:26

      Average standard deviation of split frequencies: 0.014867

      580500 -- (-785.897) (-786.732) (-792.604) [-788.576] * [-786.178] (-788.107) (-785.616) (-786.906) -- 0:00:26
      581000 -- (-787.769) (-788.031) (-791.080) [-786.071] * (-786.650) (-787.195) (-786.137) [-788.271] -- 0:00:26
      581500 -- [-789.367] (-787.558) (-787.996) (-785.549) * (-786.039) (-789.703) (-786.253) [-786.830] -- 0:00:26
      582000 -- (-788.796) (-788.050) (-787.157) [-786.935] * (-785.651) (-790.263) [-786.681] (-788.208) -- 0:00:26
      582500 -- (-787.771) (-791.637) [-786.347] (-786.085) * [-789.204] (-789.934) (-786.985) (-790.807) -- 0:00:26
      583000 -- (-786.848) (-789.593) [-788.576] (-787.471) * [-786.853] (-786.931) (-786.591) (-785.640) -- 0:00:26
      583500 -- (-786.110) (-789.074) (-785.955) [-787.628] * (-786.772) (-786.910) [-787.632] (-786.596) -- 0:00:26
      584000 -- (-788.652) (-790.011) (-787.252) [-791.651] * (-789.488) (-786.302) (-787.202) [-789.538] -- 0:00:26
      584500 -- (-786.593) (-793.313) (-789.831) [-786.676] * (-791.397) (-785.785) [-788.362] (-788.281) -- 0:00:26
      585000 -- (-787.572) (-791.837) (-792.000) [-789.237] * (-790.228) [-788.725] (-788.344) (-786.542) -- 0:00:26

      Average standard deviation of split frequencies: 0.015237

      585500 -- (-785.585) (-785.814) (-787.018) [-789.509] * (-788.336) [-791.614] (-787.792) (-786.006) -- 0:00:26
      586000 -- (-788.463) (-786.184) [-786.143] (-790.603) * (-786.133) (-789.054) (-787.456) [-785.893] -- 0:00:26
      586500 -- [-786.463] (-787.879) (-791.366) (-790.404) * (-786.236) [-788.997] (-789.673) (-790.436) -- 0:00:26
      587000 -- (-786.235) (-786.041) [-788.763] (-791.853) * (-785.807) [-785.363] (-793.323) (-787.354) -- 0:00:26
      587500 -- (-788.630) [-785.417] (-786.537) (-788.225) * (-787.957) [-787.714] (-786.091) (-786.300) -- 0:00:26
      588000 -- (-785.988) [-786.102] (-788.110) (-786.439) * [-787.653] (-788.397) (-789.536) (-787.661) -- 0:00:26
      588500 -- (-785.970) (-787.827) (-787.275) [-792.098] * (-788.904) (-787.547) [-786.316] (-786.745) -- 0:00:26
      589000 -- [-785.838] (-785.908) (-787.894) (-788.966) * (-786.379) (-788.349) [-787.742] (-787.889) -- 0:00:26
      589500 -- (-787.605) (-787.586) (-789.343) [-788.528] * (-787.021) (-788.359) [-787.811] (-787.482) -- 0:00:26
      590000 -- [-787.192] (-786.221) (-788.722) (-797.293) * (-789.155) (-788.439) [-787.787] (-793.296) -- 0:00:26

      Average standard deviation of split frequencies: 0.014976

      590500 -- (-787.706) [-787.358] (-786.057) (-789.980) * [-788.440] (-789.830) (-789.231) (-790.726) -- 0:00:26
      591000 -- (-786.672) (-788.992) (-787.047) [-789.367] * (-788.371) (-792.249) [-789.285] (-787.082) -- 0:00:26
      591500 -- (-788.465) (-787.768) (-788.031) [-786.310] * (-792.269) (-788.660) [-788.460] (-786.872) -- 0:00:26
      592000 -- (-787.242) (-786.264) (-788.387) [-786.956] * (-788.658) (-788.645) [-786.504] (-791.622) -- 0:00:26
      592500 -- (-788.312) [-787.217] (-786.745) (-785.834) * (-787.604) (-789.554) [-788.234] (-789.598) -- 0:00:26
      593000 -- (-786.639) [-785.118] (-787.532) (-789.282) * (-787.634) (-787.361) (-788.552) [-789.918] -- 0:00:26
      593500 -- (-787.966) [-786.049] (-789.632) (-788.902) * (-787.034) (-789.676) (-791.510) [-787.843] -- 0:00:26
      594000 -- (-788.054) (-786.834) (-789.041) [-788.867] * (-786.534) [-789.415] (-787.866) (-785.669) -- 0:00:25
      594500 -- (-788.447) (-790.498) (-787.685) [-787.862] * (-789.341) (-788.007) [-788.227] (-788.978) -- 0:00:25
      595000 -- (-788.773) [-787.487] (-787.773) (-786.969) * (-789.304) (-786.998) (-791.112) [-789.004] -- 0:00:25

