--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:52:33 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1816/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1816/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1816/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1816/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2226.15         -2229.06
2      -2226.18         -2229.15
--------------------------------------
TOTAL    -2226.16         -2229.10
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1816/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1816/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1816/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.904051    0.091616    0.373925    1.519417    0.870934   1177.96   1279.50    1.000
r(A<->C){all}   0.161686    0.020183    0.000039    0.445597    0.122446    138.82    238.68    1.001
r(A<->G){all}   0.169561    0.019246    0.000094    0.442319    0.136447    271.35    286.51    1.002
r(A<->T){all}   0.170816    0.021467    0.000003    0.460502    0.130160    121.44    209.55    1.001
r(C<->G){all}   0.166905    0.019257    0.000022    0.447866    0.132978    179.91    197.96    1.001
r(C<->T){all}   0.157742    0.018108    0.000006    0.422324    0.122215    156.70    168.59    1.000
r(G<->T){all}   0.173290    0.021308    0.000093    0.461322    0.137400    190.42    218.79    1.000
pi(A){all}      0.197602    0.000097    0.179551    0.218316    0.197543   1266.95   1304.18    1.000
pi(C){all}      0.286266    0.000130    0.263869    0.308021    0.286150   1255.85   1281.84    1.000
pi(G){all}      0.323893    0.000135    0.301350    0.346821    0.323659   1382.65   1393.16    1.000
pi(T){all}      0.192240    0.000094    0.172711    0.211378    0.191948   1321.13   1344.06    1.000
alpha{1,2}      0.426718    0.234909    0.000182    1.425670    0.256335   1218.54   1333.24    1.000
alpha{3}        0.473875    0.249806    0.000254    1.491322    0.317788   1198.90   1235.09    1.000
pinvar{all}     0.999127    0.000001    0.997205    0.999999    0.999448   1029.47   1077.31    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2162.928146
Model 2: PositiveSelection	-2162.928215
Model 0: one-ratio	-2162.928305
Model 7: beta	-2162.927994
Model 8: beta&w>1	-2162.927994


Model 0 vs 1	3.1799999942450086E-4

Model 2 vs 1	1.3799999942420982E-4

Model 8 vs 7	0.0
>C1
VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
>C2
VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
>C3
VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
>C4
VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
>C5
VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
>C6
VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=545 

C1              VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
C2              VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
C3              VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
C4              VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
C5              VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
C6              VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
                **************************************************

C1              GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
C2              GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
C3              GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
C4              GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
C5              GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
C6              GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
                **************************************************

C1              KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
C2              KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
C3              KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
C4              KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
C5              KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
C6              KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
                **************************************************

C1              PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
C2              PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
C3              PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
C4              PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
C5              PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
C6              PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
                **************************************************

C1              HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
C2              HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
C3              HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
C4              HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
C5              HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
C6              HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
                **************************************************

C1              YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
C2              YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
C3              YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
C4              YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
C5              YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
C6              YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
                **************************************************

C1              QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
C2              QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
C3              QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
C4              QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
C5              QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
C6              QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
                **************************************************

C1              LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
C2              LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
C3              LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
C4              LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
C5              LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
C6              LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
                **************************************************

C1              LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
C2              LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
C3              LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
C4              LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
C5              LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
C6              LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
                **************************************************

C1              QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
C2              QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
C3              QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
C4              QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
C5              QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
C6              QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
                **************************************************

C1              YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
C2              YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
C3              YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
C4              YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
C5              YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
C6              YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
                *********************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  545 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  545 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16350]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [16350]--->[16350]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.572 Mb, Max= 31.152 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
C2              VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
C3              VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
C4              VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
C5              VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
C6              VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
                **************************************************

C1              GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
C2              GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
C3              GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
C4              GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
C5              GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
C6              GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
                **************************************************

C1              KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
C2              KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
C3              KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
C4              KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
C5              KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
C6              KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
                **************************************************

C1              PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
C2              PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
C3              PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
C4              PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
C5              PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
C6              PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
                **************************************************

C1              HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
C2              HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
C3              HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
C4              HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
C5              HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
C6              HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
                **************************************************

C1              YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
C2              YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
C3              YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
C4              YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
C5              YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
C6              YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
                **************************************************

C1              QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
C2              QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
C3              QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
C4              QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
C5              QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
C6              QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
                **************************************************

C1              LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
C2              LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
C3              LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
C4              LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
C5              LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
C6              LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
                **************************************************

C1              LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
C2              LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
C3              LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
C4              LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
C5              LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
C6              LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
                **************************************************

C1              QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
C2              QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
C3              QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
C4              QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
C5              QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
C6              QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
                **************************************************

C1              YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
C2              YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
C3              YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
C4              YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
C5              YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
C6              YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
                *********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGATCACGGCCACGGACCTTGAGGTCCGCGCTGGTGCGCGCATCTTGCT
C2              GTGATCACGGCCACGGACCTTGAGGTCCGCGCTGGTGCGCGCATCTTGCT
C3              GTGATCACGGCCACGGACCTTGAGGTCCGCGCTGGTGCGCGCATCTTGCT
C4              GTGATCACGGCCACGGACCTTGAGGTCCGCGCTGGTGCGCGCATCTTGCT
C5              GTGATCACGGCCACGGACCTTGAGGTCCGCGCTGGTGCGCGCATCTTGCT
C6              GTGATCACGGCCACGGACCTTGAGGTCCGCGCTGGTGCGCGCATCTTGCT
                **************************************************

C1              CTCATCCGACGGTCCGGACCTGCGCGTACAGCCCGGCGACCGCATTGGGC
C2              CTCATCCGACGGTCCGGACCTGCGCGTACAGCCCGGCGACCGCATTGGGC
C3              CTCATCCGACGGTCCGGACCTGCGCGTACAGCCCGGCGACCGCATTGGGC
C4              CTCATCCGACGGTCCGGACCTGCGCGTACAGCCCGGCGACCGCATTGGGC
C5              CTCATCCGACGGTCCGGACCTGCGCGTACAGCCCGGCGACCGCATTGGGC
C6              CTCATCCGACGGTCCGGACCTGCGCGTACAGCCCGGCGACCGCATTGGGC
                **************************************************

C1              TGGTTGGACGCAACGGCGCAGGCAAGACCACCACCTTGCGCATTTTGGCA
C2              TGGTTGGACGCAACGGCGCAGGCAAGACCACCACCTTGCGCATTTTGGCA
C3              TGGTTGGACGCAACGGCGCAGGCAAGACCACCACCTTGCGCATTTTGGCA
C4              TGGTTGGACGCAACGGCGCAGGCAAGACCACCACCTTGCGCATTTTGGCA
C5              TGGTTGGACGCAACGGCGCAGGCAAGACCACCACCTTGCGCATTTTGGCA
C6              TGGTTGGACGCAACGGCGCAGGCAAGACCACCACCTTGCGCATTTTGGCA
                **************************************************

C1              GGGGCAACTGAACCCTATGCCGGGTCAGTCACCTGGACCGGCGAGATTGG
C2              GGGGCAACTGAACCCTATGCCGGGTCAGTCACCTGGACCGGCGAGATTGG
C3              GGGGCAACTGAACCCTATGCCGGGTCAGTCACCTGGACCGGCGAGATTGG
C4              GGGGCAACTGAACCCTATGCCGGGTCAGTCACCTGGACCGGCGAGATTGG
C5              GGGGCAACTGAACCCTATGCCGGGTCAGTCACCTGGACCGGCGAGATTGG
C6              GGGGCAACTGAACCCTATGCCGGGTCAGTCACCTGGACCGGCGAGATTGG
                **************************************************

C1              TTACCTGCCACAAGATCCCAAAGTGGGCAATCTTGACGTGTTAGCCCGAG
C2              TTACCTGCCACAAGATCCCAAAGTGGGCAATCTTGACGTGTTAGCCCGAG
C3              TTACCTGCCACAAGATCCCAAAGTGGGCAATCTTGACGTGTTAGCCCGAG
C4              TTACCTGCCACAAGATCCCAAAGTGGGCAATCTTGACGTGTTAGCCCGAG
C5              TTACCTGCCACAAGATCCCAAAGTGGGCAATCTTGACGTGTTAGCCCGAG
C6              TTACCTGCCACAAGATCCCAAAGTGGGCAATCTTGACGTGTTAGCCCGAG
                **************************************************

C1              ACCGGGTGCTGTCCGCCCGCGGGTTGGACGTGCTGCTAACCGATCTAGAG
C2              ACCGGGTGCTGTCCGCCCGCGGGTTGGACGTGCTGCTAACCGATCTAGAG
C3              ACCGGGTGCTGTCCGCCCGCGGGTTGGACGTGCTGCTAACCGATCTAGAG
C4              ACCGGGTGCTGTCCGCCCGCGGGTTGGACGTGCTGCTAACCGATCTAGAG
C5              ACCGGGTGCTGTCCGCCCGCGGGTTGGACGTGCTGCTAACCGATCTAGAG
C6              ACCGGGTGCTGTCCGCCCGCGGGTTGGACGTGCTGCTAACCGATCTAGAG
                **************************************************

C1              AAGCAGCAGGCTTTGATGGCTGAGGTAGCCGACGACGATGCGCGTGACCG
C2              AAGCAGCAGGCTTTGATGGCTGAGGTAGCCGACGACGATGCGCGTGACCG
C3              AAGCAGCAGGCTTTGATGGCTGAGGTAGCCGACGACGATGCGCGTGACCG
C4              AAGCAGCAGGCTTTGATGGCTGAGGTAGCCGACGACGATGCGCGTGACCG
C5              AAGCAGCAGGCTTTGATGGCTGAGGTAGCCGACGACGATGCGCGTGACCG
C6              AAGCAGCAGGCTTTGATGGCTGAGGTAGCCGACGACGATGCGCGTGACCG
                **************************************************

C1              TGCGATCCGTCGCTACGGCCAGCTCGAGGAGCGATTCCTTGCGTTGGGGG
C2              TGCGATCCGTCGCTACGGCCAGCTCGAGGAGCGATTCCTTGCGTTGGGGG
C3              TGCGATCCGTCGCTACGGCCAGCTCGAGGAGCGATTCCTTGCGTTGGGGG
C4              TGCGATCCGTCGCTACGGCCAGCTCGAGGAGCGATTCCTTGCGTTGGGGG
C5              TGCGATCCGTCGCTACGGCCAGCTCGAGGAGCGATTCCTTGCGTTGGGGG
C6              TGCGATCCGTCGCTACGGCCAGCTCGAGGAGCGATTCCTTGCGTTGGGGG
                **************************************************

C1              GTTACAGCGCCGAAAGCGAAGCTGGCAGGATATGCGCGAGTCTAGGTCTG
C2              GTTACAGCGCCGAAAGCGAAGCTGGCAGGATATGCGCGAGTCTAGGTCTG
C3              GTTACAGCGCCGAAAGCGAAGCTGGCAGGATATGCGCGAGTCTAGGTCTG
C4              GTTACAGCGCCGAAAGCGAAGCTGGCAGGATATGCGCGAGTCTAGGTCTG
C5              GTTACAGCGCCGAAAGCGAAGCTGGCAGGATATGCGCGAGTCTAGGTCTG
C6              GTTACAGCGCCGAAAGCGAAGCTGGCAGGATATGCGCGAGTCTAGGTCTG
                **************************************************

C1              CCTGAAAGGGTGCTGGTCCAGCAGTTGTGCACCTTGTCGGGAGGTCAGCG
C2              CCTGAAAGGGTGCTGGTCCAGCAGTTGTGCACCTTGTCGGGAGGTCAGCG
C3              CCTGAAAGGGTGCTGGTCCAGCAGTTGTGCACCTTGTCGGGAGGTCAGCG
C4              CCTGAAAGGGTGCTGGTCCAGCAGTTGTGCACCTTGTCGGGAGGTCAGCG
C5              CCTGAAAGGGTGCTGGTCCAGCAGTTGTGCACCTTGTCGGGAGGTCAGCG
C6              CCTGAAAGGGTGCTGGTCCAGCAGTTGTGCACCTTGTCGGGAGGTCAGCG
                **************************************************

C1              CCGTAGGGTAGAGCTGGCGCGTATTCTGTTCGCGGCATCCAGAGCAGGAA
C2              CCGTAGGGTAGAGCTGGCGCGTATTCTGTTCGCGGCATCCAGAGCAGGAA
C3              CCGTAGGGTAGAGCTGGCGCGTATTCTGTTCGCGGCATCCAGAGCAGGAA
C4              CCGTAGGGTAGAGCTGGCGCGTATTCTGTTCGCGGCATCCAGAGCAGGAA
C5              CCGTAGGGTAGAGCTGGCGCGTATTCTGTTCGCGGCATCCAGAGCAGGAA
C6              CCGTAGGGTAGAGCTGGCGCGTATTCTGTTCGCGGCATCCAGAGCAGGAA
                **************************************************

C1              CTGGTGCTTCCGGTTCGGGAACCACGCTGTTGCTCGATGAGCCGACCAAC
C2              CTGGTGCTTCCGGTTCGGGAACCACGCTGTTGCTCGATGAGCCGACCAAC
C3              CTGGTGCTTCCGGTTCGGGAACCACGCTGTTGCTCGATGAGCCGACCAAC
C4              CTGGTGCTTCCGGTTCGGGAACCACGCTGTTGCTCGATGAGCCGACCAAC
C5              CTGGTGCTTCCGGTTCGGGAACCACGCTGTTGCTCGATGAGCCGACCAAC
C6              CTGGTGCTTCCGGTTCGGGAACCACGCTGTTGCTCGATGAGCCGACCAAC
                **************************************************

C1              CACCTCGATGCCGATTCGCTTGGGTGGCTGCGGGATTTCTTGCGGTCGCA
C2              CACCTCGATGCCGATTCGCTTGGGTGGCTGCGGGATTTCTTGCGGTCGCA
C3              CACCTCGATGCCGATTCGCTTGGGTGGCTGCGGGATTTCTTGCGGTCGCA
C4              CACCTCGATGCCGATTCGCTTGGGTGGCTGCGGGATTTCTTGCGGTCGCA
C5              CACCTCGATGCCGATTCGCTTGGGTGGCTGCGGGATTTCTTGCGGTCGCA
C6              CACCTCGATGCCGATTCGCTTGGGTGGCTGCGGGATTTCTTGCGGTCGCA
                **************************************************

C1              CACTGGTGGACTGGTAGTGATCAGCCATAACGTCGAGTTGATCGCCGCTG
C2              CACTGGTGGACTGGTAGTGATCAGCCATAACGTCGAGTTGATCGCCGCTG
C3              CACTGGTGGACTGGTAGTGATCAGCCATAACGTCGAGTTGATCGCCGCTG
C4              CACTGGTGGACTGGTAGTGATCAGCCATAACGTCGAGTTGATCGCCGCTG
C5              CACTGGTGGACTGGTAGTGATCAGCCATAACGTCGAGTTGATCGCCGCTG
C6              CACTGGTGGACTGGTAGTGATCAGCCATAACGTCGAGTTGATCGCCGCTG
                **************************************************

C1              TCGTCAACCGGGTGTGGTTCCTGGATGCCGTGCTCGGCAAGGTCGATGTC
C2              TCGTCAACCGGGTGTGGTTCCTGGATGCCGTGCTCGGCAAGGTCGATGTC
C3              TCGTCAACCGGGTGTGGTTCCTGGATGCCGTGCTCGGCAAGGTCGATGTC
C4              TCGTCAACCGGGTGTGGTTCCTGGATGCCGTGCTCGGCAAGGTCGATGTC
C5              TCGTCAACCGGGTGTGGTTCCTGGATGCCGTGCTCGGCAAGGTCGATGTC
C6              TCGTCAACCGGGTGTGGTTCCTGGATGCCGTGCTCGGCAAGGTCGATGTC
                **************************************************

C1              TACAACATGGGCTGGTACAAGTACCTCGACTCCCGGGCCACCGACGAGCA
C2              TACAACATGGGCTGGTACAAGTACCTCGACTCCCGGGCCACCGACGAGCA
C3              TACAACATGGGCTGGTACAAGTACCTCGACTCCCGGGCCACCGACGAGCA
C4              TACAACATGGGCTGGTACAAGTACCTCGACTCCCGGGCCACCGACGAGCA
C5              TACAACATGGGCTGGTACAAGTACCTCGACTCCCGGGCCACCGACGAGCA
C6              TACAACATGGGCTGGTACAAGTACCTCGACTCCCGGGCCACCGACGAGCA
                **************************************************

C1              GCGCCGCCGCCGAGAACGCGTCAACGCTGAACGCAAGGCCACTGCGTTGC
C2              GCGCCGCCGCCGAGAACGCGTCAACGCTGAACGCAAGGCCACTGCGTTGC
C3              GCGCCGCCGCCGAGAACGCGTCAACGCTGAACGCAAGGCCACTGCGTTGC
C4              GCGCCGCCGCCGAGAACGCGTCAACGCTGAACGCAAGGCCACTGCGTTGC
C5              GCGCCGCCGCCGAGAACGCGTCAACGCTGAACGCAAGGCCACTGCGTTGC
C6              GCGCCGCCGCCGAGAACGCGTCAACGCTGAACGCAAGGCCACTGCGTTGC
                **************************************************

C1              GAACACAAGCTGCCAAGATGGGTGCTAAGGCAACCAAAGCGGTTGCGGCT
C2              GAACACAAGCTGCCAAGATGGGTGCTAAGGCAACCAAAGCGGTTGCGGCT
C3              GAACACAAGCTGCCAAGATGGGTGCTAAGGCAACCAAAGCGGTTGCGGCT
C4              GAACACAAGCTGCCAAGATGGGTGCTAAGGCAACCAAAGCGGTTGCGGCT
C5              GAACACAAGCTGCCAAGATGGGTGCTAAGGCAACCAAAGCGGTTGCGGCT
C6              GAACACAAGCTGCCAAGATGGGTGCTAAGGCAACCAAAGCGGTTGCGGCT
                **************************************************

C1              CAAAATATGTTGCGTCGAGCCGATCGGATGATGGCAGCACTTGACGAGGA
C2              CAAAATATGTTGCGTCGAGCCGATCGGATGATGGCAGCACTTGACGAGGA
C3              CAAAATATGTTGCGTCGAGCCGATCGGATGATGGCAGCACTTGACGAGGA
C4              CAAAATATGTTGCGTCGAGCCGATCGGATGATGGCAGCACTTGACGAGGA
C5              CAAAATATGTTGCGTCGAGCCGATCGGATGATGGCAGCACTTGACGAGGA
C6              CAAAATATGTTGCGTCGAGCCGATCGGATGATGGCAGCACTTGACGAGGA
                **************************************************

C1              ACGGGTCATCGAAAAAGTGGCCCAGATCAAGTTTCCTACACCAGCGGCGT
C2              ACGGGTCATCGAAAAAGTGGCCCAGATCAAGTTTCCTACACCAGCGGCGT
C3              ACGGGTCATCGAAAAAGTGGCCCAGATCAAGTTTCCTACACCAGCGGCGT
C4              ACGGGTCATCGAAAAAGTGGCCCAGATCAAGTTTCCTACACCAGCGGCGT
C5              ACGGGTCATCGAAAAAGTGGCCCAGATCAAGTTTCCTACACCAGCGGCGT
C6              ACGGGTCATCGAAAAAGTGGCCCAGATCAAGTTTCCTACACCAGCGGCGT
                **************************************************

C1              GCGGGCGCACGCCGCTGGTGGCCAAGGGACTCAGCAAGACGTACGGGTCC
C2              GCGGGCGCACGCCGCTGGTGGCCAAGGGACTCAGCAAGACGTACGGGTCC
C3              GCGGGCGCACGCCGCTGGTGGCCAAGGGACTCAGCAAGACGTACGGGTCC
C4              GCGGGCGCACGCCGCTGGTGGCCAAGGGACTCAGCAAGACGTACGGGTCC
C5              GCGGGCGCACGCCGCTGGTGGCCAAGGGACTCAGCAAGACGTACGGGTCC
C6              GCGGGCGCACGCCGCTGGTGGCCAAGGGACTCAGCAAGACGTACGGGTCC
                **************************************************

C1              CTTGAAGTGTTCACTGGTGTGAATCTGGCTATTGACCGTGGCTCGCGAGT
C2              CTTGAAGTGTTCACTGGTGTGAATCTGGCTATTGACCGTGGCTCGCGAGT
C3              CTTGAAGTGTTCACTGGTGTGAATCTGGCTATTGACCGTGGCTCGCGAGT
C4              CTTGAAGTGTTCACTGGTGTGAATCTGGCTATTGACCGTGGCTCGCGAGT
C5              CTTGAAGTGTTCACTGGTGTGAATCTGGCTATTGACCGTGGCTCGCGAGT
C6              CTTGAAGTGTTCACTGGTGTGAATCTGGCTATTGACCGTGGCTCGCGAGT
                **************************************************