      Average standard deviation of split frequencies: 0.015473

      595500 -- (-787.766) [-786.094] (-788.161) (-787.258) * (-789.731) [-787.879] (-794.389) (-787.584) -- 0:00:25
      596000 -- (-786.888) [-787.332] (-786.192) (-788.296) * (-790.173) [-786.194] (-790.575) (-789.543) -- 0:00:25
      596500 -- (-789.497) (-785.536) [-787.359] (-791.906) * (-793.782) (-786.804) [-789.752] (-786.843) -- 0:00:25
      597000 -- (-785.303) [-785.478] (-786.729) (-789.514) * (-789.268) (-788.041) [-788.131] (-786.803) -- 0:00:25
      597500 -- (-786.703) (-787.008) [-787.628] (-787.627) * (-787.247) [-789.349] (-788.134) (-786.687) -- 0:00:25
      598000 -- (-786.711) (-786.258) [-786.517] (-786.558) * (-786.646) [-785.359] (-786.302) (-788.630) -- 0:00:25
      598500 -- (-788.344) (-786.867) (-787.395) [-785.934] * (-785.671) [-787.639] (-786.330) (-787.624) -- 0:00:25
      599000 -- (-789.127) (-790.160) [-788.395] (-788.837) * (-786.248) (-785.930) (-788.361) [-787.089] -- 0:00:25
      599500 -- (-788.979) [-789.104] (-786.988) (-786.828) * [-785.956] (-786.127) (-786.627) (-787.200) -- 0:00:25
      600000 -- (-789.276) (-790.526) [-787.019] (-789.114) * (-787.363) [-786.970] (-792.260) (-788.656) -- 0:00:25

      Average standard deviation of split frequencies: 0.015696

      600500 -- (-790.191) (-792.049) (-786.708) [-787.887] * [-787.152] (-788.818) (-788.775) (-787.215) -- 0:00:25
      601000 -- [-787.048] (-792.126) (-789.434) (-787.332) * (-786.383) [-785.698] (-788.516) (-786.264) -- 0:00:25
      601500 -- [-786.426] (-789.674) (-787.148) (-786.196) * (-787.308) (-786.369) (-788.902) [-786.967] -- 0:00:25
      602000 -- (-785.856) [-787.954] (-786.468) (-787.018) * (-785.650) [-786.886] (-793.094) (-786.828) -- 0:00:25
      602500 -- (-787.761) (-787.595) [-787.141] (-785.519) * (-786.121) [-786.282] (-787.194) (-787.914) -- 0:00:25
      603000 -- [-786.409] (-785.887) (-786.209) (-789.377) * [-785.698] (-786.285) (-788.933) (-786.839) -- 0:00:25
      603500 -- [-790.378] (-788.524) (-785.923) (-786.714) * (-789.449) [-785.608] (-789.241) (-790.475) -- 0:00:25
      604000 -- [-786.514] (-786.871) (-786.781) (-788.056) * [-787.787] (-786.899) (-786.516) (-788.101) -- 0:00:25
      604500 -- [-792.915] (-786.638) (-787.334) (-787.410) * [-789.251] (-790.508) (-786.909) (-790.695) -- 0:00:25
      605000 -- (-786.033) [-788.300] (-789.640) (-788.122) * (-785.398) [-791.458] (-788.705) (-787.821) -- 0:00:25

      Average standard deviation of split frequencies: 0.015471

      605500 -- (-786.383) [-785.700] (-788.171) (-788.745) * [-787.998] (-789.602) (-788.388) (-786.301) -- 0:00:25
      606000 -- (-786.863) (-788.413) [-788.160] (-788.925) * [-787.179] (-793.030) (-786.637) (-788.413) -- 0:00:25
      606500 -- [-786.274] (-789.754) (-790.127) (-786.307) * (-788.356) [-786.446] (-787.040) (-785.563) -- 0:00:25
      607000 -- (-785.903) [-790.084] (-787.340) (-788.396) * (-790.666) (-787.773) [-787.076] (-786.681) -- 0:00:25
      607500 -- [-786.569] (-788.545) (-787.113) (-786.960) * (-785.230) [-790.178] (-788.930) (-785.397) -- 0:00:25
      608000 -- (-789.167) (-787.316) [-788.978] (-789.358) * (-787.742) (-789.254) [-786.039] (-788.780) -- 0:00:25
      608500 -- (-786.822) (-786.986) (-789.379) [-786.990] * (-785.145) (-788.773) [-786.510] (-792.536) -- 0:00:25
      609000 -- (-787.298) [-786.836] (-790.211) (-786.905) * (-787.077) (-788.178) [-787.771] (-789.524) -- 0:00:25
      609500 -- [-788.707] (-789.752) (-788.179) (-788.983) * (-785.563) [-789.114] (-792.564) (-788.606) -- 0:00:24
      610000 -- [-786.961] (-787.724) (-786.385) (-787.856) * (-785.257) [-790.446] (-786.479) (-786.915) -- 0:00:24

      Average standard deviation of split frequencies: 0.016166

      610500 -- [-787.935] (-786.797) (-785.735) (-787.441) * (-785.801) [-785.943] (-786.666) (-786.809) -- 0:00:24
      611000 -- (-788.374) (-789.862) [-786.324] (-786.162) * (-788.376) (-786.725) (-787.670) [-788.166] -- 0:00:24
      611500 -- (-786.000) (-790.523) (-788.579) [-785.992] * [-793.593] (-786.838) (-788.683) (-787.525) -- 0:00:24
      612000 -- (-786.094) (-790.230) [-786.200] (-786.238) * (-785.849) [-786.808] (-787.811) (-788.038) -- 0:00:24
      612500 -- (-785.305) (-793.314) [-785.897] (-788.680) * (-786.280) (-788.938) [-786.811] (-788.188) -- 0:00:24
      613000 -- (-788.007) (-786.126) [-786.930] (-788.260) * (-788.005) (-788.435) [-786.718] (-787.789) -- 0:00:24
      613500 -- (-787.497) (-787.589) [-787.595] (-786.896) * [-789.730] (-788.268) (-787.218) (-790.524) -- 0:00:24
      614000 -- (-787.135) [-788.272] (-786.019) (-786.632) * (-788.960) [-787.991] (-791.086) (-786.943) -- 0:00:24
      614500 -- [-788.294] (-790.443) (-794.252) (-787.898) * [-787.429] (-788.893) (-789.960) (-788.784) -- 0:00:24
      615000 -- (-789.029) (-787.388) [-787.085] (-789.533) * (-787.205) (-787.404) [-787.268] (-787.211) -- 0:00:24

      Average standard deviation of split frequencies: 0.016206

      615500 -- (-786.458) [-786.653] (-786.362) (-790.592) * (-786.335) (-788.569) (-786.314) [-789.004] -- 0:00:24
      616000 -- (-786.351) (-787.359) [-786.267] (-785.733) * (-786.598) (-787.285) (-788.429) [-789.354] -- 0:00:24
      616500 -- (-786.476) (-786.488) [-785.764] (-787.466) * (-787.516) [-785.657] (-786.323) (-787.717) -- 0:00:24
      617000 -- [-785.782] (-786.093) (-786.836) (-787.763) * [-787.377] (-785.868) (-788.598) (-788.661) -- 0:00:24
      617500 -- (-788.114) [-787.002] (-788.267) (-786.581) * (-787.354) (-787.822) (-787.315) [-793.643] -- 0:00:24
      618000 -- [-786.099] (-787.177) (-786.223) (-788.387) * (-786.772) [-787.744] (-791.657) (-787.325) -- 0:00:24
      618500 -- [-786.159] (-789.014) (-786.528) (-787.429) * (-790.374) (-786.786) [-785.800] (-790.428) -- 0:00:24
      619000 -- [-787.993] (-790.437) (-791.327) (-787.095) * (-789.479) (-785.834) [-785.596] (-787.252) -- 0:00:24
      619500 -- (-792.865) (-785.344) (-786.974) [-786.643] * (-790.069) (-786.599) [-790.528] (-787.075) -- 0:00:24
      620000 -- [-789.617] (-792.039) (-785.971) (-790.669) * (-787.854) (-785.982) [-786.526] (-786.305) -- 0:00:24

      Average standard deviation of split frequencies: 0.015646

      620500 -- (-790.852) (-789.358) [-787.279] (-788.292) * (-785.549) [-786.821] (-786.906) (-786.140) -- 0:00:24
      621000 -- (-787.260) (-789.237) (-786.485) [-788.087] * (-787.244) [-786.123] (-787.047) (-785.756) -- 0:00:24
      621500 -- (-786.656) [-788.382] (-791.970) (-791.477) * (-785.674) (-791.088) [-786.782] (-787.992) -- 0:00:24
      622000 -- (-786.149) (-787.076) [-786.231] (-790.154) * (-785.920) (-792.556) [-788.845] (-786.138) -- 0:00:24
      622500 -- (-790.828) (-790.364) (-785.933) [-786.426] * (-787.507) (-791.626) [-788.177] (-788.955) -- 0:00:24
      623000 -- (-790.971) (-789.030) (-785.789) [-787.435] * (-790.731) (-786.154) [-788.614] (-787.209) -- 0:00:24
      623500 -- (-787.475) (-788.276) (-788.447) [-788.721] * (-788.261) (-786.285) [-787.022] (-787.401) -- 0:00:24
      624000 -- [-787.208] (-788.070) (-787.265) (-788.189) * (-785.560) (-787.177) [-785.430] (-786.070) -- 0:00:24
      624500 -- (-785.790) (-791.260) [-787.249] (-787.951) * (-785.371) (-786.084) [-787.268] (-789.214) -- 0:00:24
      625000 -- (-787.368) (-790.301) [-786.764] (-786.486) * (-786.559) (-788.408) [-786.245] (-789.097) -- 0:00:24