C1              GGTCGTACTGGGCCTCAACGGCGCCGGCAAGACCACGCTGTTGCGAGTGC
C2              GGTCGTACTGGGCCTCAACGGCGCCGGCAAGACCACGCTGTTGCGAGTGC
C3              GGTCGTACTGGGCCTCAACGGCGCCGGCAAGACCACGCTGTTGCGAGTGC
C4              GGTCGTACTGGGCCTCAACGGCGCCGGCAAGACCACGCTGTTGCGAGTGC
C5              GGTCGTACTGGGCCTCAACGGCGCCGGCAAGACCACGCTGTTGCGAGTGC
C6              GGTCGTACTGGGCCTCAACGGCGCCGGCAAGACCACGCTGTTGCGAGTGC
                **************************************************

C1              TGGCCGGAGCTGAGAAGCCCGACGTCGGCAGGCTGGAACCTGGACACGGT
C2              TGGCCGGAGCTGAGAAGCCCGACGTCGGCAGGCTGGAACCTGGACACGGT
C3              TGGCCGGAGCTGAGAAGCCCGACGTCGGCAGGCTGGAACCTGGACACGGT
C4              TGGCCGGAGCTGAGAAGCCCGACGTCGGCAGGCTGGAACCTGGACACGGT
C5              TGGCCGGAGCTGAGAAGCCCGACGTCGGCAGGCTGGAACCTGGACACGGT
C6              TGGCCGGAGCTGAGAAGCCCGACGTCGGCAGGCTGGAACCTGGACACGGT
                **************************************************

C1              TTGCGGATCGGCTATTTCGCCCAGGAACACGACACGCTCGATAACGAAGA
C2              TTGCGGATCGGCTATTTCGCCCAGGAACACGACACGCTCGATAACGAAGA
C3              TTGCGGATCGGCTATTTCGCCCAGGAACACGACACGCTCGATAACGAAGA
C4              TTGCGGATCGGCTATTTCGCCCAGGAACACGACACGCTCGATAACGAAGA
C5              TTGCGGATCGGCTATTTCGCCCAGGAACACGACACGCTCGATAACGAAGA
C6              TTGCGGATCGGCTATTTCGCCCAGGAACACGACACGCTCGATAACGAAGA
                **************************************************

C1              CACCGTCTGGCAGAACATTCGGCACACCGCACCCGAGTTCGGTGAACAGG
C2              CACCGTCTGGCAGAACATTCGGCACACCGCACCCGAGTTCGGTGAACAGG
C3              CACCGTCTGGCAGAACATTCGGCACACCGCACCCGAGTTCGGTGAACAGG
C4              CACCGTCTGGCAGAACATTCGGCACACCGCACCCGAGTTCGGTGAACAGG
C5              CACCGTCTGGCAGAACATTCGGCACACCGCACCCGAGTTCGGTGAACAGG
C6              CACCGTCTGGCAGAACATTCGGCACACCGCACCCGAGTTCGGTGAACAGG
                **************************************************

C1              ATTTACGCGGACTGCTCGGCGCGTTCATGTTCAGCGGCCCACAGCTCGAC
C2              ATTTACGCGGACTGCTCGGCGCGTTCATGTTCAGCGGCCCACAGCTCGAC
C3              ATTTACGCGGACTGCTCGGCGCGTTCATGTTCAGCGGCCCACAGCTCGAC
C4              ATTTACGCGGACTGCTCGGCGCGTTCATGTTCAGCGGCCCACAGCTCGAC
C5              ATTTACGCGGACTGCTCGGCGCGTTCATGTTCAGCGGCCCACAGCTCGAC
C6              ATTTACGCGGACTGCTCGGCGCGTTCATGTTCAGCGGCCCACAGCTCGAC
                **************************************************

C1              CAACTGGCTGGCACCCTTTCCGGTGGTGAGAAGACCCGACTCGCACTCGC
C2              CAACTGGCTGGCACCCTTTCCGGTGGTGAGAAGACCCGACTCGCACTCGC
C3              CAACTGGCTGGCACCCTTTCCGGTGGTGAGAAGACCCGACTCGCACTCGC
C4              CAACTGGCTGGCACCCTTTCCGGTGGTGAGAAGACCCGACTCGCACTCGC
C5              CAACTGGCTGGCACCCTTTCCGGTGGTGAGAAGACCCGACTCGCACTCGC
C6              CAACTGGCTGGCACCCTTTCCGGTGGTGAGAAGACCCGACTCGCACTCGC
                **************************************************

C1              AGGCCTGGTAGCGTCCACGGCTAACGTGCTACTACTCGATGAACCGACCA
C2              AGGCCTGGTAGCGTCCACGGCTAACGTGCTACTACTCGATGAACCGACCA
C3              AGGCCTGGTAGCGTCCACGGCTAACGTGCTACTACTCGATGAACCGACCA
C4              AGGCCTGGTAGCGTCCACGGCTAACGTGCTACTACTCGATGAACCGACCA
C5              AGGCCTGGTAGCGTCCACGGCTAACGTGCTACTACTCGATGAACCGACCA
C6              AGGCCTGGTAGCGTCCACGGCTAACGTGCTACTACTCGATGAACCGACCA
                **************************************************

C1              ACAATCTCGATCCCGCGTCGCGCAAGCAGGTGCTCGACGCGTTGCGTAAT
C2              ACAATCTCGATCCCGCGTCGCGCAAGCAGGTGCTCGACGCGTTGCGTAAT
C3              ACAATCTCGATCCCGCGTCGCGCAAGCAGGTGCTCGACGCGTTGCGTAAT
C4              ACAATCTCGATCCCGCGTCGCGCAAGCAGGTGCTCGACGCGTTGCGTAAT
C5              ACAATCTCGATCCCGCGTCGCGCAAGCAGGTGCTCGACGCGTTGCGTAAT
C6              ACAATCTCGATCCCGCGTCGCGCAAGCAGGTGCTCGACGCGTTGCGTAAT
                **************************************************

C1              TATCAGGGTGCAGTGGTATTGGTGACGCACGATCCCGGAGCGGCAAAAGC
C2              TATCAGGGTGCAGTGGTATTGGTGACGCACGATCCCGGAGCGGCAAAAGC
C3              TATCAGGGTGCAGTGGTATTGGTGACGCACGATCCCGGAGCGGCAAAAGC
C4              TATCAGGGTGCAGTGGTATTGGTGACGCACGATCCCGGAGCGGCAAAAGC
C5              TATCAGGGTGCAGTGGTATTGGTGACGCACGATCCCGGAGCGGCAAAAGC
C6              TATCAGGGTGCAGTGGTATTGGTGACGCACGATCCCGGAGCGGCAAAAGC
                **************************************************

C1              GCTGGATCCGCAACGCGTCGTGTTGTTGCCTGACGGCACTGAGGACTATT
C2              GCTGGATCCGCAACGCGTCGTGTTGTTGCCTGACGGCACTGAGGACTATT
C3              GCTGGATCCGCAACGCGTCGTGTTGTTGCCTGACGGCACTGAGGACTATT
C4              GCTGGATCCGCAACGCGTCGTGTTGTTGCCTGACGGCACTGAGGACTATT
C5              GCTGGATCCGCAACGCGTCGTGTTGTTGCCTGACGGCACTGAGGACTATT
C6              GCTGGATCCGCAACGCGTCGTGTTGTTGCCTGACGGCACTGAGGACTATT
                **************************************************

C1              GGTCCGACGAATATCGGGATCTCATTGAGTTGGCC
C2              GGTCCGACGAATATCGGGATCTCATTGAGTTGGCC
C3              GGTCCGACGAATATCGGGATCTCATTGAGTTGGCC
C4              GGTCCGACGAATATCGGGATCTCATTGAGTTGGCC
C5              GGTCCGACGAATATCGGGATCTCATTGAGTTGGCC
C6              GGTCCGACGAATATCGGGATCTCATTGAGTTGGCC
                ***********************************



>C1
GTGATCACGGCCACGGACCTTGAGGTCCGCGCTGGTGCGCGCATCTTGCT
CTCATCCGACGGTCCGGACCTGCGCGTACAGCCCGGCGACCGCATTGGGC
TGGTTGGACGCAACGGCGCAGGCAAGACCACCACCTTGCGCATTTTGGCA
GGGGCAACTGAACCCTATGCCGGGTCAGTCACCTGGACCGGCGAGATTGG
TTACCTGCCACAAGATCCCAAAGTGGGCAATCTTGACGTGTTAGCCCGAG
ACCGGGTGCTGTCCGCCCGCGGGTTGGACGTGCTGCTAACCGATCTAGAG
AAGCAGCAGGCTTTGATGGCTGAGGTAGCCGACGACGATGCGCGTGACCG
TGCGATCCGTCGCTACGGCCAGCTCGAGGAGCGATTCCTTGCGTTGGGGG
GTTACAGCGCCGAAAGCGAAGCTGGCAGGATATGCGCGAGTCTAGGTCTG
CCTGAAAGGGTGCTGGTCCAGCAGTTGTGCACCTTGTCGGGAGGTCAGCG
CCGTAGGGTAGAGCTGGCGCGTATTCTGTTCGCGGCATCCAGAGCAGGAA
CTGGTGCTTCCGGTTCGGGAACCACGCTGTTGCTCGATGAGCCGACCAAC
CACCTCGATGCCGATTCGCTTGGGTGGCTGCGGGATTTCTTGCGGTCGCA
CACTGGTGGACTGGTAGTGATCAGCCATAACGTCGAGTTGATCGCCGCTG
TCGTCAACCGGGTGTGGTTCCTGGATGCCGTGCTCGGCAAGGTCGATGTC
TACAACATGGGCTGGTACAAGTACCTCGACTCCCGGGCCACCGACGAGCA
GCGCCGCCGCCGAGAACGCGTCAACGCTGAACGCAAGGCCACTGCGTTGC
GAACACAAGCTGCCAAGATGGGTGCTAAGGCAACCAAAGCGGTTGCGGCT
CAAAATATGTTGCGTCGAGCCGATCGGATGATGGCAGCACTTGACGAGGA
ACGGGTCATCGAAAAAGTGGCCCAGATCAAGTTTCCTACACCAGCGGCGT
GCGGGCGCACGCCGCTGGTGGCCAAGGGACTCAGCAAGACGTACGGGTCC
CTTGAAGTGTTCACTGGTGTGAATCTGGCTATTGACCGTGGCTCGCGAGT
GGTCGTACTGGGCCTCAACGGCGCCGGCAAGACCACGCTGTTGCGAGTGC
TGGCCGGAGCTGAGAAGCCCGACGTCGGCAGGCTGGAACCTGGACACGGT
TTGCGGATCGGCTATTTCGCCCAGGAACACGACACGCTCGATAACGAAGA
CACCGTCTGGCAGAACATTCGGCACACCGCACCCGAGTTCGGTGAACAGG
ATTTACGCGGACTGCTCGGCGCGTTCATGTTCAGCGGCCCACAGCTCGAC
CAACTGGCTGGCACCCTTTCCGGTGGTGAGAAGACCCGACTCGCACTCGC
AGGCCTGGTAGCGTCCACGGCTAACGTGCTACTACTCGATGAACCGACCA
ACAATCTCGATCCCGCGTCGCGCAAGCAGGTGCTCGACGCGTTGCGTAAT
TATCAGGGTGCAGTGGTATTGGTGACGCACGATCCCGGAGCGGCAAAAGC
GCTGGATCCGCAACGCGTCGTGTTGTTGCCTGACGGCACTGAGGACTATT
GGTCCGACGAATATCGGGATCTCATTGAGTTGGCC
>C2
GTGATCACGGCCACGGACCTTGAGGTCCGCGCTGGTGCGCGCATCTTGCT
CTCATCCGACGGTCCGGACCTGCGCGTACAGCCCGGCGACCGCATTGGGC
TGGTTGGACGCAACGGCGCAGGCAAGACCACCACCTTGCGCATTTTGGCA
GGGGCAACTGAACCCTATGCCGGGTCAGTCACCTGGACCGGCGAGATTGG
TTACCTGCCACAAGATCCCAAAGTGGGCAATCTTGACGTGTTAGCCCGAG
ACCGGGTGCTGTCCGCCCGCGGGTTGGACGTGCTGCTAACCGATCTAGAG
AAGCAGCAGGCTTTGATGGCTGAGGTAGCCGACGACGATGCGCGTGACCG
TGCGATCCGTCGCTACGGCCAGCTCGAGGAGCGATTCCTTGCGTTGGGGG
GTTACAGCGCCGAAAGCGAAGCTGGCAGGATATGCGCGAGTCTAGGTCTG
CCTGAAAGGGTGCTGGTCCAGCAGTTGTGCACCTTGTCGGGAGGTCAGCG
CCGTAGGGTAGAGCTGGCGCGTATTCTGTTCGCGGCATCCAGAGCAGGAA
CTGGTGCTTCCGGTTCGGGAACCACGCTGTTGCTCGATGAGCCGACCAAC
CACCTCGATGCCGATTCGCTTGGGTGGCTGCGGGATTTCTTGCGGTCGCA
CACTGGTGGACTGGTAGTGATCAGCCATAACGTCGAGTTGATCGCCGCTG
TCGTCAACCGGGTGTGGTTCCTGGATGCCGTGCTCGGCAAGGTCGATGTC
TACAACATGGGCTGGTACAAGTACCTCGACTCCCGGGCCACCGACGAGCA
GCGCCGCCGCCGAGAACGCGTCAACGCTGAACGCAAGGCCACTGCGTTGC
GAACACAAGCTGCCAAGATGGGTGCTAAGGCAACCAAAGCGGTTGCGGCT
CAAAATATGTTGCGTCGAGCCGATCGGATGATGGCAGCACTTGACGAGGA
ACGGGTCATCGAAAAAGTGGCCCAGATCAAGTTTCCTACACCAGCGGCGT
GCGGGCGCACGCCGCTGGTGGCCAAGGGACTCAGCAAGACGTACGGGTCC
CTTGAAGTGTTCACTGGTGTGAATCTGGCTATTGACCGTGGCTCGCGAGT
GGTCGTACTGGGCCTCAACGGCGCCGGCAAGACCACGCTGTTGCGAGTGC
TGGCCGGAGCTGAGAAGCCCGACGTCGGCAGGCTGGAACCTGGACACGGT
TTGCGGATCGGCTATTTCGCCCAGGAACACGACACGCTCGATAACGAAGA
CACCGTCTGGCAGAACATTCGGCACACCGCACCCGAGTTCGGTGAACAGG
ATTTACGCGGACTGCTCGGCGCGTTCATGTTCAGCGGCCCACAGCTCGAC
CAACTGGCTGGCACCCTTTCCGGTGGTGAGAAGACCCGACTCGCACTCGC
AGGCCTGGTAGCGTCCACGGCTAACGTGCTACTACTCGATGAACCGACCA
ACAATCTCGATCCCGCGTCGCGCAAGCAGGTGCTCGACGCGTTGCGTAAT
TATCAGGGTGCAGTGGTATTGGTGACGCACGATCCCGGAGCGGCAAAAGC
GCTGGATCCGCAACGCGTCGTGTTGTTGCCTGACGGCACTGAGGACTATT
GGTCCGACGAATATCGGGATCTCATTGAGTTGGCC
>C3
GTGATCACGGCCACGGACCTTGAGGTCCGCGCTGGTGCGCGCATCTTGCT
CTCATCCGACGGTCCGGACCTGCGCGTACAGCCCGGCGACCGCATTGGGC
TGGTTGGACGCAACGGCGCAGGCAAGACCACCACCTTGCGCATTTTGGCA
GGGGCAACTGAACCCTATGCCGGGTCAGTCACCTGGACCGGCGAGATTGG
TTACCTGCCACAAGATCCCAAAGTGGGCAATCTTGACGTGTTAGCCCGAG
ACCGGGTGCTGTCCGCCCGCGGGTTGGACGTGCTGCTAACCGATCTAGAG
AAGCAGCAGGCTTTGATGGCTGAGGTAGCCGACGACGATGCGCGTGACCG
TGCGATCCGTCGCTACGGCCAGCTCGAGGAGCGATTCCTTGCGTTGGGGG
GTTACAGCGCCGAAAGCGAAGCTGGCAGGATATGCGCGAGTCTAGGTCTG
CCTGAAAGGGTGCTGGTCCAGCAGTTGTGCACCTTGTCGGGAGGTCAGCG
CCGTAGGGTAGAGCTGGCGCGTATTCTGTTCGCGGCATCCAGAGCAGGAA
CTGGTGCTTCCGGTTCGGGAACCACGCTGTTGCTCGATGAGCCGACCAAC
CACCTCGATGCCGATTCGCTTGGGTGGCTGCGGGATTTCTTGCGGTCGCA
CACTGGTGGACTGGTAGTGATCAGCCATAACGTCGAGTTGATCGCCGCTG
TCGTCAACCGGGTGTGGTTCCTGGATGCCGTGCTCGGCAAGGTCGATGTC
TACAACATGGGCTGGTACAAGTACCTCGACTCCCGGGCCACCGACGAGCA
GCGCCGCCGCCGAGAACGCGTCAACGCTGAACGCAAGGCCACTGCGTTGC
GAACACAAGCTGCCAAGATGGGTGCTAAGGCAACCAAAGCGGTTGCGGCT
CAAAATATGTTGCGTCGAGCCGATCGGATGATGGCAGCACTTGACGAGGA
ACGGGTCATCGAAAAAGTGGCCCAGATCAAGTTTCCTACACCAGCGGCGT
GCGGGCGCACGCCGCTGGTGGCCAAGGGACTCAGCAAGACGTACGGGTCC
CTTGAAGTGTTCACTGGTGTGAATCTGGCTATTGACCGTGGCTCGCGAGT
GGTCGTACTGGGCCTCAACGGCGCCGGCAAGACCACGCTGTTGCGAGTGC
TGGCCGGAGCTGAGAAGCCCGACGTCGGCAGGCTGGAACCTGGACACGGT
TTGCGGATCGGCTATTTCGCCCAGGAACACGACACGCTCGATAACGAAGA
CACCGTCTGGCAGAACATTCGGCACACCGCACCCGAGTTCGGTGAACAGG
ATTTACGCGGACTGCTCGGCGCGTTCATGTTCAGCGGCCCACAGCTCGAC
CAACTGGCTGGCACCCTTTCCGGTGGTGAGAAGACCCGACTCGCACTCGC
AGGCCTGGTAGCGTCCACGGCTAACGTGCTACTACTCGATGAACCGACCA
ACAATCTCGATCCCGCGTCGCGCAAGCAGGTGCTCGACGCGTTGCGTAAT
TATCAGGGTGCAGTGGTATTGGTGACGCACGATCCCGGAGCGGCAAAAGC
GCTGGATCCGCAACGCGTCGTGTTGTTGCCTGACGGCACTGAGGACTATT
GGTCCGACGAATATCGGGATCTCATTGAGTTGGCC
>C4
GTGATCACGGCCACGGACCTTGAGGTCCGCGCTGGTGCGCGCATCTTGCT
CTCATCCGACGGTCCGGACCTGCGCGTACAGCCCGGCGACCGCATTGGGC
TGGTTGGACGCAACGGCGCAGGCAAGACCACCACCTTGCGCATTTTGGCA
GGGGCAACTGAACCCTATGCCGGGTCAGTCACCTGGACCGGCGAGATTGG
TTACCTGCCACAAGATCCCAAAGTGGGCAATCTTGACGTGTTAGCCCGAG
ACCGGGTGCTGTCCGCCCGCGGGTTGGACGTGCTGCTAACCGATCTAGAG
AAGCAGCAGGCTTTGATGGCTGAGGTAGCCGACGACGATGCGCGTGACCG
TGCGATCCGTCGCTACGGCCAGCTCGAGGAGCGATTCCTTGCGTTGGGGG
GTTACAGCGCCGAAAGCGAAGCTGGCAGGATATGCGCGAGTCTAGGTCTG
CCTGAAAGGGTGCTGGTCCAGCAGTTGTGCACCTTGTCGGGAGGTCAGCG
CCGTAGGGTAGAGCTGGCGCGTATTCTGTTCGCGGCATCCAGAGCAGGAA
CTGGTGCTTCCGGTTCGGGAACCACGCTGTTGCTCGATGAGCCGACCAAC
CACCTCGATGCCGATTCGCTTGGGTGGCTGCGGGATTTCTTGCGGTCGCA
CACTGGTGGACTGGTAGTGATCAGCCATAACGTCGAGTTGATCGCCGCTG
TCGTCAACCGGGTGTGGTTCCTGGATGCCGTGCTCGGCAAGGTCGATGTC
TACAACATGGGCTGGTACAAGTACCTCGACTCCCGGGCCACCGACGAGCA
GCGCCGCCGCCGAGAACGCGTCAACGCTGAACGCAAGGCCACTGCGTTGC
GAACACAAGCTGCCAAGATGGGTGCTAAGGCAACCAAAGCGGTTGCGGCT
CAAAATATGTTGCGTCGAGCCGATCGGATGATGGCAGCACTTGACGAGGA
ACGGGTCATCGAAAAAGTGGCCCAGATCAAGTTTCCTACACCAGCGGCGT
GCGGGCGCACGCCGCTGGTGGCCAAGGGACTCAGCAAGACGTACGGGTCC
CTTGAAGTGTTCACTGGTGTGAATCTGGCTATTGACCGTGGCTCGCGAGT
GGTCGTACTGGGCCTCAACGGCGCCGGCAAGACCACGCTGTTGCGAGTGC
TGGCCGGAGCTGAGAAGCCCGACGTCGGCAGGCTGGAACCTGGACACGGT
TTGCGGATCGGCTATTTCGCCCAGGAACACGACACGCTCGATAACGAAGA
CACCGTCTGGCAGAACATTCGGCACACCGCACCCGAGTTCGGTGAACAGG
ATTTACGCGGACTGCTCGGCGCGTTCATGTTCAGCGGCCCACAGCTCGAC
CAACTGGCTGGCACCCTTTCCGGTGGTGAGAAGACCCGACTCGCACTCGC
AGGCCTGGTAGCGTCCACGGCTAACGTGCTACTACTCGATGAACCGACCA
ACAATCTCGATCCCGCGTCGCGCAAGCAGGTGCTCGACGCGTTGCGTAAT
TATCAGGGTGCAGTGGTATTGGTGACGCACGATCCCGGAGCGGCAAAAGC
GCTGGATCCGCAACGCGTCGTGTTGTTGCCTGACGGCACTGAGGACTATT
GGTCCGACGAATATCGGGATCTCATTGAGTTGGCC
>C5
GTGATCACGGCCACGGACCTTGAGGTCCGCGCTGGTGCGCGCATCTTGCT
CTCATCCGACGGTCCGGACCTGCGCGTACAGCCCGGCGACCGCATTGGGC
TGGTTGGACGCAACGGCGCAGGCAAGACCACCACCTTGCGCATTTTGGCA
GGGGCAACTGAACCCTATGCCGGGTCAGTCACCTGGACCGGCGAGATTGG
TTACCTGCCACAAGATCCCAAAGTGGGCAATCTTGACGTGTTAGCCCGAG
ACCGGGTGCTGTCCGCCCGCGGGTTGGACGTGCTGCTAACCGATCTAGAG
AAGCAGCAGGCTTTGATGGCTGAGGTAGCCGACGACGATGCGCGTGACCG
TGCGATCCGTCGCTACGGCCAGCTCGAGGAGCGATTCCTTGCGTTGGGGG
GTTACAGCGCCGAAAGCGAAGCTGGCAGGATATGCGCGAGTCTAGGTCTG
CCTGAAAGGGTGCTGGTCCAGCAGTTGTGCACCTTGTCGGGAGGTCAGCG
CCGTAGGGTAGAGCTGGCGCGTATTCTGTTCGCGGCATCCAGAGCAGGAA
CTGGTGCTTCCGGTTCGGGAACCACGCTGTTGCTCGATGAGCCGACCAAC
CACCTCGATGCCGATTCGCTTGGGTGGCTGCGGGATTTCTTGCGGTCGCA
CACTGGTGGACTGGTAGTGATCAGCCATAACGTCGAGTTGATCGCCGCTG
TCGTCAACCGGGTGTGGTTCCTGGATGCCGTGCTCGGCAAGGTCGATGTC
TACAACATGGGCTGGTACAAGTACCTCGACTCCCGGGCCACCGACGAGCA
GCGCCGCCGCCGAGAACGCGTCAACGCTGAACGCAAGGCCACTGCGTTGC
GAACACAAGCTGCCAAGATGGGTGCTAAGGCAACCAAAGCGGTTGCGGCT
CAAAATATGTTGCGTCGAGCCGATCGGATGATGGCAGCACTTGACGAGGA
ACGGGTCATCGAAAAAGTGGCCCAGATCAAGTTTCCTACACCAGCGGCGT
GCGGGCGCACGCCGCTGGTGGCCAAGGGACTCAGCAAGACGTACGGGTCC
CTTGAAGTGTTCACTGGTGTGAATCTGGCTATTGACCGTGGCTCGCGAGT
GGTCGTACTGGGCCTCAACGGCGCCGGCAAGACCACGCTGTTGCGAGTGC
TGGCCGGAGCTGAGAAGCCCGACGTCGGCAGGCTGGAACCTGGACACGGT
TTGCGGATCGGCTATTTCGCCCAGGAACACGACACGCTCGATAACGAAGA
CACCGTCTGGCAGAACATTCGGCACACCGCACCCGAGTTCGGTGAACAGG
ATTTACGCGGACTGCTCGGCGCGTTCATGTTCAGCGGCCCACAGCTCGAC
CAACTGGCTGGCACCCTTTCCGGTGGTGAGAAGACCCGACTCGCACTCGC
AGGCCTGGTAGCGTCCACGGCTAACGTGCTACTACTCGATGAACCGACCA
ACAATCTCGATCCCGCGTCGCGCAAGCAGGTGCTCGACGCGTTGCGTAAT
TATCAGGGTGCAGTGGTATTGGTGACGCACGATCCCGGAGCGGCAAAAGC
GCTGGATCCGCAACGCGTCGTGTTGTTGCCTGACGGCACTGAGGACTATT
GGTCCGACGAATATCGGGATCTCATTGAGTTGGCC
>C6
GTGATCACGGCCACGGACCTTGAGGTCCGCGCTGGTGCGCGCATCTTGCT
CTCATCCGACGGTCCGGACCTGCGCGTACAGCCCGGCGACCGCATTGGGC
TGGTTGGACGCAACGGCGCAGGCAAGACCACCACCTTGCGCATTTTGGCA
GGGGCAACTGAACCCTATGCCGGGTCAGTCACCTGGACCGGCGAGATTGG
TTACCTGCCACAAGATCCCAAAGTGGGCAATCTTGACGTGTTAGCCCGAG
ACCGGGTGCTGTCCGCCCGCGGGTTGGACGTGCTGCTAACCGATCTAGAG
AAGCAGCAGGCTTTGATGGCTGAGGTAGCCGACGACGATGCGCGTGACCG
TGCGATCCGTCGCTACGGCCAGCTCGAGGAGCGATTCCTTGCGTTGGGGG
GTTACAGCGCCGAAAGCGAAGCTGGCAGGATATGCGCGAGTCTAGGTCTG
CCTGAAAGGGTGCTGGTCCAGCAGTTGTGCACCTTGTCGGGAGGTCAGCG
CCGTAGGGTAGAGCTGGCGCGTATTCTGTTCGCGGCATCCAGAGCAGGAA
CTGGTGCTTCCGGTTCGGGAACCACGCTGTTGCTCGATGAGCCGACCAAC
CACCTCGATGCCGATTCGCTTGGGTGGCTGCGGGATTTCTTGCGGTCGCA
CACTGGTGGACTGGTAGTGATCAGCCATAACGTCGAGTTGATCGCCGCTG
TCGTCAACCGGGTGTGGTTCCTGGATGCCGTGCTCGGCAAGGTCGATGTC
TACAACATGGGCTGGTACAAGTACCTCGACTCCCGGGCCACCGACGAGCA
GCGCCGCCGCCGAGAACGCGTCAACGCTGAACGCAAGGCCACTGCGTTGC
GAACACAAGCTGCCAAGATGGGTGCTAAGGCAACCAAAGCGGTTGCGGCT
CAAAATATGTTGCGTCGAGCCGATCGGATGATGGCAGCACTTGACGAGGA
ACGGGTCATCGAAAAAGTGGCCCAGATCAAGTTTCCTACACCAGCGGCGT
GCGGGCGCACGCCGCTGGTGGCCAAGGGACTCAGCAAGACGTACGGGTCC
CTTGAAGTGTTCACTGGTGTGAATCTGGCTATTGACCGTGGCTCGCGAGT
GGTCGTACTGGGCCTCAACGGCGCCGGCAAGACCACGCTGTTGCGAGTGC
TGGCCGGAGCTGAGAAGCCCGACGTCGGCAGGCTGGAACCTGGACACGGT
TTGCGGATCGGCTATTTCGCCCAGGAACACGACACGCTCGATAACGAAGA
CACCGTCTGGCAGAACATTCGGCACACCGCACCCGAGTTCGGTGAACAGG
ATTTACGCGGACTGCTCGGCGCGTTCATGTTCAGCGGCCCACAGCTCGAC
CAACTGGCTGGCACCCTTTCCGGTGGTGAGAAGACCCGACTCGCACTCGC
AGGCCTGGTAGCGTCCACGGCTAACGTGCTACTACTCGATGAACCGACCA
ACAATCTCGATCCCGCGTCGCGCAAGCAGGTGCTCGACGCGTTGCGTAAT
TATCAGGGTGCAGTGGTATTGGTGACGCACGATCCCGGAGCGGCAAAAGC
GCTGGATCCGCAACGCGTCGTGTTGTTGCCTGACGGCACTGAGGACTATT
GGTCCGACGAATATCGGGATCTCATTGAGTTGGCC
>C1
VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
>C2
VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
>C3
VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
>C4
VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
>C5
VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA
>C6
VITATDLEVRAGARILLSSDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
GATEPYAGSVTWTGEIGYLPQDPKVGNLDVLARDRVLSARGLDVLLTDLE
KQQALMAEVADDDARDRAIRRYGQLEERFLALGGYSAESEAGRICASLGL
PERVLVQQLCTLSGGQRRRVELARILFAASRAGTGASGSGTTLLLDEPTN
HLDADSLGWLRDFLRSHTGGLVVISHNVELIAAVVNRVWFLDAVLGKVDV
YNMGWYKYLDSRATDEQRRRRERVNAERKATALRTQAAKMGAKATKAVAA
QNMLRRADRMMAALDEERVIEKVAQIKFPTPAACGRTPLVAKGLSKTYGS
LEVFTGVNLAIDRGSRVVVLGLNGAGKTTLLRVLAGAEKPDVGRLEPGHG
LRIGYFAQEHDTLDNEDTVWQNIRHTAPEFGEQDLRGLLGAFMFSGPQLD
QLAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASRKQVLDALRN
YQGAVVLVTHDPGAAKALDPQRVVLLPDGTEDYWSDEYRDLIELA