      Average standard deviation of split frequencies: 0.015202

      625500 -- (-788.081) (-795.760) [-786.098] (-786.465) * (-785.966) (-786.252) [-786.281] (-785.962) -- 0:00:23
      626000 -- (-788.302) (-787.607) [-785.666] (-786.633) * (-788.125) (-786.437) (-786.191) [-786.695] -- 0:00:23
      626500 -- (-786.556) [-787.785] (-785.615) (-790.741) * [-790.077] (-787.973) (-785.536) (-789.307) -- 0:00:23
      627000 -- [-786.087] (-786.886) (-785.186) (-786.508) * (-789.950) (-785.271) [-786.812] (-789.727) -- 0:00:23
      627500 -- (-792.085) (-785.992) (-787.067) [-786.177] * (-788.270) (-786.570) (-789.358) [-790.981] -- 0:00:23
      628000 -- (-790.855) [-785.228] (-787.884) (-787.204) * (-788.096) (-785.986) (-785.928) [-785.981] -- 0:00:23
      628500 -- [-788.352] (-786.054) (-785.841) (-785.785) * (-789.071) [-788.568] (-786.341) (-785.881) -- 0:00:23
      629000 -- (-785.810) [-785.465] (-785.633) (-785.565) * (-786.257) [-789.106] (-788.502) (-787.241) -- 0:00:23
      629500 -- (-789.616) [-788.539] (-785.945) (-786.561) * [-790.137] (-786.712) (-788.214) (-785.817) -- 0:00:23
      630000 -- (-787.700) (-787.361) [-788.581] (-785.905) * [-787.214] (-791.714) (-786.300) (-788.186) -- 0:00:23

      Average standard deviation of split frequencies: 0.015463

      630500 -- (-791.160) (-788.270) [-787.207] (-786.669) * [-789.955] (-786.774) (-786.662) (-789.385) -- 0:00:23
      631000 -- (-788.350) [-786.317] (-787.368) (-789.146) * [-788.792] (-790.572) (-792.325) (-789.733) -- 0:00:23
      631500 -- [-790.309] (-787.648) (-788.277) (-787.993) * (-786.251) [-790.227] (-787.797) (-787.101) -- 0:00:23
      632000 -- [-787.371] (-793.920) (-790.664) (-790.735) * (-787.824) (-785.806) (-786.253) [-786.035] -- 0:00:23
      632500 -- (-785.783) [-787.014] (-787.736) (-787.415) * (-787.236) [-786.425] (-785.124) (-791.530) -- 0:00:23
      633000 -- [-786.647] (-790.565) (-789.957) (-788.218) * [-785.165] (-787.107) (-785.589) (-787.707) -- 0:00:23
      633500 -- [-785.986] (-786.330) (-786.552) (-790.869) * (-785.166) [-788.800] (-786.028) (-787.928) -- 0:00:23
      634000 -- [-786.142] (-785.901) (-789.106) (-797.455) * (-787.051) (-787.143) [-787.416] (-787.546) -- 0:00:23
      634500 -- [-786.854] (-787.982) (-786.803) (-788.634) * (-788.117) (-785.726) [-788.406] (-788.523) -- 0:00:23
      635000 -- [-786.665] (-786.501) (-787.482) (-786.985) * (-788.691) (-786.432) (-788.767) [-786.660] -- 0:00:23

      Average standard deviation of split frequencies: 0.015022

      635500 -- (-787.024) (-785.792) [-786.323] (-787.150) * (-788.118) [-786.127] (-787.177) (-787.566) -- 0:00:23
      636000 -- [-789.131] (-786.368) (-791.148) (-787.372) * (-789.141) [-786.796] (-787.747) (-790.765) -- 0:00:23
      636500 -- (-786.883) [-787.233] (-786.191) (-786.416) * (-790.488) [-786.844] (-788.550) (-788.805) -- 0:00:23
      637000 -- (-787.588) [-787.885] (-786.441) (-786.268) * (-787.993) (-787.110) (-787.768) [-787.978] -- 0:00:23
      637500 -- (-787.589) [-787.696] (-789.506) (-786.959) * [-787.304] (-792.762) (-788.677) (-786.479) -- 0:00:23
      638000 -- [-787.325] (-786.572) (-786.533) (-789.568) * (-789.002) (-787.656) [-787.223] (-788.344) -- 0:00:23
      638500 -- (-790.634) (-788.520) (-788.230) [-788.231] * [-788.103] (-786.045) (-789.488) (-790.559) -- 0:00:23
      639000 -- (-789.760) [-786.066] (-787.496) (-787.142) * [-786.632] (-788.758) (-791.567) (-790.741) -- 0:00:23
      639500 -- [-786.164] (-788.078) (-791.779) (-785.687) * [-786.156] (-786.301) (-791.173) (-792.391) -- 0:00:23
      640000 -- (-787.272) (-789.717) (-788.010) [-785.750] * [-786.435] (-790.459) (-786.713) (-786.319) -- 0:00:23

      Average standard deviation of split frequencies: 0.015599

      640500 -- (-789.254) (-791.365) (-787.139) [-787.747] * (-785.910) (-786.067) [-787.477] (-788.114) -- 0:00:23
      641000 -- (-786.908) (-789.413) (-787.068) [-786.580] * (-790.551) [-785.923] (-789.869) (-787.769) -- 0:00:22
      641500 -- [-785.200] (-788.560) (-786.579) (-788.877) * (-789.192) (-785.636) [-785.566] (-788.372) -- 0:00:22
      642000 -- (-785.869) (-785.619) [-788.076] (-788.234) * (-786.171) [-789.656] (-787.664) (-787.301) -- 0:00:22
      642500 -- [-786.415] (-785.936) (-788.182) (-786.740) * (-787.136) (-786.024) [-788.034] (-785.551) -- 0:00:22
      643000 -- [-786.356] (-791.312) (-789.420) (-786.348) * (-792.242) (-785.784) (-789.117) [-788.654] -- 0:00:22
      643500 -- (-785.725) [-790.879] (-789.298) (-787.825) * (-790.511) [-785.490] (-786.249) (-785.986) -- 0:00:22
      644000 -- [-786.062] (-790.527) (-787.776) (-786.668) * (-788.110) [-789.924] (-790.102) (-787.437) -- 0:00:22
      644500 -- (-788.026) (-788.530) [-786.407] (-786.220) * (-786.461) (-788.002) (-786.713) [-789.038] -- 0:00:22
      645000 -- [-786.631] (-796.772) (-790.507) (-785.550) * (-789.729) [-785.590] (-787.089) (-790.668) -- 0:00:22

      Average standard deviation of split frequencies: 0.015461

      645500 -- (-787.236) (-789.035) [-787.150] (-785.717) * [-790.170] (-786.774) (-786.285) (-789.465) -- 0:00:22
      646000 -- [-791.539] (-792.118) (-787.514) (-786.790) * (-786.934) [-785.836] (-786.270) (-789.401) -- 0:00:22
      646500 -- (-786.702) (-786.879) [-788.355] (-787.042) * [-787.274] (-791.887) (-786.407) (-787.585) -- 0:00:22
      647000 -- (-786.767) (-789.389) (-786.735) [-786.600] * [-786.895] (-789.467) (-788.721) (-790.330) -- 0:00:22
      647500 -- (-786.640) (-789.253) (-787.661) [-786.784] * [-787.912] (-786.361) (-786.384) (-794.727) -- 0:00:22
      648000 -- (-787.767) (-789.718) [-785.768] (-787.386) * [-787.633] (-786.296) (-787.867) (-787.520) -- 0:00:22
      648500 -- (-786.933) (-791.416) [-786.214] (-785.752) * (-791.336) [-790.777] (-787.548) (-786.028) -- 0:00:22
      649000 -- (-786.806) (-786.109) [-787.450] (-787.284) * (-787.269) [-788.403] (-788.069) (-786.517) -- 0:00:22
      649500 -- (-786.440) (-786.125) (-786.042) [-787.713] * (-787.145) (-789.964) [-786.422] (-786.102) -- 0:00:22
      650000 -- (-786.428) (-785.952) (-786.229) [-786.203] * (-788.634) (-788.148) (-787.297) [-785.827] -- 0:00:22

      Average standard deviation of split frequencies: 0.015172

      650500 -- (-788.192) (-791.524) [-786.120] (-786.450) * (-786.179) (-788.965) (-786.714) [-785.841] -- 0:00:22
      651000 -- [-785.846] (-789.857) (-785.982) (-788.019) * [-785.267] (-793.076) (-789.602) (-786.034) -- 0:00:22
      651500 -- (-789.400) (-785.547) [-787.112] (-786.614) * [-786.531] (-790.725) (-786.602) (-786.615) -- 0:00:22
      652000 -- (-789.347) (-792.199) (-789.754) [-786.383] * [-785.693] (-787.395) (-788.057) (-786.508) -- 0:00:22
      652500 -- (-786.614) [-789.930] (-790.224) (-789.281) * (-786.101) (-787.437) (-789.774) [-785.910] -- 0:00:22
      653000 -- (-786.265) [-789.048] (-789.259) (-785.965) * (-785.780) (-789.426) [-788.022] (-786.577) -- 0:00:22
      653500 -- (-787.553) [-786.249] (-787.537) (-785.944) * (-785.824) (-790.043) (-788.015) [-786.470] -- 0:00:22
      654000 -- (-787.688) [-785.806] (-791.347) (-785.710) * (-794.006) (-785.722) (-788.922) [-788.214] -- 0:00:22
      654500 -- (-787.504) [-788.517] (-787.168) (-789.974) * [-785.741] (-785.356) (-789.168) (-787.726) -- 0:00:22
      655000 -- (-792.758) (-789.779) (-787.079) [-790.476] * (-785.844) (-791.016) (-787.228) [-785.157] -- 0:00:22

      Average standard deviation of split frequencies: 0.015175

      655500 -- (-787.285) [-794.101] (-786.220) (-787.910) * [-785.331] (-792.292) (-787.078) (-787.470) -- 0:00:22
      656000 -- (-789.491) [-789.055] (-790.109) (-789.624) * [-786.872] (-789.551) (-786.826) (-787.431) -- 0:00:22
      656500 -- (-788.313) (-787.234) [-789.262] (-786.929) * (-790.611) (-787.368) [-786.661] (-786.363) -- 0:00:21
      657000 -- (-786.159) (-786.318) (-788.775) [-787.941] * (-785.937) (-787.666) (-786.834) [-786.794] -- 0:00:21
      657500 -- (-786.633) (-786.738) [-785.864] (-788.908) * (-788.711) [-787.466] (-790.428) (-788.212) -- 0:00:21
      658000 -- (-785.712) (-786.938) [-785.929] (-787.534) * [-787.021] (-786.409) (-786.499) (-788.367) -- 0:00:21
      658500 -- (-790.590) (-785.827) [-786.366] (-789.192) * (-786.167) (-786.685) [-787.429] (-790.411) -- 0:00:21
      659000 -- (-791.568) (-785.454) [-786.198] (-787.055) * [-786.602] (-787.220) (-788.382) (-794.472) -- 0:00:21
      659500 -- (-791.764) [-786.494] (-785.711) (-787.651) * (-786.864) (-789.041) [-788.631] (-786.731) -- 0:00:21
      660000 -- (-788.668) (-786.007) [-786.375] (-791.306) * [-789.167] (-793.442) (-788.441) (-787.904) -- 0:00:21