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1816/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1635 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579859465
      Setting output file names to "/data/7res/ML1816/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1668965411
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5600692335
      Seed = 2051743012
      Swapseed = 1579859465
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3659.208382 -- -24.965149
         Chain 2 -- -3659.208382 -- -24.965149
         Chain 3 -- -3659.208382 -- -24.965149
         Chain 4 -- -3659.208382 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3659.208171 -- -24.965149
         Chain 2 -- -3659.208382 -- -24.965149
         Chain 3 -- -3659.208382 -- -24.965149
         Chain 4 -- -3659.208382 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3659.208] (-3659.208) (-3659.208) (-3659.208) * [-3659.208] (-3659.208) (-3659.208) (-3659.208) 
        500 -- (-2268.154) (-2277.910) (-2262.930) [-2235.069] * (-2236.245) (-2245.787) (-2243.289) [-2249.343] -- 0:00:00
       1000 -- (-2237.414) (-2252.138) (-2252.502) [-2246.383] * (-2237.222) (-2243.574) [-2235.177] (-2233.124) -- 0:00:00
       1500 -- (-2241.469) (-2244.625) [-2242.528] (-2232.595) * (-2229.585) (-2230.446) [-2236.069] (-2232.528) -- 0:00:00
       2000 -- (-2236.394) (-2239.752) [-2235.244] (-2236.555) * (-2236.918) (-2237.508) [-2233.792] (-2236.437) -- 0:00:00
       2500 -- (-2241.039) [-2237.901] (-2244.081) (-2231.193) * (-2233.241) (-2238.245) [-2232.662] (-2235.216) -- 0:00:00
       3000 -- (-2240.791) (-2235.301) (-2232.780) [-2239.157] * [-2232.496] (-2237.180) (-2241.018) (-2233.266) -- 0:00:00
       3500 -- (-2239.137) (-2236.618) [-2234.492] (-2243.488) * (-2234.839) (-2233.741) (-2238.927) [-2233.803] -- 0:00:00
       4000 -- [-2237.164] (-2234.521) (-2240.961) (-2240.506) * (-2231.333) (-2245.738) (-2236.058) [-2231.406] -- 0:00:00
       4500 -- (-2243.691) (-2234.071) [-2233.269] (-2241.387) * (-2237.378) (-2238.033) [-2238.439] (-2247.034) -- 0:00:00
       5000 -- (-2240.119) (-2235.522) (-2239.220) [-2233.567] * (-2237.212) (-2241.700) (-2237.902) [-2233.809] -- 0:00:00

      Average standard deviation of split frequencies: 0.095647

       5500 -- [-2233.055] (-2232.962) (-2240.574) (-2238.897) * (-2234.254) [-2237.560] (-2232.332) (-2239.952) -- 0:00:00
       6000 -- (-2233.981) (-2234.737) [-2236.255] (-2231.778) * [-2229.802] (-2240.058) (-2239.695) (-2228.489) -- 0:00:00
       6500 -- (-2234.401) (-2238.948) (-2251.083) [-2233.954] * [-2237.279] (-2234.143) (-2239.681) (-2232.213) -- 0:00:00
       7000 -- (-2239.039) (-2230.328) (-2239.410) [-2242.790] * [-2232.031] (-2234.940) (-2235.013) (-2235.696) -- 0:00:00
       7500 -- (-2235.975) [-2232.127] (-2240.332) (-2237.794) * (-2237.821) [-2238.182] (-2239.447) (-2242.102) -- 0:00:00
       8000 -- [-2234.301] (-2245.166) (-2240.575) (-2233.551) * (-2234.967) [-2234.222] (-2240.176) (-2239.923) -- 0:00:00
       8500 -- [-2235.647] (-2244.033) (-2238.473) (-2230.753) * (-2234.326) (-2235.103) (-2236.488) [-2237.646] -- 0:00:00
       9000 -- [-2233.805] (-2247.788) (-2239.543) (-2233.678) * (-2233.592) [-2234.323] (-2237.392) (-2242.070) -- 0:00:00
       9500 -- (-2232.099) (-2245.620) [-2233.434] (-2230.994) * (-2237.358) [-2241.072] (-2242.293) (-2238.569) -- 0:00:00
      10000 -- (-2235.718) [-2235.044] (-2234.285) (-2245.502) * (-2233.855) [-2231.075] (-2228.513) (-2235.723) -- 0:00:00

      Average standard deviation of split frequencies: 0.070711

      10500 -- (-2234.554) (-2240.266) (-2233.697) [-2236.964] * (-2235.410) (-2234.657) (-2234.406) [-2232.666] -- 0:00:00
      11000 -- (-2235.606) (-2236.494) (-2232.661) [-2229.819] * (-2243.807) (-2240.299) (-2239.658) [-2235.822] -- 0:00:00
      11500 -- (-2231.460) [-2232.032] (-2232.864) (-2234.926) * (-2242.121) (-2244.499) [-2236.452] (-2237.101) -- 0:00:00
      12000 -- [-2239.959] (-2236.027) (-2235.029) (-2233.101) * (-2232.970) (-2241.883) [-2232.647] (-2233.603) -- 0:00:00
      12500 -- [-2240.050] (-2235.983) (-2239.589) (-2236.277) * (-2235.910) [-2227.959] (-2250.309) (-2235.718) -- 0:00:00
      13000 -- (-2231.173) [-2235.546] (-2241.440) (-2236.527) * (-2231.925) (-2240.064) (-2232.363) [-2232.196] -- 0:00:00
      13500 -- [-2237.953] (-2240.105) (-2237.040) (-2228.256) * (-2243.795) [-2233.334] (-2237.148) (-2241.401) -- 0:01:13
      14000 -- [-2226.764] (-2241.102) (-2247.245) (-2229.560) * (-2239.207) [-2231.993] (-2238.086) (-2238.706) -- 0:01:10
      14500 -- (-2227.864) [-2229.611] (-2245.504) (-2229.909) * [-2235.201] (-2239.424) (-2238.489) (-2245.273) -- 0:01:07
      15000 -- [-2228.232] (-2240.196) (-2235.526) (-2225.802) * (-2236.753) (-2235.770) (-2233.838) [-2237.184] -- 0:01:05

      Average standard deviation of split frequencies: 0.063578

      15500 -- (-2227.033) (-2234.266) [-2239.591] (-2225.515) * (-2234.500) [-2234.956] (-2233.975) (-2231.330) -- 0:01:03
      16000 -- (-2228.923) (-2235.988) [-2236.728] (-2227.330) * (-2240.860) (-2232.578) [-2239.593] (-2234.688) -- 0:01:01
      16500 -- [-2231.804] (-2239.130) (-2238.328) (-2227.331) * (-2238.901) (-2241.173) (-2233.291) [-2239.252] -- 0:00:59
      17000 -- [-2229.681] (-2240.094) (-2240.114) (-2227.291) * (-2242.599) (-2234.898) [-2237.469] (-2232.438) -- 0:00:57
      17500 -- (-2231.384) [-2232.463] (-2235.582) (-2226.411) * (-2234.611) (-2235.583) [-2231.359] (-2236.313) -- 0:00:56
      18000 -- [-2231.321] (-2232.274) (-2234.816) (-2226.849) * [-2233.991] (-2239.112) (-2238.878) (-2234.184) -- 0:00:54
      18500 -- (-2227.822) (-2233.424) (-2233.241) [-2226.927] * (-2234.229) [-2226.457] (-2236.840) (-2232.214) -- 0:00:53
      19000 -- (-2226.697) (-2232.783) [-2230.969] (-2227.418) * [-2237.462] (-2230.031) (-2236.315) (-2240.092) -- 0:00:51
      19500 -- (-2226.953) [-2231.079] (-2238.347) (-2227.417) * (-2233.976) (-2232.494) [-2234.185] (-2234.430) -- 0:00:50
      20000 -- (-2230.022) (-2235.753) (-2236.431) [-2227.604] * (-2234.773) [-2237.311] (-2235.441) (-2240.121) -- 0:00:49

      Average standard deviation of split frequencies: 0.076983

      20500 -- [-2227.374] (-2235.371) (-2231.153) (-2233.411) * (-2235.691) [-2228.884] (-2235.427) (-2235.406) -- 0:00:47
      21000 -- (-2226.688) [-2230.225] (-2233.139) (-2230.212) * [-2240.622] (-2228.337) (-2238.473) (-2238.730) -- 0:00:46
      21500 -- (-2227.409) (-2237.326) (-2238.367) [-2230.500] * (-2233.756) [-2225.294] (-2235.182) (-2240.341) -- 0:00:45
      22000 -- [-2227.422] (-2231.548) (-2236.848) (-2232.539) * (-2234.548) [-2225.183] (-2233.678) (-2240.422) -- 0:00:44
      22500 -- [-2226.064] (-2239.031) (-2237.024) (-2228.568) * (-2239.792) [-2224.779] (-2234.760) (-2234.199) -- 0:00:43
      23000 -- (-2225.313) (-2236.102) (-2241.568) [-2228.937] * (-2235.991) (-2225.525) (-2238.573) [-2242.055] -- 0:00:42
      23500 -- [-2225.381] (-2235.572) (-2241.502) (-2228.750) * [-2228.514] (-2234.368) (-2241.036) (-2239.259) -- 0:00:41
      24000 -- [-2231.003] (-2240.982) (-2238.162) (-2228.956) * (-2238.333) (-2230.367) [-2233.096] (-2233.072) -- 0:00:40
      24500 -- (-2229.638) (-2239.400) [-2229.418] (-2226.683) * (-2230.578) (-2230.525) (-2236.278) [-2240.130] -- 0:00:39
      25000 -- (-2231.303) (-2232.627) [-2228.993] (-2226.598) * [-2235.619] (-2226.475) (-2233.792) (-2234.178) -- 0:00:39

      Average standard deviation of split frequencies: 0.056120

      25500 -- (-2225.923) [-2235.875] (-2230.327) (-2226.117) * (-2235.972) (-2228.551) [-2235.703] (-2244.963) -- 0:00:38
      26000 -- (-2226.304) [-2231.264] (-2229.676) (-2226.750) * [-2230.812] (-2226.341) (-2241.324) (-2238.144) -- 0:00:37
      26500 -- (-2226.335) (-2241.981) (-2231.648) [-2226.130] * (-2243.334) (-2225.967) (-2238.844) [-2237.023] -- 0:00:36
      27000 -- (-2229.652) [-2234.054] (-2230.912) (-2226.054) * (-2233.476) [-2225.826] (-2236.081) (-2236.544) -- 0:01:12
      27500 -- [-2227.495] (-2234.254) (-2231.861) (-2225.606) * [-2238.484] (-2226.970) (-2239.879) (-2235.817) -- 0:01:10
      28000 -- (-2227.374) [-2238.734] (-2229.776) (-2224.881) * [-2238.634] (-2228.488) (-2235.625) (-2233.746) -- 0:01:09
      28500 -- (-2228.165) [-2229.598] (-2229.619) (-2225.377) * (-2240.791) (-2228.428) (-2241.884) [-2231.959] -- 0:01:08
      29000 -- (-2231.396) (-2238.038) (-2226.370) [-2226.898] * (-2241.625) (-2227.525) (-2236.934) [-2228.970] -- 0:01:06
      29500 -- (-2229.877) [-2233.853] (-2226.264) (-2225.405) * (-2234.280) [-2226.866] (-2231.630) (-2228.404) -- 0:01:05
      30000 -- (-2228.087) (-2239.659) [-2227.836] (-2225.530) * (-2235.044) (-2225.980) [-2233.255] (-2229.477) -- 0:01:04