      Average standard deviation of split frequencies: 0.015446

      660500 -- (-785.994) [-786.982] (-787.296) (-793.344) * (-791.808) (-786.267) (-789.309) [-788.421] -- 0:00:21
      661000 -- [-786.510] (-787.893) (-787.123) (-788.375) * (-787.863) [-787.478] (-790.665) (-790.692) -- 0:00:21
      661500 -- (-787.660) (-789.318) [-790.953] (-786.212) * (-788.909) (-789.973) (-786.606) [-790.416] -- 0:00:21
      662000 -- [-787.635] (-785.584) (-787.946) (-789.815) * (-786.675) (-787.250) [-786.415] (-786.310) -- 0:00:21
      662500 -- (-786.214) (-786.241) (-789.760) [-790.150] * (-788.654) (-786.785) (-787.372) [-785.825] -- 0:00:21
      663000 -- (-790.049) [-786.893] (-786.873) (-787.672) * (-788.642) [-786.538] (-786.077) (-787.057) -- 0:00:21
      663500 -- (-785.316) [-786.410] (-785.675) (-788.258) * (-787.695) (-787.262) [-787.405] (-789.570) -- 0:00:21
      664000 -- [-786.792] (-786.292) (-791.559) (-785.915) * (-787.182) (-787.523) (-785.839) [-788.016] -- 0:00:21
      664500 -- [-786.930] (-790.040) (-786.152) (-785.765) * [-794.119] (-789.887) (-787.035) (-787.040) -- 0:00:21
      665000 -- (-786.729) [-788.079] (-786.821) (-787.038) * (-790.574) (-790.262) [-789.236] (-786.957) -- 0:00:21

      Average standard deviation of split frequencies: 0.014781

      665500 -- (-787.527) (-787.931) [-787.041] (-787.304) * (-785.820) [-790.552] (-787.258) (-785.935) -- 0:00:21
      666000 -- (-791.178) (-788.471) (-787.281) [-786.178] * [-788.064] (-789.888) (-786.305) (-788.030) -- 0:00:21
      666500 -- (-788.999) (-787.997) (-786.868) [-785.987] * (-787.100) [-787.712] (-787.396) (-786.883) -- 0:00:21
      667000 -- [-786.622] (-788.504) (-786.927) (-788.425) * (-793.124) [-787.457] (-785.887) (-789.617) -- 0:00:20
      667500 -- (-785.269) (-786.995) (-786.875) [-787.697] * (-789.817) (-786.233) (-786.177) [-788.304] -- 0:00:21
      668000 -- [-785.245] (-788.174) (-785.998) (-792.612) * (-791.446) (-786.935) (-787.999) [-787.417] -- 0:00:21
      668500 -- [-785.775] (-788.148) (-785.755) (-788.503) * (-793.449) [-787.020] (-787.662) (-786.730) -- 0:00:21
      669000 -- (-785.746) (-787.842) (-787.417) [-786.641] * (-793.492) [-789.426] (-787.926) (-786.303) -- 0:00:21
      669500 -- (-785.863) (-786.279) (-786.462) [-785.664] * (-789.583) (-790.742) [-786.838] (-787.004) -- 0:00:21
      670000 -- (-791.336) [-786.749] (-785.985) (-786.104) * (-789.568) (-787.885) [-790.084] (-789.984) -- 0:00:21

      Average standard deviation of split frequencies: 0.014058

      670500 -- (-786.789) (-786.300) (-791.236) [-787.952] * (-789.948) [-787.199] (-788.977) (-786.642) -- 0:00:21
      671000 -- (-785.963) (-785.507) [-788.893] (-787.717) * (-786.102) [-785.332] (-785.877) (-786.559) -- 0:00:21
      671500 -- (-787.082) (-787.273) [-786.575] (-788.484) * [-787.807] (-786.488) (-785.909) (-787.773) -- 0:00:21
      672000 -- (-786.408) (-786.495) (-789.246) [-792.288] * (-789.018) (-788.357) (-786.443) [-787.993] -- 0:00:20
      672500 -- (-786.790) (-787.587) [-788.600] (-786.166) * [-785.535] (-786.710) (-787.624) (-790.391) -- 0:00:20
      673000 -- (-787.942) (-787.687) [-787.459] (-785.904) * [-786.410] (-787.650) (-787.238) (-789.181) -- 0:00:20
      673500 -- (-788.648) (-788.542) (-785.991) [-789.554] * (-786.696) (-786.930) (-787.744) [-787.385] -- 0:00:20
      674000 -- [-788.371] (-792.693) (-787.202) (-787.431) * [-786.484] (-788.486) (-785.985) (-791.425) -- 0:00:20
      674500 -- (-788.737) (-788.547) (-788.670) [-787.146] * (-790.347) (-789.233) (-788.501) [-786.075] -- 0:00:20
      675000 -- (-787.119) [-789.011] (-787.445) (-788.232) * (-789.160) (-786.222) [-786.041] (-786.707) -- 0:00:20

      Average standard deviation of split frequencies: 0.014165

      675500 -- (-787.719) (-788.738) [-787.092] (-787.260) * (-785.822) [-787.010] (-786.619) (-788.665) -- 0:00:20
      676000 -- [-786.372] (-791.725) (-786.204) (-785.751) * (-786.951) [-787.325] (-787.727) (-785.626) -- 0:00:20
      676500 -- (-788.228) (-787.038) (-789.112) [-788.504] * (-787.239) [-787.342] (-786.259) (-785.665) -- 0:00:20
      677000 -- (-786.771) [-787.238] (-788.997) (-788.309) * (-786.569) (-786.632) [-787.085] (-787.713) -- 0:00:20
      677500 -- (-788.699) (-788.467) [-786.069] (-787.122) * (-791.886) (-786.561) [-789.467] (-787.674) -- 0:00:20
      678000 -- (-792.895) [-785.339] (-786.247) (-786.116) * [-785.939] (-786.402) (-791.246) (-786.497) -- 0:00:20
      678500 -- (-790.775) (-786.054) (-788.428) [-787.869] * (-786.373) [-786.929] (-788.561) (-785.870) -- 0:00:20
      679000 -- [-788.174] (-789.368) (-786.776) (-789.393) * [-786.828] (-787.652) (-786.125) (-785.673) -- 0:00:20
      679500 -- (-786.946) (-788.325) [-785.792] (-789.707) * (-786.460) (-788.658) [-786.422] (-785.990) -- 0:00:20
      680000 -- [-788.041] (-786.723) (-789.436) (-791.030) * [-787.334] (-787.485) (-785.186) (-791.123) -- 0:00:20

      Average standard deviation of split frequencies: 0.014055

      680500 -- (-787.683) [-786.018] (-785.993) (-788.650) * (-791.019) (-787.415) (-787.993) [-787.050] -- 0:00:20
      681000 -- (-791.054) [-785.811] (-788.290) (-790.727) * (-789.902) (-789.424) (-785.820) [-789.122] -- 0:00:20
      681500 -- [-786.573] (-787.046) (-786.786) (-789.342) * [-786.894] (-785.567) (-788.266) (-787.913) -- 0:00:20
      682000 -- (-786.614) (-787.565) (-785.938) [-786.813] * (-787.310) (-786.561) (-788.688) [-787.295] -- 0:00:20
      682500 -- (-786.741) [-786.612] (-790.871) (-790.919) * [-789.097] (-788.077) (-787.868) (-788.181) -- 0:00:20
      683000 -- (-789.346) [-789.137] (-786.650) (-789.773) * (-787.198) (-786.674) (-787.385) [-787.125] -- 0:00:19
      683500 -- (-786.427) (-788.033) (-788.417) [-786.797] * (-786.292) [-785.659] (-789.280) (-789.939) -- 0:00:20
      684000 -- (-789.682) [-788.322] (-788.548) (-789.012) * (-787.238) (-788.261) [-786.303] (-787.173) -- 0:00:20
      684500 -- (-788.565) [-785.463] (-789.371) (-790.800) * (-787.470) [-785.753] (-790.009) (-785.844) -- 0:00:20
      685000 -- [-786.161] (-790.368) (-789.732) (-786.931) * (-787.219) (-787.597) (-787.027) [-785.976] -- 0:00:20

      Average standard deviation of split frequencies: 0.014067

      685500 -- (-787.853) [-785.975] (-788.065) (-786.181) * (-785.690) (-787.258) (-787.625) [-786.290] -- 0:00:20
      686000 -- (-787.519) (-788.077) [-785.771] (-794.772) * (-786.508) (-787.377) [-788.989] (-786.247) -- 0:00:20
      686500 -- [-788.155] (-787.917) (-788.333) (-791.366) * [-786.181] (-787.550) (-786.782) (-788.189) -- 0:00:20
      687000 -- (-789.820) [-787.176] (-788.503) (-785.429) * [-787.846] (-787.746) (-791.194) (-787.315) -- 0:00:20
      687500 -- (-785.869) (-786.198) (-786.056) [-787.189] * [-786.517] (-787.071) (-789.242) (-787.724) -- 0:00:20
      688000 -- (-786.923) [-787.170] (-790.182) (-786.632) * (-790.219) (-786.902) [-785.781] (-787.832) -- 0:00:19
      688500 -- (-788.985) (-786.992) (-790.909) [-786.885] * [-790.824] (-790.431) (-785.601) (-785.761) -- 0:00:19
      689000 -- (-786.664) (-786.969) (-789.524) [-787.893] * (-790.313) [-786.813] (-786.590) (-786.471) -- 0:00:19
      689500 -- (-790.677) (-791.009) (-786.944) [-787.573] * [-788.647] (-785.463) (-786.938) (-787.428) -- 0:00:19
      690000 -- (-787.705) (-787.946) [-787.283] (-787.305) * [-787.882] (-785.462) (-787.172) (-789.579) -- 0:00:19