      Average standard deviation of split frequencies: 0.055632

      30500 -- [-2229.026] (-2237.155) (-2227.441) (-2226.841) * (-2236.776) (-2227.176) [-2228.566] (-2228.220) -- 0:01:03
      31000 -- (-2229.267) [-2235.246] (-2226.302) (-2228.117) * [-2232.348] (-2227.477) (-2227.464) (-2225.948) -- 0:01:02
      31500 -- (-2229.566) [-2241.301] (-2226.758) (-2228.861) * (-2235.576) (-2229.262) (-2228.467) [-2225.526] -- 0:01:01
      32000 -- (-2229.490) [-2240.997] (-2225.861) (-2226.516) * (-2237.901) (-2226.717) [-2226.150] (-2227.199) -- 0:01:00
      32500 -- (-2230.084) [-2230.607] (-2226.805) (-2226.295) * [-2234.822] (-2226.395) (-2225.947) (-2226.785) -- 0:00:59
      33000 -- (-2229.520) (-2233.626) [-2226.981] (-2224.923) * [-2240.679] (-2226.394) (-2226.480) (-2226.833) -- 0:00:58
      33500 -- (-2227.023) (-2235.783) (-2227.388) [-2225.378] * (-2232.688) (-2224.830) (-2225.902) [-2226.833] -- 0:00:57
      34000 -- (-2229.289) [-2232.433] (-2227.831) (-2226.021) * (-2235.692) [-2226.284] (-2226.836) (-2229.188) -- 0:00:56
      34500 -- (-2226.135) (-2240.439) (-2229.640) [-2226.166] * (-2244.592) (-2225.930) (-2226.477) [-2230.304] -- 0:00:55
      35000 -- (-2226.034) [-2233.979] (-2226.798) (-2225.730) * [-2227.639] (-2227.923) (-2227.235) (-2231.246) -- 0:00:55

      Average standard deviation of split frequencies: 0.054342

      35500 -- (-2227.416) [-2230.684] (-2226.854) (-2226.214) * [-2228.288] (-2225.362) (-2225.753) (-2228.312) -- 0:00:54
      36000 -- (-2228.021) (-2232.776) [-2227.699] (-2226.298) * (-2227.915) (-2225.532) (-2227.402) [-2225.040] -- 0:00:53
      36500 -- (-2229.506) (-2233.020) [-2227.101] (-2227.986) * (-2228.221) (-2228.370) (-2225.289) [-2226.660] -- 0:00:52
      37000 -- (-2230.752) (-2234.833) (-2226.908) [-2228.332] * (-2227.084) (-2228.064) [-2226.064] (-2232.606) -- 0:00:52
      37500 -- (-2230.772) (-2236.192) (-2226.988) [-2230.115] * (-2229.620) (-2227.361) [-2226.328] (-2224.968) -- 0:00:51
      38000 -- [-2227.705] (-2235.366) (-2226.838) (-2231.328) * (-2226.854) (-2227.420) (-2225.314) [-2227.564] -- 0:00:50
      38500 -- [-2226.355] (-2236.359) (-2231.455) (-2228.634) * [-2228.248] (-2229.696) (-2225.150) (-2225.285) -- 0:00:49
      39000 -- (-2229.064) (-2238.649) [-2229.420] (-2228.158) * [-2227.496] (-2226.396) (-2225.027) (-2225.352) -- 0:00:49
      39500 -- [-2226.336] (-2236.189) (-2226.135) (-2229.893) * (-2226.525) (-2227.568) (-2225.257) [-2226.156] -- 0:00:48
      40000 -- (-2227.725) (-2236.211) [-2227.376] (-2227.458) * (-2226.861) (-2227.804) [-2226.545] (-2228.669) -- 0:00:48

      Average standard deviation of split frequencies: 0.048106

      40500 -- (-2225.797) (-2243.090) (-2226.244) [-2225.776] * (-2226.777) (-2228.179) (-2227.645) [-2226.454] -- 0:00:47
      41000 -- [-2227.690] (-2233.117) (-2226.730) (-2230.617) * (-2228.850) [-2231.531] (-2226.726) (-2227.699) -- 0:01:10
      41500 -- (-2228.325) (-2234.750) (-2226.902) [-2232.040] * (-2227.493) [-2227.092] (-2225.856) (-2225.863) -- 0:01:09
      42000 -- [-2226.968] (-2236.811) (-2225.889) (-2230.153) * [-2224.707] (-2227.352) (-2226.803) (-2225.822) -- 0:01:08
      42500 -- (-2227.228) (-2234.375) [-2225.404] (-2228.307) * (-2227.485) (-2227.165) (-2227.314) [-2226.774] -- 0:01:07
      43000 -- (-2228.579) [-2236.431] (-2226.721) (-2227.025) * [-2225.814] (-2226.600) (-2227.710) (-2229.251) -- 0:01:06
      43500 -- (-2228.266) [-2241.508] (-2227.290) (-2226.418) * [-2224.632] (-2228.246) (-2232.087) (-2230.397) -- 0:01:05
      44000 -- (-2227.739) [-2231.001] (-2228.023) (-2225.255) * (-2225.797) (-2227.479) [-2230.480] (-2231.316) -- 0:01:05
      44500 -- (-2227.815) (-2238.490) [-2227.805] (-2226.248) * (-2227.165) (-2228.721) (-2229.370) [-2225.737] -- 0:01:04
      45000 -- (-2233.121) (-2243.413) [-2225.513] (-2225.738) * (-2226.185) (-2226.617) [-2225.684] (-2226.756) -- 0:01:03

      Average standard deviation of split frequencies: 0.038942

      45500 -- (-2226.930) (-2239.331) (-2225.698) [-2228.161] * (-2226.146) (-2226.718) [-2227.366] (-2225.555) -- 0:01:02
      46000 -- (-2231.102) (-2239.760) [-2225.667] (-2228.329) * (-2226.947) (-2226.639) (-2226.900) [-2225.959] -- 0:01:02
      46500 -- (-2228.296) (-2243.529) [-2225.605] (-2225.374) * (-2226.775) [-2226.590] (-2228.406) (-2225.602) -- 0:01:01
      47000 -- [-2228.819] (-2231.940) (-2230.110) (-2227.461) * (-2227.453) (-2227.047) (-2226.987) [-2227.743] -- 0:01:00
      47500 -- [-2226.267] (-2234.492) (-2228.400) (-2225.728) * (-2227.086) (-2226.993) [-2226.977] (-2226.323) -- 0:01:00
      48000 -- (-2227.807) [-2232.962] (-2227.323) (-2226.659) * (-2226.351) (-2226.848) [-2229.298] (-2226.455) -- 0:00:59
      48500 -- (-2227.313) (-2234.824) (-2227.323) [-2227.963] * (-2225.829) (-2226.120) [-2227.205] (-2228.718) -- 0:00:58
      49000 -- (-2228.979) (-2235.776) [-2225.702] (-2226.803) * (-2225.070) [-2226.297] (-2229.144) (-2228.745) -- 0:00:58
      49500 -- [-2227.086] (-2238.668) (-2225.702) (-2225.430) * (-2226.154) [-2227.414] (-2228.053) (-2226.746) -- 0:00:57
      50000 -- (-2226.465) (-2240.320) (-2226.185) [-2225.949] * (-2229.463) [-2225.872] (-2227.176) (-2227.413) -- 0:00:57

      Average standard deviation of split frequencies: 0.033788

      50500 -- (-2228.179) (-2234.825) [-2226.298] (-2228.086) * (-2227.178) [-2229.313] (-2232.925) (-2225.718) -- 0:00:56
      51000 -- (-2228.037) (-2236.686) (-2227.084) [-2225.795] * [-2227.414] (-2227.735) (-2228.836) (-2226.703) -- 0:00:55
      51500 -- (-2226.787) [-2230.952] (-2227.879) (-2226.619) * (-2225.680) [-2230.135] (-2230.387) (-2225.449) -- 0:00:55
      52000 -- (-2227.223) [-2231.591] (-2226.056) (-2225.929) * [-2224.744] (-2225.585) (-2228.206) (-2226.983) -- 0:00:54
      52500 -- (-2226.492) (-2237.608) (-2237.311) [-2225.540] * (-2225.785) (-2225.371) (-2227.902) [-2227.933] -- 0:00:54
      53000 -- [-2226.578] (-2233.336) (-2237.781) (-2230.069) * (-2225.902) (-2225.830) [-2225.335] (-2227.720) -- 0:00:53
      53500 -- (-2225.613) (-2239.190) (-2229.409) [-2229.304] * (-2228.801) (-2227.026) (-2226.279) [-2227.760] -- 0:00:53
      54000 -- (-2225.680) (-2230.487) (-2235.015) [-2228.469] * (-2230.186) [-2226.678] (-2228.277) (-2226.807) -- 0:00:52
      54500 -- (-2226.754) [-2235.147] (-2230.390) (-2226.715) * (-2224.688) [-2226.672] (-2225.237) (-2226.281) -- 0:00:52
      55000 -- (-2226.915) (-2235.311) [-2227.429] (-2226.559) * (-2225.253) [-2227.269] (-2229.909) (-2227.478) -- 0:00:51

      Average standard deviation of split frequencies: 0.029884

      55500 -- (-2229.041) (-2238.049) (-2231.135) [-2226.968] * (-2226.320) (-2230.135) [-2229.659] (-2226.996) -- 0:01:08
      56000 -- [-2226.001] (-2243.635) (-2226.606) (-2226.146) * (-2226.186) (-2226.275) (-2225.390) [-2225.680] -- 0:01:07
      56500 -- (-2226.039) (-2231.746) [-2225.860] (-2225.988) * (-2226.229) [-2226.982] (-2226.419) (-2225.712) -- 0:01:06
      57000 -- (-2225.753) (-2237.919) [-2226.190] (-2227.786) * [-2224.777] (-2227.278) (-2226.348) (-2227.066) -- 0:01:06
      57500 -- (-2225.146) (-2247.709) [-2226.183] (-2230.039) * (-2224.777) (-2225.214) [-2227.746] (-2227.160) -- 0:01:05
      58000 -- (-2224.564) (-2237.650) [-2226.401] (-2231.232) * (-2227.886) (-2225.826) (-2226.652) [-2225.704] -- 0:01:04
      58500 -- (-2225.015) (-2235.402) [-2226.440] (-2227.621) * (-2227.903) (-2226.904) (-2226.700) [-2225.781] -- 0:01:04
      59000 -- (-2224.893) [-2234.716] (-2227.259) (-2228.880) * (-2227.870) [-2226.425] (-2226.361) (-2226.324) -- 0:01:03
      59500 -- (-2224.875) (-2234.545) [-2225.958] (-2226.078) * (-2227.725) [-2228.096] (-2227.304) (-2227.530) -- 0:01:03
      60000 -- (-2224.859) (-2239.745) [-2226.665] (-2226.108) * (-2228.972) (-2226.007) (-2227.126) [-2225.632] -- 0:01:02

      Average standard deviation of split frequencies: 0.032717

      60500 -- [-2224.947] (-2236.382) (-2230.120) (-2225.541) * (-2227.246) [-2225.843] (-2226.405) (-2227.793) -- 0:01:02
      61000 -- (-2225.279) [-2235.438] (-2227.763) (-2225.512) * (-2226.068) (-2227.579) [-2226.532] (-2227.153) -- 0:01:01
      61500 -- (-2225.282) (-2238.603) [-2228.507] (-2225.386) * (-2224.827) (-2227.913) (-2226.975) [-2227.153] -- 0:01:01
      62000 -- [-2225.300] (-2234.018) (-2228.159) (-2226.104) * (-2225.022) (-2226.292) (-2228.177) [-2226.251] -- 0:01:00
      62500 -- (-2228.192) [-2234.431] (-2226.762) (-2230.950) * [-2225.022] (-2225.882) (-2226.542) (-2228.252) -- 0:01:00
      63000 -- [-2227.432] (-2240.911) (-2228.315) (-2226.824) * [-2225.390] (-2227.804) (-2227.008) (-2228.767) -- 0:00:59
      63500 -- (-2225.784) [-2232.307] (-2227.386) (-2228.124) * [-2224.831] (-2226.330) (-2227.077) (-2226.025) -- 0:00:58
      64000 -- [-2226.428] (-2237.058) (-2225.148) (-2228.862) * (-2227.487) (-2225.562) (-2227.078) [-2225.784] -- 0:00:58
      64500 -- (-2226.666) (-2248.232) [-2225.308] (-2229.099) * (-2228.282) (-2227.925) (-2230.176) [-2226.237] -- 0:00:58
      65000 -- (-2227.168) (-2237.612) (-2225.175) [-2229.099] * (-2227.702) (-2227.067) (-2231.852) [-2227.396] -- 0:00:57

      Average standard deviation of split frequencies: 0.035712

      65500 -- (-2226.702) (-2236.526) (-2225.247) [-2226.541] * [-2226.204] (-2226.886) (-2229.893) (-2227.279) -- 0:00:57
      66000 -- (-2226.787) [-2232.725] (-2225.651) (-2226.888) * (-2226.396) (-2226.550) [-2230.126] (-2227.705) -- 0:00:56
      66500 -- (-2226.986) [-2243.685] (-2225.308) (-2228.385) * (-2227.996) (-2225.912) [-2229.358] (-2227.712) -- 0:00:56
      67000 -- (-2228.382) (-2234.337) (-2225.336) [-2228.555] * (-2231.343) [-2226.037] (-2229.934) (-2226.777) -- 0:00:55
      67500 -- (-2228.640) (-2233.677) (-2225.331) [-2225.279] * [-2225.853] (-2228.584) (-2227.916) (-2227.307) -- 0:00:55
      68000 -- (-2226.806) (-2239.739) (-2225.304) [-2225.266] * [-2227.746] (-2224.712) (-2228.020) (-2228.198) -- 0:00:54
      68500 -- (-2231.267) (-2235.082) [-2225.292] (-2225.482) * (-2226.880) [-2225.190] (-2229.180) (-2225.234) -- 0:00:54
      69000 -- (-2228.792) [-2224.572] (-2227.032) (-2225.340) * (-2232.523) (-2225.190) (-2229.392) [-2226.506] -- 0:00:53
      69500 -- (-2227.157) (-2225.101) (-2228.080) [-2225.224] * (-2229.317) [-2224.817] (-2228.248) (-2225.963) -- 0:01:06
      70000 -- (-2226.403) [-2225.101] (-2228.895) (-2224.941) * (-2227.223) (-2225.984) (-2228.589) [-2224.723] -- 0:01:06

      Average standard deviation of split frequencies: 0.029685

      70500 -- (-2227.651) (-2225.809) (-2229.162) [-2224.848] * (-2232.026) [-2228.275] (-2226.576) (-2225.462) -- 0:01:05
      71000 -- (-2231.693) (-2225.725) (-2228.053) [-2224.848] * [-2226.701] (-2226.439) (-2227.440) (-2231.752) -- 0:01:05
      71500 -- (-2227.805) [-2225.337] (-2227.041) (-2225.966) * (-2225.571) (-2225.862) (-2228.807) [-2225.708] -- 0:01:04
      72000 -- (-2227.307) [-2225.573] (-2227.056) (-2226.935) * [-2225.219] (-2226.125) (-2226.957) (-2225.196) -- 0:01:04
      72500 -- (-2227.805) (-2225.584) [-2226.585] (-2226.702) * (-2225.220) (-2228.301) [-2227.418] (-2226.653) -- 0:01:03
      73000 -- (-2227.660) [-2225.439] (-2233.967) (-2226.385) * (-2226.740) (-2229.940) (-2226.547) [-2227.623] -- 0:01:03
      73500 -- (-2229.655) (-2226.520) (-2234.147) [-2228.333] * (-2227.237) (-2229.244) [-2225.600] (-2227.993) -- 0:01:03
      74000 -- (-2235.630) (-2225.039) [-2225.995] (-2225.307) * [-2226.512] (-2227.263) (-2228.278) (-2226.559) -- 0:01:02
      74500 -- [-2227.893] (-2225.080) (-2225.994) (-2225.705) * (-2225.922) (-2229.250) (-2226.414) [-2226.150] -- 0:01:02
      75000 -- (-2228.816) [-2225.073] (-2228.513) (-2225.197) * (-2225.986) (-2228.651) (-2228.575) [-2230.293] -- 0:01:01

      Average standard deviation of split frequencies: 0.025741

      75500 -- (-2224.812) (-2225.381) (-2226.632) [-2225.229] * (-2225.204) (-2227.664) (-2225.970) [-2228.169] -- 0:01:01
      76000 -- [-2225.534] (-2227.304) (-2227.049) (-2227.392) * (-2226.563) (-2227.849) [-2225.978] (-2226.078) -- 0:01:00
      76500 -- (-2227.188) (-2226.697) (-2227.068) [-2227.376] * (-2230.211) [-2225.342] (-2228.824) (-2226.304) -- 0:01:00
      77000 -- (-2230.509) [-2226.746] (-2229.365) (-2226.361) * (-2227.768) [-2227.778] (-2227.230) (-2227.304) -- 0:00:59
      77500 -- [-2227.221] (-2226.129) (-2228.003) (-2227.817) * (-2228.484) [-2226.923] (-2226.360) (-2227.261) -- 0:00:59
      78000 -- (-2227.845) (-2225.914) [-2226.466] (-2225.304) * (-2228.534) (-2226.500) (-2225.542) [-2227.140] -- 0:00:59
      78500 -- (-2227.158) [-2225.723] (-2229.910) (-2225.326) * [-2227.531] (-2226.176) (-2225.775) (-2224.894) -- 0:00:58
      79000 -- (-2227.161) [-2225.977] (-2232.076) (-2224.911) * (-2229.172) [-2225.336] (-2227.649) (-2228.542) -- 0:00:58
      79500 -- (-2226.914) (-2225.574) (-2227.895) [-2227.429] * (-2228.848) (-2225.369) (-2225.401) [-2225.680] -- 0:00:57
      80000 -- (-2226.751) [-2228.107] (-2226.928) (-2226.434) * (-2231.093) [-2227.876] (-2225.582) (-2227.269) -- 0:00:57

      Average standard deviation of split frequencies: 0.024969

      80500 -- [-2226.350] (-2230.036) (-2226.188) (-2226.647) * (-2225.924) [-2226.398] (-2225.582) (-2230.815) -- 0:00:57
      81000 -- (-2226.900) (-2229.615) (-2225.884) [-2226.740] * (-2227.009) (-2225.541) [-2225.810] (-2225.195) -- 0:00:56
      81500 -- [-2229.008] (-2230.340) (-2226.271) (-2226.740) * [-2224.844] (-2225.536) (-2229.324) (-2225.868) -- 0:00:56
      82000 -- (-2227.123) [-2225.118] (-2225.846) (-2230.051) * [-2224.844] (-2225.282) (-2231.336) (-2228.128) -- 0:00:55
      82500 -- (-2228.726) (-2225.579) [-2228.333] (-2226.994) * (-2225.136) [-2225.999] (-2228.415) (-2229.280) -- 0:00:55
      83000 -- (-2226.840) [-2225.749] (-2226.028) (-2225.781) * (-2225.086) (-2225.597) (-2226.268) [-2225.155] -- 0:01:06
      83500 -- [-2227.939] (-2226.921) (-2226.117) (-2225.969) * (-2226.463) [-2226.047] (-2227.171) (-2226.791) -- 0:01:05
      84000 -- (-2227.166) (-2229.275) [-2226.385] (-2231.055) * (-2228.126) (-2225.461) (-2229.076) [-2230.365] -- 0:01:05
      84500 -- (-2227.920) [-2227.116] (-2230.289) (-2228.422) * (-2226.353) [-2225.437] (-2226.685) (-2227.894) -- 0:01:05
      85000 -- (-2227.949) (-2225.502) [-2227.345] (-2229.784) * (-2225.423) (-2229.047) [-2226.424] (-2225.071) -- 0:01:04

      Average standard deviation of split frequencies: 0.023356

      85500 -- [-2227.387] (-2225.776) (-2228.170) (-2231.811) * (-2227.741) (-2229.107) [-2226.549] (-2229.227) -- 0:01:04
      86000 -- (-2227.269) [-2225.776] (-2228.073) (-2228.945) * (-2227.808) (-2227.176) (-2228.129) [-2225.298] -- 0:01:03
      86500 -- (-2228.654) (-2225.146) (-2229.212) [-2225.120] * (-2230.568) (-2226.283) (-2226.862) [-2226.796] -- 0:01:03
      87000 -- (-2227.029) (-2227.177) (-2227.435) [-2225.524] * (-2230.926) (-2227.833) [-2230.108] (-2224.959) -- 0:01:02
      87500 -- (-2227.837) (-2228.073) (-2230.140) [-2224.921] * (-2226.353) (-2227.660) (-2226.194) [-2228.216] -- 0:01:02
      88000 -- (-2227.403) (-2229.010) (-2232.074) [-2224.789] * (-2227.007) (-2228.967) [-2227.827] (-2227.982) -- 0:01:02
      88500 -- (-2227.653) (-2226.039) [-2228.793] (-2226.588) * (-2227.233) (-2228.235) [-2226.058] (-2228.192) -- 0:01:01
      89000 -- (-2226.894) (-2227.164) (-2228.783) [-2227.905] * [-2226.257] (-2228.591) (-2229.612) (-2228.568) -- 0:01:01
      89500 -- (-2227.322) (-2225.811) (-2228.134) [-2227.965] * (-2226.593) (-2226.243) (-2226.700) [-2227.382] -- 0:01:01
      90000 -- [-2227.805] (-2224.773) (-2224.970) (-2228.698) * (-2227.099) (-2226.259) (-2229.313) [-2225.697] -- 0:01:00