      Average standard deviation of split frequencies: 0.014291

      690500 -- (-789.475) [-785.520] (-787.608) (-788.386) * (-787.385) (-786.226) [-789.198] (-788.826) -- 0:00:19
      691000 -- (-788.258) [-787.032] (-787.199) (-792.142) * (-788.707) [-785.608] (-789.174) (-787.825) -- 0:00:19
      691500 -- (-788.558) (-785.944) [-787.443] (-793.482) * (-793.397) [-790.805] (-787.607) (-787.515) -- 0:00:19
      692000 -- [-789.800] (-786.118) (-787.458) (-788.717) * (-792.724) (-786.919) (-788.087) [-787.339] -- 0:00:19
      692500 -- (-791.443) (-787.730) (-786.060) [-786.522] * (-789.126) [-787.344] (-786.980) (-787.143) -- 0:00:19
      693000 -- [-790.220] (-785.155) (-789.313) (-787.897) * (-786.318) (-790.517) (-789.493) [-786.492] -- 0:00:19
      693500 -- [-788.209] (-785.971) (-786.543) (-786.581) * [-787.298] (-788.914) (-792.157) (-786.500) -- 0:00:19
      694000 -- (-787.648) (-787.036) (-788.389) [-786.802] * [-785.713] (-788.811) (-789.236) (-787.222) -- 0:00:19
      694500 -- (-787.682) [-786.969] (-789.592) (-788.889) * [-785.444] (-786.772) (-785.974) (-788.169) -- 0:00:19
      695000 -- (-787.409) (-788.779) (-791.415) [-791.195] * (-786.381) (-787.086) (-789.868) [-786.949] -- 0:00:19

      Average standard deviation of split frequencies: 0.013800

      695500 -- (-786.600) (-788.731) (-789.373) [-787.072] * (-786.098) (-788.126) [-786.296] (-786.289) -- 0:00:19
      696000 -- (-786.949) [-785.857] (-787.573) (-786.272) * (-786.493) (-787.381) [-793.529] (-788.518) -- 0:00:19
      696500 -- (-789.679) (-785.926) (-786.684) [-788.222] * (-787.966) [-787.138] (-786.365) (-789.007) -- 0:00:19
      697000 -- (-789.436) (-791.228) (-786.173) [-786.487] * [-788.247] (-785.621) (-786.666) (-789.688) -- 0:00:19
      697500 -- [-791.534] (-787.852) (-790.714) (-791.231) * (-791.667) [-786.325] (-786.763) (-788.061) -- 0:00:19
      698000 -- [-787.497] (-787.466) (-786.397) (-788.083) * (-788.923) (-789.208) (-790.530) [-787.260] -- 0:00:19
      698500 -- [-786.951] (-787.501) (-786.036) (-789.459) * (-789.806) [-789.651] (-787.112) (-786.094) -- 0:00:18
      699000 -- [-787.320] (-788.600) (-789.411) (-788.839) * (-788.196) (-788.061) [-788.017] (-786.606) -- 0:00:18
      699500 -- (-787.171) (-789.291) (-787.805) [-786.715] * [-789.045] (-787.625) (-787.393) (-794.436) -- 0:00:18
      700000 -- (-786.948) (-789.389) (-785.960) [-788.028] * (-787.874) (-785.927) [-786.964] (-801.246) -- 0:00:19

      Average standard deviation of split frequencies: 0.014089

      700500 -- (-790.360) (-787.099) (-787.995) [-786.166] * (-787.149) (-786.405) (-786.486) [-787.091] -- 0:00:19
      701000 -- [-786.845] (-786.945) (-789.907) (-787.713) * (-785.719) (-788.532) [-786.655] (-787.693) -- 0:00:19
      701500 -- [-788.238] (-786.241) (-788.245) (-786.435) * (-786.328) (-788.572) (-790.928) [-786.956] -- 0:00:19
      702000 -- (-787.478) (-789.244) [-786.486] (-787.810) * (-786.872) (-788.176) (-791.548) [-786.055] -- 0:00:19
      702500 -- (-789.820) [-787.763] (-787.525) (-787.615) * [-786.078] (-789.473) (-789.247) (-787.564) -- 0:00:19
      703000 -- (-785.638) [-789.204] (-785.444) (-787.898) * (-785.421) (-794.266) [-785.789] (-786.677) -- 0:00:19
      703500 -- (-787.609) (-785.828) [-788.160] (-791.154) * (-789.798) (-793.141) [-787.661] (-787.247) -- 0:00:18
      704000 -- [-785.380] (-787.859) (-789.825) (-788.474) * (-787.074) (-793.045) [-786.242] (-787.063) -- 0:00:18
      704500 -- (-785.871) (-787.738) [-789.703] (-787.667) * [-788.233] (-788.475) (-786.241) (-786.917) -- 0:00:18
      705000 -- (-790.467) (-788.879) (-789.997) [-789