      Average standard deviation of split frequencies: 0.025006

      90500 -- (-2228.766) (-2227.522) (-2227.237) [-2228.491] * [-2227.987] (-2228.051) (-2225.070) (-2227.198) -- 0:01:00
      91000 -- (-2231.278) (-2227.727) (-2226.245) [-2226.301] * (-2231.491) (-2228.504) (-2228.146) [-2229.158] -- 0:00:59
      91500 -- (-2231.625) (-2230.010) (-2224.767) [-2224.944] * [-2226.376] (-2227.883) (-2228.125) (-2227.412) -- 0:00:59
      92000 -- (-2229.900) (-2228.855) (-2225.289) [-2224.806] * [-2226.720] (-2226.884) (-2230.901) (-2227.608) -- 0:00:59
      92500 -- (-2231.542) [-2230.084] (-2228.267) (-2225.904) * (-2225.884) (-2225.943) (-2231.985) [-2227.787] -- 0:00:58
      93000 -- [-2227.707] (-2229.146) (-2227.561) (-2225.857) * (-2229.855) (-2225.955) (-2231.772) [-2228.761] -- 0:00:58
      93500 -- [-2227.752] (-2225.888) (-2226.499) (-2226.015) * (-2225.485) [-2227.710] (-2229.753) (-2229.882) -- 0:00:58
      94000 -- (-2226.176) (-2224.518) (-2225.745) [-2225.279] * [-2225.542] (-2227.563) (-2226.144) (-2228.912) -- 0:00:57
      94500 -- [-2225.745] (-2224.768) (-2225.300) (-2225.338) * (-2226.410) (-2226.685) [-2224.675] (-2229.129) -- 0:00:57
      95000 -- (-2224.896) (-2224.833) (-2225.190) [-2224.802] * (-2227.374) (-2227.641) [-2224.675] (-2228.622) -- 0:00:57

      Average standard deviation of split frequencies: 0.024085

      95500 -- (-2227.996) (-2226.096) [-2224.903] (-2224.794) * (-2225.813) (-2228.561) [-2224.642] (-2229.486) -- 0:00:56
      96000 -- (-2229.095) (-2225.692) (-2226.025) [-2226.755] * (-2226.063) [-2227.130] (-2224.689) (-2229.885) -- 0:00:56
      96500 -- (-2232.453) [-2225.147] (-2226.347) (-2226.155) * (-2225.122) (-2226.422) [-2227.812] (-2229.489) -- 0:00:56
      97000 -- (-2226.896) [-2226.091] (-2225.635) (-2230.002) * (-2225.537) [-2226.296] (-2228.471) (-2229.424) -- 0:00:55
      97500 -- (-2226.703) (-2226.171) (-2228.229) [-2229.140] * (-2225.496) (-2225.830) [-2226.172] (-2228.040) -- 0:01:04
      98000 -- (-2228.315) (-2225.200) [-2228.605] (-2228.314) * [-2225.625] (-2225.717) (-2225.211) (-2225.885) -- 0:01:04
      98500 -- [-2226.092] (-2226.845) (-2229.526) (-2229.692) * (-2225.461) (-2225.377) (-2228.026) [-2226.059] -- 0:01:04
      99000 -- [-2226.034] (-2228.979) (-2225.749) (-2229.815) * [-2225.407] (-2225.295) (-2228.753) (-2226.776) -- 0:01:03
      99500 -- (-2225.730) [-2226.521] (-2225.749) (-2230.590) * (-2225.400) (-2230.503) (-2227.825) [-2226.442] -- 0:01:03
      100000 -- (-2224.918) (-2226.304) (-2227.203) [-2228.282] * [-2226.716] (-2232.921) (-2226.115) (-2225.881) -- 0:01:02

      Average standard deviation of split frequencies: 0.021184

      100500 -- [-2224.617] (-2227.189) (-2230.091) (-2228.140) * [-2226.869] (-2228.247) (-2227.078) (-2231.068) -- 0:01:02
      101000 -- [-2225.522] (-2227.216) (-2228.661) (-2225.246) * (-2226.472) [-2225.612] (-2226.299) (-2231.147) -- 0:01:02
      101500 -- (-2225.262) (-2227.259) (-2226.880) [-2226.059] * (-2227.174) (-2225.328) (-2225.417) [-2226.067] -- 0:01:01
      102000 -- (-2227.606) [-2227.464] (-2225.174) (-2225.424) * (-2225.877) (-2228.796) (-2226.325) [-2228.276] -- 0:01:01
      102500 -- (-2229.649) (-2226.255) [-2225.174] (-2225.750) * (-2228.246) [-2226.288] (-2226.325) (-2231.527) -- 0:01:01
      103000 -- (-2226.474) (-2225.476) (-2226.021) [-2226.304] * [-2228.415] (-2226.864) (-2225.201) (-2230.496) -- 0:01:00
      103500 -- (-2229.526) [-2225.421] (-2225.107) (-2225.295) * (-2225.408) (-2227.308) [-2225.901] (-2229.330) -- 0:01:00
      104000 -- [-2225.935] (-2226.042) (-2228.137) (-2227.544) * (-2225.408) (-2227.573) [-2228.025] (-2226.480) -- 0:01:00
      104500 -- (-2225.932) (-2226.210) (-2227.581) [-2227.446] * (-2225.906) [-2228.486] (-2225.056) (-2224.861) -- 0:00:59
      105000 -- [-2226.162] (-2225.596) (-2230.776) (-2228.638) * (-2225.173) (-2225.354) (-2227.008) [-2226.057] -- 0:00:59

      Average standard deviation of split frequencies: 0.018424

      105500 -- (-2226.480) (-2225.179) (-2229.777) [-2227.574] * [-2224.723] (-2226.059) (-2226.283) (-2228.633) -- 0:00:59
      106000 -- (-2226.169) (-2227.094) [-2229.776] (-2228.351) * (-2224.976) (-2228.044) [-2225.785] (-2227.974) -- 0:00:59
      106500 -- [-2225.711] (-2225.834) (-2231.008) (-2227.470) * (-2227.441) (-2228.757) [-2226.604] (-2229.871) -- 0:00:58
      107000 -- [-2225.687] (-2227.812) (-2226.531) (-2227.026) * (-2226.492) (-2228.261) (-2226.903) [-2227.388] -- 0:00:58
      107500 -- [-2227.444] (-2226.755) (-2227.743) (-2225.159) * (-2226.417) (-2226.209) [-2227.101] (-2228.250) -- 0:00:58
      108000 -- (-2233.740) [-2226.567] (-2226.753) (-2225.715) * (-2227.200) (-2229.398) (-2225.324) [-2225.801] -- 0:00:57
      108500 -- (-2227.480) [-2229.273] (-2225.753) (-2225.942) * [-2227.017] (-2228.444) (-2224.817) (-2228.112) -- 0:00:57
      109000 -- (-2225.781) (-2225.612) (-2226.142) [-2226.941] * (-2226.065) (-2229.529) [-2226.041] (-2229.206) -- 0:00:57
      109500 -- (-2225.989) [-2225.976] (-2228.859) (-2226.941) * (-2226.097) [-2225.005] (-2228.596) (-2228.255) -- 0:00:56
      110000 -- (-2226.354) [-2225.715] (-2228.980) (-2227.101) * (-2227.112) [-2226.014] (-2229.791) (-2226.061) -- 0:00:56

      Average standard deviation of split frequencies: 0.016142

      110500 -- (-2228.194) (-2225.201) (-2227.384) [-2225.598] * (-2224.760) (-2226.703) (-2225.095) [-2226.611] -- 0:00:56
      111000 -- (-2225.225) (-2224.917) (-2226.878) [-2225.499] * [-2224.931] (-2227.341) (-2227.913) (-2225.016) -- 0:00:56
      111500 -- (-2226.356) (-2224.994) [-2227.241] (-2228.319) * (-2224.909) [-2228.845] (-2230.702) (-2227.339) -- 0:01:03
      112000 -- (-2226.173) (-2227.372) [-2226.717] (-2226.259) * (-2226.457) [-2229.815] (-2228.298) (-2230.052) -- 0:01:03
      112500 -- [-2226.524] (-2226.175) (-2225.998) (-2227.845) * [-2226.484] (-2226.055) (-2229.300) (-2228.328) -- 0:01:03
      113000 -- (-2228.943) (-2226.974) (-2225.994) [-2226.924] * [-2225.742] (-2229.504) (-2231.577) (-2227.431) -- 0:01:02
      113500 -- [-2228.171] (-2227.095) (-2225.931) (-2227.743) * [-2225.277] (-2230.792) (-2233.268) (-2227.200) -- 0:01:02
      114000 -- (-2225.148) (-2226.104) [-2226.594] (-2225.390) * [-2227.309] (-2227.895) (-2230.790) (-2228.382) -- 0:01:02
      114500 -- [-2227.824] (-2227.275) (-2227.267) (-2226.005) * [-2225.281] (-2227.786) (-2228.198) (-2228.229) -- 0:01:01
      115000 -- (-2228.182) [-2225.649] (-2226.889) (-2226.791) * (-2225.347) (-2227.504) (-2228.252) [-2226.230] -- 0:01:01

      Average standard deviation of split frequencies: 0.015186

      115500 -- (-2226.391) [-2225.882] (-2226.996) (-2226.799) * (-2227.363) (-2224.868) (-2227.409) [-2230.130] -- 0:01:01
      116000 -- [-2226.626] (-2226.749) (-2225.027) (-2224.913) * (-2230.131) (-2224.863) [-2225.679] (-2228.502) -- 0:01:00
      116500 -- (-2226.553) (-2226.905) (-2225.637) [-2227.163] * (-2231.240) [-2226.054] (-2231.593) (-2228.082) -- 0:01:00
      117000 -- [-2227.025] (-2228.416) (-2226.105) (-2226.924) * (-2228.311) (-2226.139) (-2231.237) [-2228.714] -- 0:01:00
      117500 -- (-2227.157) (-2228.853) [-2225.826] (-2226.595) * [-2229.771] (-2226.821) (-2232.883) (-2229.125) -- 0:01:00
      118000 -- (-2225.844) [-2225.392] (-2225.177) (-2226.260) * (-2227.175) (-2228.376) [-2225.278] (-2225.164) -- 0:00:59
      118500 -- (-2229.286) [-2225.456] (-2225.132) (-2226.594) * (-2227.383) (-2228.174) [-2225.787] (-2224.560) -- 0:00:59
      119000 -- (-2227.917) [-2226.339] (-2225.061) (-2228.395) * (-2227.237) (-2229.055) [-2225.731] (-2224.531) -- 0:00:59
      119500 -- (-2225.523) [-2226.495] (-2226.110) (-2225.828) * (-2229.986) (-2230.481) (-2225.574) [-2224.529] -- 0:00:58
      120000 -- (-2228.411) (-2225.689) [-2224.973] (-2225.986) * [-2233.575] (-2227.545) (-2225.720) (-2233.344) -- 0:00:58

      Average standard deviation of split frequencies: 0.016278

      120500 -- (-2230.772) (-2226.877) (-2227.334) [-2225.763] * [-2226.904] (-2227.951) (-2227.139) (-2228.058) -- 0:00:58
      121000 -- (-2227.178) (-2224.689) [-2226.554] (-2225.502) * (-2230.693) (-2228.222) [-2226.891] (-2228.304) -- 0:00:58
      121500 -- [-2227.175] (-2224.515) (-2226.554) (-2228.163) * [-2227.087] (-2226.816) (-2226.891) (-2227.996) -- 0:00:57
      122000 -- (-2226.647) (-2224.767) (-2224.698) [-2226.151] * (-2228.309) [-2227.411] (-2227.111) (-2225.367) -- 0:00:57
      122500 -- (-2227.020) [-2224.589] (-2228.888) (-2225.722) * [-2225.543] (-2227.177) (-2228.472) (-2225.965) -- 0:00:57
      123000 -- (-2226.430) (-2224.768) [-2225.357] (-2225.744) * (-2225.683) [-2226.430] (-2225.506) (-2226.928) -- 0:00:57
      123500 -- (-2226.487) [-2224.716] (-2224.815) (-2225.767) * [-2225.624] (-2227.025) (-2225.424) (-2229.215) -- 0:00:56
      124000 -- (-2226.315) [-2225.898] (-2225.290) (-2225.730) * (-2226.239) (-2229.719) (-2225.426) [-2228.601] -- 0:00:56
      124500 -- (-2226.594) [-2229.757] (-2225.207) (-2226.365) * (-2226.663) (-2229.955) [-2228.659] (-2230.754) -- 0:00:56
      125000 -- (-2227.753) (-2227.577) [-2225.307] (-2226.042) * [-2228.250] (-2229.790) (-2232.380) (-2226.737) -- 0:00:56

      Average standard deviation of split frequencies: 0.014134

      125500 -- [-2225.415] (-2227.452) (-2225.772) (-2225.808) * (-2226.896) (-2230.068) (-2229.996) [-2226.183] -- 0:00:55
      126000 -- (-2225.627) (-2227.365) (-2226.317) [-2225.301] * (-2226.942) [-2228.508] (-2227.494) (-2226.656) -- 0:01:02
      126500 -- (-2225.705) (-2227.378) (-2230.174) [-2225.365] * [-2226.566] (-2226.729) (-2228.095) (-2226.987) -- 0:01:02
      127000 -- [-2226.292] (-2227.352) (-2229.075) (-2225.445) * (-2228.325) (-2226.539) (-2226.976) [-2228.227] -- 0:01:01
      127500 -- (-2225.705) (-2229.463) (-2231.077) [-2225.909] * (-2226.326) (-2226.083) (-2228.555) [-2228.095] -- 0:01:01
      128000 -- [-2226.570] (-2226.295) (-2238.461) (-2227.947) * (-2226.337) [-2228.053] (-2226.894) (-2229.408) -- 0:01:01
      128500 -- [-2225.485] (-2227.091) (-2233.247) (-2226.224) * (-2229.425) (-2234.476) (-2233.039) [-2225.993] -- 0:01:01
      129000 -- [-2225.069] (-2228.021) (-2230.481) (-2226.597) * (-2226.438) (-2228.366) (-2233.611) [-2226.313] -- 0:01:00
      129500 -- (-2225.750) [-2227.603] (-2229.080) (-2227.469) * (-2227.606) (-2228.258) [-2230.469] (-2228.495) -- 0:01:00
      130000 -- [-2226.201] (-2228.745) (-2232.099) (-2227.235) * (-2228.204) (-2230.256) [-2228.334] (-2226.474) -- 0:01:00

      Average standard deviation of split frequencies: 0.016519

      130500 -- [-2226.808] (-2228.759) (-2226.998) (-2232.851) * (-2228.011) (-2229.592) (-2233.538) [-2226.222] -- 0:00:59
      131000 -- (-2225.474) (-2226.396) (-2225.924) [-2226.307] * [-2226.262] (-2229.008) (-2229.136) (-2227.111) -- 0:00:59
      131500 -- (-2227.500) (-2225.888) [-2226.025] (-2225.876) * [-2227.835] (-2230.487) (-2230.172) (-2232.047) -- 0:00:59
      132000 -- (-2227.497) [-2225.704] (-2227.159) (-2228.593) * [-2229.698] (-2227.268) (-2231.394) (-2225.113) -- 0:00:59
      132500 -- (-2226.335) (-2225.544) [-2228.319] (-2229.453) * (-2228.678) (-2226.564) (-2226.530) [-2224.723] -- 0:00:58
      133000 -- (-2227.327) (-2228.119) (-2227.015) [-2227.041] * [-2226.563] (-2226.564) (-2226.547) (-2224.679) -- 0:00:58
      133500 -- (-2232.585) [-2225.558] (-2230.245) (-2230.555) * (-2227.605) (-2226.401) (-2229.138) [-2225.096] -- 0:00:58
      134000 -- (-2228.555) (-2225.918) [-2227.812] (-2233.479) * (-2224.750) [-2226.405] (-2226.506) (-2225.738) -- 0:00:58
      134500 -- [-2228.046] (-2226.337) (-2225.921) (-2229.749) * (-2225.386) (-2227.585) (-2226.401) [-2225.758] -- 0:00:57
      135000 -- (-2226.635) (-2225.323) (-2225.921) [-2225.421] * [-2225.361] (-2225.291) (-2226.074) (-2225.943) -- 0:00:57

      Average standard deviation of split frequencies: 0.017513

      135500 -- (-2224.927) (-2228.377) (-2228.585) [-2225.893] * (-2227.514) (-2225.521) (-2226.165) [-2225.295] -- 0:00:57
      136000 -- (-2225.138) (-2228.748) [-2228.709] (-2226.113) * [-2227.342] (-2225.375) (-2226.460) (-2225.630) -- 0:00:57
      136500 -- (-2225.021) [-2228.205] (-2225.882) (-2225.820) * (-2227.390) (-2226.594) (-2228.893) [-2228.487] -- 0:00:56
      137000 -- (-2226.530) [-2229.077] (-2227.556) (-2225.905) * [-2231.229] (-2225.100) (-2225.596) (-2225.913) -- 0:00:56
      137500 -- [-2224.606] (-2228.466) (-2227.335) (-2225.796) * [-2232.624] (-2226.476) (-2224.938) (-2226.175) -- 0:00:56
      138000 -- [-2225.375] (-2230.706) (-2226.143) (-2225.861) * (-2229.853) [-2227.027] (-2225.118) (-2226.931) -- 0:00:56
      138500 -- (-2226.877) [-2229.305] (-2225.288) (-2226.153) * (-2231.938) (-2228.001) (-2226.153) [-2225.472] -- 0:00:55
      139000 -- (-2224.878) (-2228.839) (-2225.248) [-2226.153] * (-2230.429) [-2227.357] (-2225.330) (-2227.231) -- 0:00:55
      139500 -- (-2226.055) (-2229.656) (-2225.357) [-2225.173] * [-2231.312] (-2225.638) (-2226.211) (-2227.764) -- 0:00:55
      140000 -- (-2226.312) (-2229.825) [-2225.526] (-2225.212) * (-2231.314) [-2227.147] (-2226.211) (-2225.947) -- 0:00:55

      Average standard deviation of split frequencies: 0.015248

      140500 -- (-2226.060) [-2231.437] (-2225.314) (-2225.674) * (-2230.894) (-2227.007) (-2224.703) [-2227.074] -- 0:01:01
      141000 -- (-2226.569) [-2226.860] (-2225.973) (-2227.672) * (-2230.375) (-2226.266) (-2225.558) [-2227.239] -- 0:01:00
      141500 -- (-2226.569) (-2225.989) [-2225.997] (-2225.786) * (-2230.064) (-2228.157) [-2225.368] (-2227.230) -- 0:01:00
      142000 -- (-2225.886) (-2227.302) (-2225.841) [-2224.993] * (-2228.125) (-2226.843) [-2225.236] (-2226.841) -- 0:01:00
      142500 -- (-2225.331) (-2226.917) (-2225.094) [-2224.974] * (-2233.494) (-2227.708) [-2227.023] (-2227.118) -- 0:01:00
      143000 -- (-2227.962) (-2226.625) [-2225.532] (-2225.032) * (-2230.118) (-2226.735) (-2227.957) [-2227.085] -- 0:00:59
      143500 -- (-2227.652) [-2226.586] (-2225.755) (-2226.341) * (-2226.072) (-2226.406) (-2230.000) [-2227.382] -- 0:00:59
      144000 -- [-2226.227] (-2225.680) (-2230.068) (-2225.219) * [-2225.939] (-2226.422) (-2225.435) (-2226.228) -- 0:00:59
      144500 -- (-2228.024) [-2225.388] (-2226.507) (-2228.144) * (-2225.580) [-2225.231] (-2225.121) (-2226.275) -- 0:00:59
      145000 -- [-2224.819] (-2226.329) (-2230.582) (-2227.408) * (-2226.282) (-2226.856) (-2225.104) [-2226.145] -- 0:00:58

      Average standard deviation of split frequencies: 0.015660

      145500 -- (-2224.558) [-2226.588] (-2232.032) (-2227.601) * (-2228.270) (-2226.856) [-2225.142] (-2226.181) -- 0:00:58
      146000 -- [-2225.135] (-2228.371) (-2227.364) (-2231.257) * (-2228.940) (-2226.418) [-2226.610] (-2225.587) -- 0:00:58
      146500 -- [-2231.504] (-2227.668) (-2225.883) (-2231.380) * (-2226.461) (-2228.469) [-2226.604] (-2227.000) -- 0:00:58
      147000 -- (-2231.330) (-2226.175) (-2225.325) [-2226.480] * (-2224.761) [-2232.574] (-2224.918) (-2226.610) -- 0:00:58
      147500 -- (-2230.459) (-2225.604) [-2225.031] (-2226.076) * (-2227.166) (-2231.856) [-2225.205] (-2227.990) -- 0:00:57
      148000 -- (-2230.971) (-2225.850) (-2226.059) [-2227.469] * (-2224.825) (-2231.568) (-2227.220) [-2227.771] -- 0:00:57
      148500 -- (-2230.451) (-2229.316) [-2228.369] (-2228.195) * (-2225.067) (-2227.861) (-2226.516) [-2227.489] -- 0:00:57
      149000 -- (-2228.600) [-2226.536] (-2227.762) (-2228.188) * (-2227.445) (-2228.100) (-2230.266) [-2228.033] -- 0:00:57
      149500 -- (-2228.824) (-2226.344) [-2228.789] (-2226.390) * (-2227.445) (-2230.838) (-2226.665) [-2225.614] -- 0:00:56
      150000 -- (-2229.298) [-2226.382] (-2227.882) (-2226.338) * (-2226.881) [-2229.283] (-2225.588) (-2225.674) -- 0:00:56

      Average standard deviation of split frequencies: 0.016113

      150500 -- (-2227.932) (-2227.006) [-2227.241] (-2225.509) * (-2228.062) (-2227.498) (-2225.934) [-2224.934] -- 0:00:56
      151000 -- (-2226.548) (-2225.986) (-2227.873) [-2225.663] * (-2228.894) (-2227.305) [-2226.434] (-2227.473) -- 0:00:56
      151500 -- (-2226.553) (-2225.146) (-2227.575) [-2226.231] * (-2225.345) [-2228.454] (-2225.744) (-2225.385) -- 0:00:56
      152000 -- (-2226.539) (-2229.616) [-2227.385] (-2226.663) * (-2225.905) (-2233.414) [-2225.855] (-2225.385) -- 0:00:55
      152500 -- (-2227.227) (-2231.386) (-2229.608) [-2225.844] * (-2229.606) [-2232.130] (-2225.881) (-2226.834) -- 0:01:01
      153000 -- (-2227.337) (-2236.827) [-2228.097] (-2226.537) * (-2230.051) [-2229.605] (-2225.650) (-2226.007) -- 0:01:00
      153500 -- (-2228.679) [-2228.248] (-2228.462) (-2226.732) * (-2228.320) (-2226.929) (-2226.143) [-2226.060] -- 0:01:00
      154000 -- (-2226.915) (-2230.259) [-2227.622] (-2226.930) * (-2228.570) (-2227.204) [-2225.944] (-2228.331) -- 0:01:00
      154500 -- [-2228.152] (-2229.306) (-2226.951) (-2228.214) * (-2227.208) (-2227.339) [-2226.612] (-2227.134) -- 0:01:00
      155000 -- (-2226.413) [-2227.540] (-2228.990) (-2227.051) * (-2225.860) [-2226.137] (-2227.650) (-2227.739) -- 0:00:59

      Average standard deviation of split frequencies: 0.016318

      155500 -- [-2227.759] (-2228.906) (-2227.523) (-2229.285) * (-2230.930) (-2226.099) [-2226.128] (-2230.250) -- 0:00:59
      156000 -- (-2226.946) (-2229.587) [-2227.837] (-2227.077) * [-2228.336] (-2227.289) (-2227.585) (-2229.521) -- 0:00:59
      156500 -- (-2228.657) [-2227.261] (-2225.547) (-2228.183) * (-2226.736) (-2224.733) (-2227.640) [-2225.214] -- 0:00:59
      157000 -- (-2227.319) (-2227.711) [-2225.120] (-2228.424) * [-2226.721] (-2225.475) (-2226.846) (-2226.483) -- 0:00:59
      157500 -- (-2226.223) (-2225.900) [-2225.564] (-2228.480) * [-2226.423] (-2227.525) (-2230.375) (-2226.685) -- 0:00:58
      158000 -- (-2227.148) (-2228.710) (-2227.019) [-2225.136] * (-2225.988) (-2227.525) (-2231.834) [-2224.804] -- 0:00:58
      158500 -- [-2229.982] (-2230.254) (-2228.373) (-2225.136) * (-2226.446) (-2226.401) (-2225.503) [-2227.431] -- 0:00:58
      159000 -- [-2228.392] (-2229.099) (-2225.802) (-2224.737) * [-2225.832] (-2225.699) (-2226.977) (-2227.740) -- 0:00:58
      159500 -- (-2226.893) [-2226.262] (-2226.484) (-2225.441) * (-2228.854) [-2227.277] (-2225.660) (-2227.362) -- 0:00:57
      160000 -- (-2226.314) (-2225.811) [-2225.242] (-2226.971) * [-2227.193] (-2226.266) (-2226.247) (-2226.496) -- 0:00:57

      Average standard deviation of split frequencies: 0.017018

      160500 -- (-2228.912) (-2225.592) (-2228.646) [-2226.959] * (-2228.156) [-2226.268] (-2226.420) (-2225.638) -- 0:00:57
      161000 -- (-2227.437) (-2226.550) [-2229.508] (-2231.985) * (-2231.767) [-2227.249] (-2226.310) (-2226.583) -- 0:00:57
      161500 -- [-2226.433] (-2230.184) (-2227.148) (-2231.551) * (-2230.774) [-2225.296] (-2228.885) (-2227.356) -- 0:00:57
      162000 -- (-2227.805) (-2231.146) (-2226.573) [-2227.572] * (-2227.366) (-2227.587) (-2228.396) [-2226.098] -- 0:00:56
      162500 -- (-2226.439) (-2225.242) [-2227.256] (-2225.692) * (-2229.092) [-2225.052] (-2228.694) (-2226.388) -- 0:00:56
      163000 -- (-2229.244) [-2225.622] (-2227.351) (-2228.288) * [-2226.329] (-2226.000) (-2227.018) (-2228.465) -- 0:00:56
      163500 -- (-2226.044) (-2225.192) (-2227.576) [-2227.617] * (-2227.631) [-2225.628] (-2231.263) (-2225.712) -- 0:00:56
      164000 -- [-2227.673] (-2228.372) (-2225.333) (-2227.517) * [-2229.140] (-2225.848) (-2227.374) (-2227.029) -- 0:00:56
      164500 -- (-2226.206) (-2224.808) (-2224.968) [-2226.862] * [-2227.259] (-2225.107) (-2226.173) (-2226.862) -- 0:01:00
      165000 -- [-2226.228] (-2226.169) (-2225.139) (-2228.653) * (-2230.101) (-2226.963) [-2227.254] (-2226.510) -- 0:01:00

      Average standard deviation of split frequencies: 0.017039

      165500 -- (-2226.141) [-2225.904] (-2225.122) (-2228.429) * (-2226.385) (-2227.012) (-2233.510) [-2225.434] -- 0:01:00
      166000 -- (-2228.117) [-2225.875] (-2225.067) (-2226.177) * (-2225.541) [-2226.820] (-2226.764) (-2225.676) -- 0:01:00
      166500 -- (-2227.168) (-2228.484) (-2225.209) [-2227.474] * (-2226.415) (-2227.868) [-2227.715] (-2226.689) -- 0:01:00
      167000 -- (-2227.212) (-2227.430) (-2225.080) [-2226.632] * (-2228.959) [-2227.797] (-2228.382) (-2226.709) -- 0:00:59
      167500 -- (-2225.078) [-2225.781] (-2228.290) (-2226.612) * (-2225.387) (-2227.302) (-2227.887) [-2228.950] -- 0:00:59
      168000 -- (-2224.986) (-2233.745) (-2229.375) [-2226.114] * (-2227.380) (-2227.795) [-2226.142] (-2228.280) -- 0:00:59
      168500 -- [-2227.045] (-2226.945) (-2227.520) (-2225.003) * (-2227.994) (-2229.656) [-2226.619] (-2227.304) -- 0:00:59
      169000 -- (-2227.666) (-2228.856) (-2229.977) [-2225.678] * (-2227.537) [-2226.595] (-2231.652) (-2227.009) -- 0:00:59
      169500 -- (-2229.781) (-2228.697) [-2227.982] (-2226.743) * (-2224.921) (-2225.862) [-2226.690] (-2227.503) -- 0:00:58
      170000 -- (-2228.786) (-2228.840) (-2226.935) [-2226.631] * (-2224.995) (-2225.403) [-2226.591] (-2226.606) -- 0:00:58

      Average standard deviation of split frequencies: 0.017678

      170500 -- [-2227.303] (-2229.676) (-2224.961) (-2226.796) * (-2226.178) (-2225.282) (-2226.580) [-2225.539] -- 0:00:58
      171000 -- (-2228.517) (-2231.235) [-2226.651] (-2229.349) * (-2228.430) (-2228.656) (-2226.603) [-2225.573] -- 0:00:58
      171500 -- (-2229.801) [-2225.451] (-2226.216) (-2229.065) * (-2229.295) [-2226.068] (-2226.763) (-2225.710) -- 0:00:57
      172000 -- [-2226.745] (-2226.577) (-2226.045) (-2227.560) * (-2234.007) (-2230.492) [-2225.847] (-2225.871) -- 0:00:57
      172500 -- (-2234.317) (-2227.990) [-2225.982] (-2228.587) * (-2225.656) (-2229.204) [-2228.150] (-2226.233) -- 0:00:57
      173000 -- (-2234.909) (-2225.665) (-2225.203) [-2228.993] * [-2225.431] (-2225.754) (-2233.181) (-2225.375) -- 0:00:57
      173500 -- [-2233.341] (-2228.333) (-2225.518) (-2230.414) * (-2226.423) [-2227.035] (-2235.339) (-2227.634) -- 0:00:57
      174000 -- [-2231.754] (-2228.712) (-2225.699) (-2229.216) * (-2225.811) [-2229.274] (-2230.286) (-2227.205) -- 0:00:56
      174500 -- [-2231.890] (-2225.973) (-2227.221) (-2226.300) * (-2226.670) (-2227.565) (-2226.473) [-2226.480] -- 0:00:56
      175000 -- (-2231.594) (-2228.685) (-2227.618) [-2226.147] * (-2225.973) (-2229.821) (-2225.607) [-2228.932] -- 0:00:56

      Average standard deviation of split frequencies: 0.015507

      175500 -- (-2224.602) [-2224.610] (-2228.138) (-2228.388) * [-2224.926] (-2227.862) (-2227.564) (-2228.065) -- 0:00:56
      176000 -- (-2224.866) (-2225.765) [-2226.525] (-2227.495) * (-2224.926) (-2226.494) (-2230.474) [-2228.041] -- 0:00:56
      176500 -- [-2225.988] (-2227.770) (-2226.829) (-2227.117) * [-2224.926] (-2225.857) (-2229.123) (-2225.914) -- 0:01:00
      177000 -- (-2225.413) (-2228.948) (-2227.018) [-2227.109] * (-2224.734) [-2228.290] (-2229.531) (-2227.231) -- 0:01:00
      177500 -- [-2225.413] (-2228.154) (-2226.361) (-2227.109) * [-2226.723] (-2229.290) (-2224.691) (-2227.969) -- 0:01:00
      178000 -- (-2225.422) (-2230.983) [-2226.877] (-2225.685) * [-2226.659] (-2227.948) (-2224.575) (-2229.337) -- 0:01:00
      178500 -- [-2226.884] (-2230.848) (-2227.896) (-2227.032) * (-2226.042) (-2226.705) [-2225.009] (-2228.860) -- 0:00:59
      179000 -- (-2226.673) [-2226.516] (-2229.283) (-2226.489) * (-2230.251) (-2227.006) (-2224.651) [-2228.881] -- 0:00:59
      179500 -- (-2225.168) [-2226.628] (-2229.645) (-2226.716) * (-2227.055) (-2226.340) [-2226.453] (-2227.624) -- 0:00:59
      180000 -- [-2226.459] (-2227.049) (-2229.053) (-2225.443) * [-2225.366] (-2226.837) (-2227.314) (-2224.938) -- 0:00:59

      Average standard deviation of split frequencies: 0.014742

      180500 -- (-2225.136) (-2227.034) [-2231.755] (-2224.983) * (-2225.446) (-2228.032) [-2227.934] (-2226.182) -- 0:00:59
      181000 -- (-2225.908) [-2227.292] (-2228.529) (-2227.898) * [-2226.875] (-2227.830) (-2227.703) (-2227.542) -- 0:00:58
      181500 -- (-2229.990) [-2227.108] (-2227.571) (-2226.791) * [-2225.994] (-2232.887) (-2225.392) (-2228.239) -- 0:00:58
      182000 -- (-2227.981) (-2230.329) (-2226.490) [-2225.853] * (-2228.291) [-2226.035] (-2225.402) (-2228.376) -- 0:00:58
      182500 -- (-2230.337) (-2228.297) (-2227.574) [-2225.289] * (-2228.840) [-2228.331] (-2226.667) (-2225.754) -- 0:00:58
      183000 -- (-2226.907) (-2228.438) (-2227.726) [-2225.577] * [-2226.714] (-2227.919) (-2226.544) (-2230.248) -- 0:00:58
      183500 -- (-2226.127) (-2227.820) (-2234.117) [-2225.952] * [-2230.081] (-2226.857) (-2226.103) (-2227.496) -- 0:00:57
      184000 -- (-2226.539) [-2228.041] (-2226.141) (-2226.458) * (-2226.149) (-2226.792) [-2225.543] (-2227.622) -- 0:00:57
      184500 -- (-2229.691) (-2227.648) (-2227.107) [-2227.078] * (-2227.585) (-2228.360) [-2226.006] (-2227.135) -- 0:00:57
      185000 -- (-2225.941) [-2227.646] (-2225.955) (-2225.711) * (-2227.542) [-2226.674] (-2224.880) (-2227.447) -- 0:00:57

      Average standard deviation of split frequencies: 0.014362

      185500 -- (-2226.667) (-2227.104) [-2225.916] (-2228.560) * [-2227.949] (-2226.929) (-2225.177) (-2226.736) -- 0:00:57
      186000 -- (-2226.492) [-2227.310] (-2228.851) (-2225.370) * (-2227.271) (-2226.524) [-2225.593] (-2226.727) -- 0:00:56
      186500 -- (-2230.030) [-2224.835] (-2227.258) (-2227.757) * (-2227.844) [-2226.033] (-2225.697) (-2230.914) -- 0:00:56
      187000 -- (-2228.003) (-2225.655) [-2228.059] (-2227.795) * (-2229.476) (-2226.778) [-2225.691] (-2232.235) -- 0:00:56
      187500 -- (-2227.556) (-2227.826) [-2228.581] (-2227.585) * [-2228.763] (-2227.233) (-2225.609) (-2226.138) -- 0:00:56
      188000 -- (-2227.750) [-2225.407] (-2226.090) (-2225.494) * (-2227.138) [-2226.321] (-2230.135) (-2226.033) -- 0:00:56
      188500 -- (-2228.831) (-2225.313) (-2227.195) [-2227.482] * (-2227.745) [-2225.233] (-2228.145) (-2230.503) -- 0:00:55
      189000 -- (-2227.532) [-2225.569] (-2227.211) (-2225.540) * (-2228.794) [-2225.472] (-2227.146) (-2227.900) -- 0:00:55
      189500 -- (-2226.197) [-2225.258] (-2227.226) (-2224.852) * [-2225.910] (-2230.023) (-2227.063) (-2227.426) -- 0:00:55
      190000 -- [-2227.361] (-2224.908) (-2228.428) (-2228.458) * (-2229.202) (-2225.832) [-2227.318] (-2227.240) -- 0:00:59

      Average standard deviation of split frequencies: 0.014965

      190500 -- (-2230.829) (-2225.697) [-2228.256] (-2227.327) * (-2231.387) (-2226.457) (-2227.480) [-2227.298] -- 0:00:59
      191000 -- (-2229.971) (-2228.017) (-2228.137) [-2228.161] * [-2225.861] (-2225.479) (-2227.444) (-2230.905) -- 0:00:59
      191500 -- [-2228.264] (-2227.579) (-2226.875) (-2229.120) * [-2225.840] (-2225.506) (-2227.303) (-2227.850) -- 0:00:59
      192000 -- (-2229.014) (-2229.189) [-2225.872] (-2227.530) * (-2225.025) [-2226.001] (-2227.793) (-2234.459) -- 0:00:58
      192500 -- (-2230.637) (-2229.044) (-2226.699) [-2228.321] * (-2225.472) (-2227.234) (-2225.470) [-2228.639] -- 0:00:58
      193000 -- (-2233.813) (-2228.684) (-2226.554) [-2226.187] * (-2225.198) [-2227.149] (-2225.522) (-2229.496) -- 0:00:58
      193500 -- (-2228.190) (-2228.354) (-2226.977) [-2226.071] * (-2225.455) (-2226.222) [-2229.502] (-2230.678) -- 0:00:58
      194000 -- [-2227.652] (-2229.011) (-2227.262) (-2225.818) * (-2227.050) (-2229.891) [-2228.614] (-2232.078) -- 0:00:58
      194500 -- (-2228.402) (-2230.834) [-2226.644] (-2226.012) * (-2225.491) [-2228.978] (-2228.370) (-2228.520) -- 0:00:57
      195000 -- (-2228.412) [-2225.914] (-2227.546) (-2225.234) * [-2225.755] (-2227.066) (-2226.028) (-2227.589) -- 0:00:57

      Average standard deviation of split frequencies: 0.012026

      195500 -- (-2230.770) [-2225.971] (-2227.732) (-2225.614) * (-2226.364) (-2227.830) (-2226.056) [-2227.587] -- 0:00:57
      196000 -- (-2230.725) [-2225.205] (-2229.176) (-2227.191) * [-2229.184] (-2225.731) (-2225.867) (-2227.837) -- 0:00:57
      196500 -- (-2228.126) (-2226.609) [-2228.693] (-2225.507) * (-2225.907) (-2225.386) [-2227.528] (-2226.583) -- 0:00:57
      197000 -- [-2226.863] (-2227.860) (-2227.183) (-2226.241) * (-2224.865) [-2225.075] (-2226.890) (-2226.146) -- 0:00:57
      197500 -- (-2227.612) [-2227.512] (-2227.157) (-2225.747) * (-2226.483) [-2225.723] (-2230.261) (-2227.782) -- 0:00:56
      198000 -- (-2227.365) (-2226.488) [-2225.946] (-2225.230) * (-2224.972) (-2225.288) (-2229.432) [-2226.030] -- 0:00:56
      198500 -- (-2228.556) (-2227.380) [-2227.909] (-2224.684) * [-2226.435] (-2226.023) (-2227.666) (-2226.252) -- 0:00:56
      199000 -- [-2229.120] (-2226.012) (-2226.661) (-2226.348) * (-2229.245) [-2225.535] (-2229.031) (-2227.280) -- 0:00:56
      199500 -- (-2226.286) [-2225.938] (-2226.121) (-2226.117) * (-2226.332) [-2225.628] (-2228.351) (-2227.608) -- 0:00:56
      200000 -- (-2227.331) (-2225.608) [-2225.686] (-2225.585) * [-2227.370] (-2225.120) (-2227.610) (-2227.312) -- 0:00:55

      Average standard deviation of split frequencies: 0.012735

      200500 -- (-2232.749) (-2227.559) (-2226.800) [-2225.507] * [-2226.272] (-2225.162) (-2227.307) (-2225.867) -- 0:00:55
      201000 -- (-2227.586) (-2227.056) [-2229.270] (-2225.935) * (-2226.662) (-2227.545) (-2227.555) [-2227.946] -- 0:00:55
      201500 -- (-2228.501) (-2225.201) (-2228.061) [-2225.905] * (-2226.333) [-2229.242] (-2227.438) (-2228.550) -- 0:00:55
      202000 -- (-2228.503) [-2228.063] (-2230.962) (-2226.736) * (-2227.974) [-2227.361] (-2227.253) (-2227.808) -- 0:00:55
      202500 -- [-2226.988] (-2228.433) (-2229.578) (-2225.835) * (-2227.500) (-2227.085) [-2227.399] (-2227.719) -- 0:00:55
      203000 -- [-2227.318] (-2227.480) (-2226.255) (-2226.863) * (-2227.364) (-2228.025) [-2228.542] (-2229.353) -- 0:00:54
      203500 -- (-2230.687) [-2226.818] (-2225.591) (-2228.754) * (-2227.366) (-2226.746) (-2226.051) [-2225.557] -- 0:00:54
      204000 -- (-2230.868) (-2226.524) [-2224.658] (-2226.167) * (-2230.091) (-2228.186) [-2227.059] (-2226.808) -- 0:00:54
      204500 -- (-2225.501) [-2226.187] (-2224.674) (-2228.325) * [-2226.222] (-2226.690) (-2228.517) (-2225.449) -- 0:00:58
      205000 -- (-2226.458) [-2226.515] (-2225.227) (-2225.270) * (-2226.046) (-2226.387) [-2229.450] (-2227.037) -- 0:00:58

      Average standard deviation of split frequencies: 0.012014

      205500 -- (-2227.143) (-2226.595) (-2225.307) [-2227.165] * (-2228.932) (-2225.015) (-2229.680) [-2231.155] -- 0:00:57
      206000 -- [-2225.350] (-2226.597) (-2225.316) (-2225.159) * (-2228.835) [-2225.638] (-2227.348) (-2227.112) -- 0:00:57
      206500 -- [-2226.300] (-2226.402) (-2226.515) (-2225.799) * (-2231.909) [-2225.870] (-2226.702) (-2226.757) -- 0:00:57
      207000 -- (-2227.944) (-2225.406) [-2226.605] (-2225.210) * (-2231.853) (-2228.688) [-2227.769] (-2225.934) -- 0:00:57
      207500 -- [-2227.596] (-2225.955) (-2227.269) (-2224.803) * (-2229.663) (-2227.758) [-2227.231] (-2225.054) -- 0:00:57
      208000 -- (-2227.285) (-2227.396) [-2226.052] (-2228.241) * (-2233.495) (-2226.981) [-2226.922] (-2225.469) -- 0:00:57
      208500 -- (-2225.682) [-2226.072] (-2228.573) (-2229.445) * (-2229.804) (-2226.156) (-2226.222) [-2225.749] -- 0:00:56
      209000 -- [-2224.932] (-2227.375) (-2230.125) (-2225.421) * (-2227.647) [-2228.713] (-2226.062) (-2226.080) -- 0:00:56
      209500 -- [-2225.651] (-2229.871) (-2227.802) (-2228.304) * [-2224.814] (-2227.435) (-2225.271) (-2226.047) -- 0:00:56
      210000 -- [-2225.537] (-2226.711) (-2229.352) (-2226.578) * (-2224.888) (-2226.801) [-2226.655] (-2224.748) -- 0:00:56

      Average standard deviation of split frequencies: 0.012602

      210500 -- (-2228.186) [-2226.789] (-2226.501) (-2229.083) * (-2224.888) (-2227.380) [-2226.527] (-2225.251) -- 0:00:56
      211000 -- (-2229.795) (-2227.838) (-2225.986) [-2228.941] * [-2224.889] (-2226.341) (-2226.395) (-2227.441) -- 0:00:56
      211500 -- (-2232.044) (-2228.495) [-2226.533] (-2226.930) * (-2227.757) (-2228.213) [-2226.599] (-2225.672) -- 0:00:55
      212000 -- (-2227.678) (-2226.112) [-2226.315] (-2225.675) * (-2228.461) (-2228.363) (-2227.494) [-2225.453] -- 0:00:55
      212500 -- (-2227.723) (-2226.929) (-2233.598) [-2228.434] * (-2228.825) [-2231.790] (-2226.834) (-2225.471) -- 0:00:55
      213000 -- [-2227.766] (-2228.140) (-2229.884) (-2230.003) * (-2227.326) (-2225.982) [-2228.348] (-2225.373) -- 0:00:55
      213500 -- (-2227.449) (-2226.851) [-2227.151] (-2227.864) * (-2227.831) [-2226.561] (-2230.429) (-2230.135) -- 0:00:55
      214000 -- [-2226.085] (-2231.896) (-2225.113) (-2226.724) * (-2229.065) [-2225.296] (-2229.754) (-2227.028) -- 0:00:55
      214500 -- [-2225.054] (-2230.425) (-2226.286) (-2226.509) * (-2226.993) (-2226.473) (-2227.016) [-2227.267] -- 0:00:54
      215000 -- (-2225.234) (-2229.929) (-2225.999) [-2225.923] * (-2226.906) [-2225.638] (-2230.920) (-2224.832) -- 0:00:54

      Average standard deviation of split frequencies: 0.012865

      215500 -- (-2225.519) (-2229.283) (-2226.694) [-2226.936] * (-2227.009) (-2226.603) [-2227.917] (-2227.272) -- 0:00:54
      216000 -- (-2225.987) (-2229.990) (-2227.041) [-2230.070] * (-2230.602) [-2226.872] (-2230.705) (-2227.148) -- 0:00:54
      216500 -- [-2225.706] (-2229.994) (-2225.661) (-2227.535) * (-2230.799) (-2226.457) [-2231.333] (-2225.511) -- 0:00:54
      217000 -- [-2225.136] (-2227.384) (-2226.950) (-2225.164) * [-2230.986] (-2226.564) (-2233.040) (-2225.744) -- 0:00:54
      217500 -- (-2226.938) (-2226.105) (-2224.795) [-2226.565] * (-2227.945) (-2229.754) (-2230.039) [-2225.409] -- 0:00:53
      218000 -- (-2225.840) (-2225.929) [-2224.772] (-2226.376) * [-2228.223] (-2229.969) (-2234.111) (-2225.703) -- 0:00:53
      218500 -- (-2224.619) [-2226.918] (-2224.869) (-2224.772) * [-2229.183] (-2227.368) (-2228.365) (-2230.397) -- 0:00:53
      219000 -- [-2225.222] (-2225.749) (-2224.721) (-2225.225) * (-2226.763) (-2226.809) (-2226.074) [-2228.163] -- 0:00:53
      219500 -- (-2225.222) [-2226.539] (-2224.678) (-2226.325) * (-2225.416) [-2226.953] (-2225.931) (-2228.397) -- 0:00:56
      220000 -- (-2225.165) (-2226.518) (-2224.775) [-2225.916] * (-2226.803) [-2227.122] (-2225.502) (-2225.439) -- 0:00:56

      Average standard deviation of split frequencies: 0.013411

      220500 -- (-2226.769) [-2225.656] (-2226.343) (-2225.591) * (-2226.771) [-2227.646] (-2226.575) (-2226.549) -- 0:00:56
      221000 -- (-2227.321) [-2226.090] (-2225.833) (-2225.206) * (-2227.155) (-2227.997) [-2225.702] (-2226.893) -- 0:00:56
      221500 -- (-2231.159) (-2226.201) [-2225.858] (-2225.206) * [-2227.799] (-2226.439) (-2225.504) (-2226.667) -- 0:00:56
      222000 -- (-2225.337) (-2225.571) (-2226.924) [-2225.157] * (-2229.245) (-2229.444) [-2228.793] (-2227.035) -- 0:00:56
      222500 -- (-2224.916) (-2226.888) [-2228.727] (-2226.376) * [-2228.924] (-2225.924) (-2226.864) (-2229.604) -- 0:00:55
      223000 -- (-2225.895) (-2225.212) [-2225.820] (-2226.818) * (-2230.355) [-2227.033] (-2228.477) (-2227.806) -- 0:00:55
      223500 -- (-2228.240) (-2224.989) [-2225.889] (-2227.820) * [-2226.326] (-2226.570) (-2226.057) (-2230.061) -- 0:00:55
      224000 -- (-2227.410) (-2225.320) [-2225.454] (-2227.998) * [-2226.887] (-2226.240) (-2226.861) (-2226.785) -- 0:00:55
      224500 -- (-2228.561) [-2227.089] (-2225.932) (-2226.879) * [-2225.686] (-2227.687) (-2228.310) (-2227.649) -- 0:00:55
      225000 -- [-2232.550] (-2227.408) (-2225.843) (-2225.396) * [-2224.803] (-2227.080) (-2225.245) (-2227.252) -- 0:00:55

      Average standard deviation of split frequencies: 0.013975

      225500 -- (-2229.353) (-2227.430) (-2228.896) [-2225.538] * [-2224.550] (-2228.103) (-2227.161) (-2226.356) -- 0:00:54
      226000 -- (-2229.044) (-2228.760) [-2227.200] (-2226.000) * [-2224.831] (-2229.688) (-2228.473) (-2232.601) -- 0:00:54
      226500 -- (-2225.547) [-2225.909] (-2226.040) (-2227.695) * [-2225.417] (-2229.707) (-2228.544) (-2227.836) -- 0:00:54
      227000 -- [-2225.948] (-2225.682) (-2227.549) (-2227.384) * (-2225.459) [-2228.926] (-2226.434) (-2228.683) -- 0:00:54
      227500 -- [-2224.777] (-2225.743) (-2226.015) (-2225.854) * [-2226.806] (-2226.392) (-2226.259) (-2230.007) -- 0:00:54
      228000 -- [-2227.902] (-2227.739) (-2227.302) (-2225.854) * (-2229.303) [-2225.588] (-2227.724) (-2229.049) -- 0:00:54
      228500 -- [-2227.970] (-2227.161) (-2227.627) (-2225.257) * (-2228.046) (-2225.610) [-2224.802] (-2229.049) -- 0:00:54
      229000 -- (-2228.323) (-2228.091) [-2229.329] (-2225.226) * [-2227.566] (-2226.879) (-2226.585) (-2229.885) -- 0:00:53
      229500 -- (-2227.614) (-2227.326) (-2226.358) [-2225.845] * (-2232.516) [-2227.568] (-2226.658) (-2227.606) -- 0:00:53
      230000 -- (-2230.152) (-2229.457) (-2227.035) [-2226.523] * (-2227.737) (-2227.566) (-2226.512) [-2229.405] -- 0:00:53

      Average standard deviation of split frequencies: 0.013795

      230500 -- (-2230.044) [-2230.568] (-2230.042) (-2226.737) * (-2225.942) (-2225.964) (-2227.174) [-2226.840] -- 0:00:53
      231000 -- (-2228.622) [-2229.257] (-2227.454) (-2226.097) * (-2226.281) (-2228.843) (-2225.320) [-2229.759] -- 0:00:53
      231500 -- (-2227.861) (-2228.903) [-2225.423] (-2226.359) * (-2226.702) (-2229.015) [-2225.395] (-2228.524) -- 0:00:53
      232000 -- (-2225.383) [-2227.970] (-2226.715) (-2225.714) * (-2224.872) (-2226.248) [-2227.252] (-2229.559) -- 0:00:52
      232500 -- [-2226.505] (-2231.174) (-2225.131) (-2226.520) * (-2229.082) (-2228.703) (-2225.505) [-2225.780] -- 0:00:52
      233000 -- (-2226.641) (-2232.804) [-2225.091] (-2226.771) * (-2226.230) (-2231.101) [-2226.346] (-2225.903) -- 0:00:52
      233500 -- (-2228.414) (-2231.348) [-2226.377] (-2230.947) * (-2226.230) (-2228.518) [-2225.734] (-2227.282) -- 0:00:52
      234000 -- (-2229.207) (-2227.264) (-2225.363) [-2227.985] * (-2227.268) [-2226.513] (-2227.376) (-2224.736) -- 0:00:52
      234500 -- (-2235.143) (-2230.411) (-2225.748) [-2231.253] * (-2228.271) [-2227.809] (-2227.918) (-2224.735) -- 0:00:55
      235000 -- (-2233.498) [-2227.400] (-2226.095) (-2231.353) * (-2228.233) (-2228.583) [-2229.808] (-2225.093) -- 0:00:55

      Average standard deviation of split frequencies: 0.014182

      235500 -- (-2228.878) [-2228.958] (-2225.895) (-2228.440) * (-2228.175) [-2227.012] (-2227.901) (-2225.371) -- 0:00:55
      236000 -- (-2230.536) (-2229.212) (-2225.994) [-2226.332] * (-2227.979) (-2226.717) [-2226.386] (-2229.985) -- 0:00:55
      236500 -- [-2231.062] (-2229.431) (-2225.983) (-2227.017) * (-2228.188) (-2226.722) [-2226.441] (-2228.975) -- 0:00:54
      237000 -- (-2231.358) (-2227.928) [-2225.983] (-2227.647) * [-2226.562] (-2227.968) (-2225.094) (-2224.815) -- 0:00:54
      237500 -- [-2226.405] (-2227.584) (-2225.718) (-2235.304) * (-2226.628) (-2228.025) (-2225.502) [-2225.362] -- 0:00:54
      238000 -- [-2228.475] (-2225.938) (-2225.132) (-2225.211) * (-2226.137) (-2227.426) (-2225.502) [-2226.991] -- 0:00:54
      238500 -- (-2227.011) (-2228.995) (-2225.528) [-2225.653] * [-2228.148] (-2229.436) (-2227.732) (-2227.755) -- 0:00:54
      239000 -- (-2227.678) (-2227.494) [-2225.540] (-2225.837) * (-2228.136) [-2225.565] (-2227.526) (-2233.574) -- 0:00:54
      239500 -- (-2230.604) (-2225.133) (-2226.120) [-2225.847] * (-2228.507) (-2224.955) [-2226.616] (-2238.297) -- 0:00:53
      240000 -- (-2226.027) (-2225.704) [-2225.037] (-2225.030) * (-2226.538) (-2227.710) (-2226.297) [-2233.227] -- 0:00:53

      Average standard deviation of split frequencies: 0.014742

      240500 -- [-2226.509] (-2227.897) (-2225.429) (-2225.918) * (-2225.074) (-2228.139) (-2228.143) [-2229.248] -- 0:00:53
      241000 -- (-2225.768) (-2225.343) (-2226.349) [-2229.681] * [-2225.074] (-2228.224) (-2226.084) (-2228.457) -- 0:00:53
      241500 -- (-2226.403) (-2226.966) (-2227.476) [-2225.499] * (-2225.011) (-2226.927) (-2226.557) [-2227.715] -- 0:00:53
      242000 -- (-2227.893) (-2228.199) [-2225.800] (-2226.367) * (-2229.494) (-2226.936) (-2226.640) [-2226.319] -- 0:00:53
      242500 -- (-2227.706) [-2226.644] (-2224.953) (-2227.700) * (-2225.790) (-2227.924) [-2226.511] (-2225.963) -- 0:00:53
      243000 -- [-2226.851] (-2224.911) (-2225.001) (-2226.332) * (-2225.563) (-2227.830) [-2228.316] (-2226.566) -- 0:00:52
      243500 -- (-2228.386) (-2225.280) (-2224.985) [-2224.985] * (-2225.170) (-2233.360) (-2226.808) [-2225.385] -- 0:00:52
      244000 -- (-2228.322) (-2225.178) [-2225.360] (-2225.564) * (-2225.424) (-2228.003) [-2227.514] (-2226.625) -- 0:00:52
      244500 -- [-2226.307] (-2225.877) (-2225.624) (-2227.802) * (-2227.582) (-2227.921) [-2227.869] (-2226.072) -- 0:00:52
      245000 -- [-2227.391] (-2226.216) (-2225.624) (-2226.967) * (-2227.430) [-2227.498] (-2229.283) (-2227.190) -- 0:00:52

      Average standard deviation of split frequencies: 0.014180

      245500 -- (-2226.617) (-2227.899) [-2226.761] (-2225.272) * (-2225.484) (-2227.458) (-2227.367) [-2226.383] -- 0:00:52
      246000 -- (-2225.938) [-2226.801] (-2230.292) (-2226.088) * [-2227.402] (-2227.792) (-2226.176) (-2226.892) -- 0:00:52
      246500 -- (-2228.099) (-2226.312) (-2227.206) [-2226.475] * (-2227.528) (-2228.040) (-2227.395) [-2229.999] -- 0:00:51
      247000 -- (-2228.398) (-2225.765) (-2225.024) [-2226.420] * (-2227.210) (-2230.019) [-2228.077] (-2228.028) -- 0:00:51
      247500 -- (-2230.514) [-2224.796] (-2227.379) (-2224.742) * (-2226.770) (-2225.757) [-2225.373] (-2227.073) -- 0:00:51
      248000 -- (-2226.584) (-2225.853) (-2228.865) [-2225.415] * (-2226.719) (-2225.758) [-2227.739] (-2226.385) -- 0:00:51
      248500 -- (-2225.715) [-2226.732] (-2226.548) (-2225.797) * (-2226.413) (-2225.372) (-2228.017) [-2226.980] -- 0:00:51
      249000 -- (-2225.159) (-2226.734) (-2227.471) [-2225.155] * (-2226.483) (-2225.374) [-2229.091] (-2226.133) -- 0:00:51
      249500 -- (-2227.338) (-2229.812) [-2226.881] (-2225.614) * [-2226.432] (-2225.232) (-2228.380) (-2226.810) -- 0:00:54
      250000 -- [-2228.221] (-2227.184) (-2226.130) (-2226.852) * (-2228.730) (-2226.503) [-2227.348] (-2229.610) -- 0:00:54

      Average standard deviation of split frequencies: 0.014313

      250500 -- [-2225.276] (-2230.454) (-2226.825) (-2226.177) * (-2227.216) (-2227.463) [-2228.564] (-2227.741) -- 0:00:53
      251000 -- (-2226.335) [-2225.499] (-2226.424) (-2224.688) * (-2227.767) (-2226.824) (-2226.021) [-2224.981] -- 0:00:53
      251500 -- (-2226.932) [-2225.985] (-2225.660) (-2224.688) * [-2225.766] (-2226.998) (-2225.557) (-2225.319) -- 0:00:53
      252000 -- [-2226.632] (-2226.652) (-2225.350) (-2231.074) * (-2225.370) (-2227.815) [-2225.199] (-2225.709) -- 0:00:53
      252500 -- [-2225.672] (-2227.665) (-2225.806) (-2229.316) * (-2227.210) [-2228.582] (-2226.504) (-2226.536) -- 0:00:53
      253000 -- (-2225.609) (-2229.695) (-2227.972) [-2224.919] * [-2228.956] (-2227.152) (-2226.283) (-2227.133) -- 0:00:53
      253500 -- [-2225.745] (-2231.619) (-2227.059) (-2226.074) * (-2227.413) (-2225.853) [-2226.199] (-2227.008) -- 0:00:53
      254000 -- (-2226.090) (-2226.652) (-2229.036) [-2226.762] * (-2227.247) (-2225.853) [-2228.992] (-2227.275) -- 0:00:52
      254500 -- (-2226.409) [-2226.989] (-2227.349) (-2227.223) * (-2227.245) (-2231.094) (-2226.735) [-2229.046] -- 0:00:52
      255000 -- (-2225.560) [-2226.466] (-2226.772) (-2229.864) * (-2231.238) (-2227.698) [-2229.969] (-2228.304) -- 0:00:52

      Average standard deviation of split frequencies: 0.014118

      255500 -- (-2226.973) (-2228.529) [-2226.421] (-2225.799) * (-2226.540) (-2227.405) [-2225.055] (-2227.217) -- 0:00:52
      256000 -- [-2227.808] (-2225.831) (-2226.888) (-2227.024) * (-2228.811) (-2226.942) (-2226.372) [-2226.370] -- 0:00:52
      256500 -- (-2226.151) (-2226.669) (-2224.854) [-2228.094] * [-2226.983] (-2226.512) (-2228.563) (-2226.297) -- 0:00:52
      257000 -- (-2230.226) (-2226.914) (-2226.313) [-2226.608] * (-2232.708) (-2227.171) [-2227.740] (-2233.107) -- 0:00:52
      257500 -- [-2227.330] (-2228.362) (-2226.250) (-2227.070) * (-2225.759) (-2227.644) [-2224.631] (-2232.671) -- 0:00:51
      258000 -- (-2227.284) [-2228.351] (-2226.097) (-2227.715) * (-2227.512) (-2230.079) (-2225.599) [-2227.258] -- 0:00:51
      258500 -- (-2226.691) [-2227.497] (-2226.503) (-2227.357) * [-2227.652] (-2225.124) (-2225.891) (-2226.568) -- 0:00:51
      259000 -- (-2226.612) (-2227.482) (-2225.040) [-2227.518] * (-2225.761) [-2226.775] (-2227.622) (-2227.321) -- 0:00:51
      259500 -- (-2226.109) (-2229.465) [-2224.806] (-2226.730) * (-2225.809) [-2228.741] (-2225.544) (-2233.125) -- 0:00:51
      260000 -- (-2226.516) (-2227.389) [-2224.806] (-2228.946) * (-2225.949) [-2229.740] (-2226.226) (-2226.495) -- 0:00:51

      Average standard deviation of split frequencies: 0.014372

      260500 -- (-2226.494) [-2226.991] (-2225.079) (-2229.642) * (-2226.299) [-2229.609] (-2226.024) (-2226.106) -- 0:00:51
      261000 -- (-2227.178) (-2229.035) [-2225.366] (-2226.536) * (-2225.671) (-2230.454) [-2227.979] (-2228.553) -- 0:00:50
      261500 -- (-2234.199) [-2226.723] (-2227.874) (-2228.078) * (-2224.614) (-2230.981) (-2227.128) [-2228.494] -- 0:00:50
      262000 -- (-2226.033) [-2228.452] (-2226.004) (-2229.661) * (-2227.771) (-2226.898) (-2225.167) [-2226.614] -- 0:00:50
      262500 -- [-2227.981] (-2228.975) (-2225.414) (-2228.120) * [-2225.281] (-2228.400) (-2226.266) (-2227.192) -- 0:00:50
      263000 -- (-2228.078) [-2229.203] (-2225.414) (-2225.517) * [-2228.189] (-2232.742) (-2230.408) (-2226.307) -- 0:00:50
      263500 -- (-2230.187) (-2231.357) [-2229.725] (-2225.517) * (-2225.712) (-2227.675) (-2227.717) [-2229.321] -- 0:00:50
      264000 -- (-2232.169) [-2226.196] (-2227.061) (-2225.942) * (-2225.586) (-2229.111) (-2227.989) [-2226.804] -- 0:00:50
      264500 -- (-2228.530) (-2225.623) [-2226.467] (-2225.362) * (-2225.444) (-2226.064) (-2227.378) [-2226.804] -- 0:00:52
      265000 -- (-2227.167) (-2226.471) [-2226.257] (-2228.440) * (-2229.985) [-2227.912] (-2226.669) (-2225.795) -- 0:00:52

      Average standard deviation of split frequencies: 0.013618

      265500 -- (-2231.046) (-2226.553) [-2226.141] (-2226.826) * (-2225.363) [-2229.013] (-2231.051) (-2226.920) -- 0:00:52
      266000 -- (-2227.293) (-2225.681) (-2228.146) [-2225.306] * [-2225.835] (-2225.831) (-2227.960) (-2225.440) -- 0:00:52
      266500 -- [-2227.959] (-2229.790) (-2225.249) (-2225.334) * (-2227.056) (-2226.650) (-2227.342) [-2225.507] -- 0:00:52
      267000 -- (-2226.795) (-2230.448) [-2226.643] (-2228.306) * [-2226.580] (-2226.033) (-2228.171) (-2225.508) -- 0:00:52
      267500 -- [-2226.115] (-2225.987) (-2227.214) (-2227.915) * (-2233.218) (-2226.184) (-2232.012) [-2225.432] -- 0:00:52
      268000 -- (-2227.198) (-2225.704) (-2226.515) [-2227.061] * [-2229.202] (-2226.309) (-2233.909) (-2227.178) -- 0:00:51
      268500 -- [-2225.690] (-2225.605) (-2225.357) (-2227.783) * [-2226.920] (-2227.226) (-2233.207) (-2225.730) -- 0:00:51
      269000 -- (-2225.101) (-2226.708) [-2225.387] (-2226.657) * (-2226.659) (-2226.668) [-2227.302] (-2225.422) -- 0:00:51
      269500 -- (-2224.930) (-2227.038) [-2225.576] (-2226.498) * [-2227.028] (-2225.635) (-2227.342) (-2229.447) -- 0:00:51
      270000 -- (-2227.379) [-2226.629] (-2226.395) (-2225.077) * (-2225.109) (-2225.796) (-2231.729) [-2228.598] -- 0:00:51

      Average standard deviation of split frequencies: 0.012869

      270500 -- [-2224.925] (-2226.528) (-2225.931) (-2225.737) * [-2225.868] (-2226.600) (-2229.505) (-2228.008) -- 0:00:51
      271000 -- (-2225.154) (-2226.374) (-2226.558) [-2226.328] * (-2226.117) (-2227.024) [-2228.113] (-2229.028) -- 0:00:51
      271500 -- [-2228.151] (-2225.176) (-2225.423) (-2227.882) * (-2228.955) [-2227.981] (-2225.431) (-2225.973) -- 0:00:50
      272000 -- [-2228.787] (-2226.285) (-2227.175) (-2225.748) * (-2232.789) [-2226.278] (-2225.431) (-2229.240) -- 0:00:50
      272500 -- (-2232.250) (-2226.022) (-2227.241) [-2225.738] * (-2232.828) (-2225.729) [-2225.431] (-2226.313) -- 0:00:50
      273000 -- (-2227.072) [-2225.108] (-2227.117) (-2227.324) * [-2228.583] (-2225.974) (-2226.609) (-2230.521) -- 0:00:50
      273500 -- (-2226.919) (-2225.637) [-2227.531] (-2225.427) * (-2226.688) (-2229.975) (-2227.764) [-2224.841] -- 0:00:50
      274000 -- (-2225.500) [-2225.380] (-2228.573) (-2226.278) * [-2226.966] (-2225.337) (-2226.327) (-2227.428) -- 0:00:50
      274500 -- (-2231.195) (-2226.890) (-2228.893) [-2225.855] * (-2225.015) (-2225.810) [-2229.436] (-2228.050) -- 0:00:50
      275000 -- [-2229.238] (-2225.873) (-2226.443) (-2225.557) * [-2225.092] (-2224.776) (-2228.315) (-2228.602) -- 0:00:50

      Average standard deviation of split frequencies: 0.013262

      275500 -- (-2226.497) (-2226.573) [-2226.786] (-2225.181) * (-2225.538) [-2226.918] (-2228.040) (-2226.035) -- 0:00:49
      276000 -- (-2230.188) (-2228.581) [-2226.512] (-2226.430) * [-2226.353] (-2225.613) (-2226.817) (-2224.629) -- 0:00:49
      276500 -- (-2227.185) (-2228.015) (-2227.856) [-2226.492] * (-2226.447) (-2233.541) [-2227.658] (-2225.824) -- 0:00:49
      277000 -- (-2227.295) [-2228.005] (-2226.664) (-2228.988) * [-2225.113] (-2226.829) (-2226.922) (-2225.730) -- 0:00:49
      277500 -- [-2228.703] (-2227.346) (-2226.339) (-2225.312) * [-2227.032] (-2227.843) (-2227.219) (-2225.226) -- 0:00:49
      278000 -- (-2226.335) (-2227.790) (-2226.441) [-2225.715] * (-2226.234) (-2227.087) [-2225.804] (-2226.209) -- 0:00:49
      278500 -- (-2231.799) (-2227.627) (-2225.996) [-2227.627] * (-2224.799) (-2226.492) (-2225.491) [-2226.490] -- 0:00:49
      279000 -- (-2228.497) (-2230.850) (-2225.820) [-2226.635] * (-2225.525) [-2227.886] (-2228.308) (-2225.521) -- 0:00:49
      279500 -- [-2226.763] (-2226.505) (-2227.088) (-2238.638) * [-2225.771] (-2229.613) (-2226.965) (-2224.810) -- 0:00:51
      280000 -- (-2226.342) [-2227.147] (-2226.071) (-2233.148) * (-2231.337) (-2230.279) [-2227.584] (-2226.660) -- 0:00:51

      Average standard deviation of split frequencies: 0.012548

      280500 -- (-2226.881) [-2228.285] (-2226.402) (-2226.260) * [-2226.920] (-2226.125) (-2228.341) (-2226.101) -- 0:00:51
      281000 -- (-2226.675) (-2227.618) (-2229.265) [-2228.767] * (-2229.442) (-2226.126) (-2226.566) [-2226.190] -- 0:00:51
      281500 -- [-2225.336] (-2227.586) (-2229.868) (-2227.146) * [-2232.450] (-2226.326) (-2227.398) (-2225.441) -- 0:00:51
      282000 -- [-2225.122] (-2228.075) (-2226.672) (-2225.982) * (-2235.448) (-2228.311) (-2226.960) [-2226.019] -- 0:00:50
      282500 -- [-2226.211] (-2225.304) (-2226.287) (-2226.873) * (-2229.936) (-2226.740) [-2227.712] (-2226.019) -- 0:00:50
      283000 -- (-2226.554) (-2225.883) [-2225.098] (-2225.908) * (-2228.793) (-2225.761) [-2226.117] (-2226.196) -- 0:00:50
      283500 -- (-2226.981) (-2228.043) (-2230.872) [-2226.223] * (-2229.518) [-2225.804] (-2226.625) (-2225.118) -- 0:00:50
      284000 -- (-2228.824) [-2232.145] (-2224.924) (-2230.160) * (-2226.481) [-2226.339] (-2226.918) (-2225.350) -- 0:00:50
      284500 -- [-2227.019] (-2228.574) (-2227.445) (-2225.837) * (-2225.545) (-2226.069) [-2227.473] (-2225.346) -- 0:00:50
      285000 -- (-2226.302) [-2225.692] (-2231.112) (-2227.098) * (-2227.174) (-2228.278) (-2226.577) [-2227.765] -- 0:00:50

      Average standard deviation of split frequencies: 0.014054

      285500 -- [-2228.220] (-2226.342) (-2227.738) (-2227.163) * (-2226.531) (-2225.015) [-2226.287] (-2228.836) -- 0:00:50
      286000 -- (-2226.341) (-2226.349) (-2229.033) [-2226.729] * (-2227.128) (-2227.080) [-2227.419] (-2227.933) -- 0:00:49
      286500 -- (-2226.944) [-2227.355] (-2227.480) (-2226.464) * (-2227.042) [-2226.823] (-2230.060) (-2226.557) -- 0:00:49
      287000 -- (-2227.262) [-2225.352] (-2226.653) (-2229.068) * (-2228.141) [-2227.693] (-2227.863) (-2225.523) -- 0:00:49
      287500 -- (-2228.252) (-2230.224) [-2225.548] (-2227.533) * (-2226.321) (-2227.855) (-2227.680) [-2227.843] -- 0:00:49
      288000 -- (-2227.110) (-2226.748) [-2226.733] (-2225.071) * (-2226.543) [-2227.065] (-2231.346) (-2225.009) -- 0:00:49
      288500 -- (-2227.522) (-2226.776) [-2228.421] (-2228.265) * (-2225.652) (-2226.916) (-2230.138) [-2224.734] -- 0:00:49
      289000 -- (-2230.331) (-2225.390) [-2228.224] (-2226.683) * (-2225.893) [-2228.287] (-2226.624) (-2224.713) -- 0:00:49
      289500 -- (-2227.247) [-2225.041] (-2227.816) (-2224.907) * (-2228.658) (-2227.586) [-2226.621] (-2233.688) -- 0:00:49
      290000 -- [-2227.099] (-2227.214) (-2227.975) (-2225.410) * (-2227.173) [-2225.665] (-2228.698) (-2231.892) -- 0:00:48

      Average standard deviation of split frequencies: 0.014416

      290500 -- [-2227.089] (-2229.985) (-2228.519) (-2225.362) * (-2227.088) (-2225.492) (-2228.640) [-2226.961] -- 0:00:48
      291000 -- (-2230.076) (-2237.326) [-2226.160] (-2228.233) * (-2226.754) [-2225.492] (-2228.221) (-2225.958) -- 0:00:48
      291500 -- (-2228.235) [-2225.111] (-2225.428) (-2224.973) * (-2225.943) [-2224.539] (-2227.109) (-2227.752) -- 0:00:48
      292000 -- (-2234.391) (-2225.893) (-2228.447) [-2226.298] * (-2227.622) [-2224.532] (-2225.839) (-2226.399) -- 0:00:48
      292500 -- (-2225.402) [-2224.811] (-2225.341) (-2228.022) * (-2228.093) (-2224.535) [-2226.445] (-2226.167) -- 0:00:48
      293000 -- (-2227.865) (-2226.082) [-2225.371] (-2228.444) * (-2228.846) (-2226.135) (-2226.654) [-2226.206] -- 0:00:50
      293500 -- (-2233.102) (-2226.769) (-2225.923) [-2227.008] * [-2230.347] (-2229.052) (-2234.247) (-2225.157) -- 0:00:50
      294000 -- (-2229.764) [-2229.065] (-2225.172) (-2227.992) * (-2230.600) (-2232.096) (-2231.888) [-2226.402] -- 0:00:50
      294500 -- (-2226.980) [-2228.493] (-2224.834) (-2226.937) * (-2229.227) [-2226.165] (-2227.055) (-2228.158) -- 0:00:50
      295000 -- (-2226.645) (-2233.901) (-2229.364) [-2230.465] * (-2230.216) (-2227.373) [-2226.232] (-2229.297) -- 0:00:50

      Average standard deviation of split frequencies: 0.013360

      295500 -- (-2227.389) (-2227.170) (-2228.490) [-2227.221] * (-2227.453) (-2233.319) [-2228.919] (-2229.037) -- 0:00:50
      296000 -- (-2226.471) [-2226.621] (-2226.176) (-2226.971) * (-2226.231) (-2227.015) [-2228.105] (-2226.504) -- 0:00:49
      296500 -- (-2225.158) (-2225.844) (-2226.292) [-2227.997] * (-2227.032) (-2231.180) (-2229.406) [-2226.635] -- 0:00:49
      297000 -- (-2226.605) (-2225.159) [-2226.518] (-2225.053) * (-2226.420) (-2230.418) [-2227.046] (-2227.881) -- 0:00:49
      297500 -- [-2226.935] (-2226.234) (-2227.637) (-2228.569) * (-2225.628) [-2226.804] (-2224.765) (-2226.248) -- 0:00:49
      298000 -- (-2227.732) (-2225.221) (-2225.505) [-2226.132] * (-2225.631) (-2226.459) [-2225.022] (-2227.338) -- 0:00:49
      298500 -- (-2228.039) (-2228.693) (-2225.934) [-2226.154] * (-2225.642) (-2227.563) [-2226.308] (-2230.376) -- 0:00:49
      299000 -- [-2226.412] (-2229.531) (-2225.983) (-2227.485) * (-2225.897) [-2226.802] (-2225.497) (-2226.822) -- 0:00:49
      299500 -- [-2226.319] (-2230.220) (-2225.247) (-2228.416) * (-2225.964) [-2228.459] (-2225.345) (-2226.463) -- 0:00:49
      300000 -- (-2224.696) [-2226.749] (-2227.070) (-2225.997) * (-2225.220) [-2227.538] (-2224.845) (-2226.934) -- 0:00:48

      Average standard deviation of split frequencies: 0.013675

      300500 -- (-2224.952) (-2228.369) (-2228.510) [-2226.087] * [-2225.013] (-2226.920) (-2225.522) (-2227.126) -- 0:00:48
      301000 -- (-2225.782) (-2226.710) (-2229.216) [-2225.185] * (-2225.879) (-2227.037) [-2225.708] (-2227.629) -- 0:00:48
      301500 -- (-2227.061) (-2226.708) [-2226.137] (-2225.432) * (-2225.704) (-2228.352) [-2226.199] (-2226.702) -- 0:00:48
      302000 -- (-2230.474) (-2226.264) (-2225.098) [-2225.142] * (-2225.101) (-2225.987) [-2224.828] (-2227.109) -- 0:00:48
      302500 -- (-2228.954) [-2225.052] (-2225.481) (-2225.244) * (-2225.042) (-2228.611) [-2226.031] (-2228.329) -- 0:00:48
      303000 -- (-2228.560) (-2227.662) [-2225.349] (-2224.936) * (-2224.964) [-2227.364] (-2226.084) (-2229.689) -- 0:00:48
      303500 -- (-2226.001) (-2227.802) [-2226.568] (-2226.121) * [-2225.422] (-2226.436) (-2225.635) (-2227.646) -- 0:00:48
      304000 -- [-2225.498] (-2226.588) (-2226.095) (-2228.734) * [-2227.320] (-2226.430) (-2226.378) (-2229.673) -- 0:00:48
      304500 -- (-2225.731) [-2226.174] (-2226.076) (-2230.080) * (-2226.218) (-2226.295) (-2226.701) [-2227.410] -- 0:00:47
      305000 -- [-2225.732] (-2226.877) (-2226.812) (-2229.251) * (-2227.371) (-2226.025) [-2227.647] (-2229.050) -- 0:00:47

      Average standard deviation of split frequencies: 0.013622

      305500 -- (-2227.788) (-2227.657) (-2227.205) [-2227.007] * (-2227.569) (-2227.189) (-2227.753) [-2224.823] -- 0:00:47
      306000 -- (-2226.723) [-2226.995] (-2231.511) (-2230.584) * (-2229.214) [-2231.678] (-2227.752) (-2226.804) -- 0:00:47
      306500 -- (-2226.055) [-2226.942] (-2226.750) (-2226.818) * (-2226.689) [-2231.377] (-2227.896) (-2226.273) -- 0:00:47
      307000 -- (-2225.936) (-2227.623) [-2225.424] (-2229.237) * (-2226.995) (-2228.041) (-2226.604) [-2225.432] -- 0:00:49
      307500 -- (-2225.275) (-2226.379) (-2225.946) [-2231.438] * (-2228.046) [-2228.886] (-2227.339) (-2226.030) -- 0:00:49
      308000 -- [-2225.211] (-2227.141) (-2225.081) (-2225.830) * (-2231.962) (-2227.169) [-2228.127] (-2226.879) -- 0:00:49
      308500 -- (-2224.913) (-2231.735) [-2226.445] (-2225.815) * (-2227.611) (-2228.925) [-2226.786] (-2226.098) -- 0:00:49
      309000 -- (-2226.018) (-2234.240) [-2227.896] (-2227.774) * (-2227.788) (-2226.527) [-2227.501] (-2226.855) -- 0:00:49
      309500 -- (-2231.163) (-2231.305) [-2225.574] (-2228.637) * [-2230.462] (-2226.907) (-2238.440) (-2228.013) -- 0:00:49
      310000 -- [-2228.126] (-2230.904) (-2226.904) (-2229.603) * [-2227.130] (-2226.592) (-2230.388) (-2227.450) -- 0:00:48

      Average standard deviation of split frequencies: 0.014078

      310500 -- (-2227.964) (-2227.145) [-2229.781] (-2228.146) * (-2228.318) [-2227.121] (-2227.797) (-2225.954) -- 0:00:48
      311000 -- [-2229.670] (-2229.276) (-2225.470) (-2226.605) * (-2226.672) (-2226.926) (-2227.782) [-2226.108] -- 0:00:48
      311500 -- [-2224.950] (-2229.177) (-2225.418) (-2227.331) * (-2226.225) (-2226.347) (-2225.223) [-2227.754] -- 0:00:48
      312000 -- (-2226.947) (-2228.675) [-2225.769] (-2227.402) * (-2226.054) [-2225.594] (-2225.223) (-2226.235) -- 0:00:48
      312500 -- [-2225.057] (-2231.253) (-2225.266) (-2229.571) * (-2225.990) (-2226.427) [-2226.531] (-2225.164) -- 0:00:48
      313000 -- (-2225.640) (-2228.266) (-2225.700) [-2230.210] * [-2231.790] (-2224.829) (-2225.542) (-2225.062) -- 0:00:48
      313500 -- (-2227.103) (-2230.123) [-2225.533] (-2231.434) * (-2232.548) (-2226.402) (-2229.555) [-2225.272] -- 0:00:48
      314000 -- [-2227.433] (-2227.780) (-2225.147) (-2231.133) * (-2227.124) (-2224.836) (-2226.961) [-2224.903] -- 0:00:48
      314500 -- [-2225.920] (-2228.342) (-2225.291) (-2231.992) * [-2224.527] (-2225.037) (-2227.644) (-2225.068) -- 0:00:47
      315000 -- [-2225.612] (-2227.344) (-2225.591) (-2232.295) * (-2225.653) [-2232.266] (-2228.155) (-2224.753) -- 0:00:47

      Average standard deviation of split frequencies: 0.014172

      315500 -- (-2229.011) (-2229.951) [-2227.022] (-2226.975) * (-2227.099) (-2225.852) (-2225.792) [-2225.302] -- 0:00:47
      316000 -- (-2230.307) (-2227.541) (-2227.300) [-2227.272] * (-2228.505) (-2225.765) (-2225.658) [-2224.719] -- 0:00:47
      316500 -- (-2227.265) [-2225.313] (-2226.405) (-2224.758) * [-2227.115] (-2227.401) (-2225.658) (-2225.853) -- 0:00:47
      317000 -- (-2225.259) (-2226.173) (-2228.910) [-2224.757] * (-2226.498) (-2227.763) (-2226.853) [-2225.501] -- 0:00:47
      317500 -- (-2225.997) (-2228.658) (-2224.902) [-2224.791] * (-2226.797) [-2228.024] (-2225.818) (-2227.949) -- 0:00:47
      318000 -- (-2226.240) [-2227.262] (-2227.303) (-2224.790) * (-2226.827) (-2228.077) [-2226.412] (-2226.491) -- 0:00:47
      318500 -- (-2226.583) (-2227.387) (-2228.852) [-2224.795] * [-2227.171] (-2229.711) (-2229.428) (-2227.639) -- 0:00:47
      319000 -- (-2227.633) [-2225.940] (-2227.535) (-2225.470) * [-2227.898] (-2225.949) (-2231.118) (-2233.270) -- 0:00:46
      319500 -- [-2227.899] (-2232.529) (-2230.766) (-2224.852) * (-2227.754) [-2225.552] (-2232.144) (-2228.976) -- 0:00:46
      320000 -- (-2227.876) (-2227.317) (-2230.107) [-2224.916] * (-2225.264) (-2226.865) (-2228.758) [-2226.122] -- 0:00:46

      Average standard deviation of split frequencies: 0.014441

      320500 -- (-2226.331) (-2225.198) [-2228.489] (-2226.222) * [-2229.142] (-2225.655) (-2224.931) (-2226.134) -- 0:00:46
      321000 -- (-2226.292) [-2227.257] (-2229.295) (-2226.421) * (-2226.274) (-2226.311) [-2225.840] (-2225.460) -- 0:00:46
      321500 -- [-2227.438] (-2227.470) (-2229.860) (-2227.400) * [-2226.215] (-2228.392) (-2225.742) (-2225.448) -- 0:00:46
      322000 -- [-2227.051] (-2227.643) (-2231.952) (-2227.599) * (-2225.360) (-2227.539) [-2226.341] (-2225.662) -- 0:00:48
      322500 -- [-2225.911] (-2226.378) (-2230.101) (-2226.609) * (-2227.024) (-2225.176) (-2226.835) [-2225.517] -- 0:00:48
      323000 -- [-2228.870] (-2226.358) (-2227.468) (-2226.577) * [-2225.715] (-2225.874) (-2226.267) (-2226.798) -- 0:00:48
      323500 -- (-2227.316) (-2227.291) (-2226.917) [-2227.369] * [-2225.414] (-2225.967) (-2226.326) (-2227.818) -- 0:00:48
      324000 -- [-2226.853] (-2229.110) (-2228.682) (-2229.226) * (-2225.894) [-2226.301] (-2228.082) (-2229.210) -- 0:00:47
      324500 -- (-2228.333) (-2229.379) [-2226.083] (-2227.549) * (-2229.749) (-2227.501) [-2226.329] (-2227.914) -- 0:00:47
      325000 -- [-2226.314] (-2227.780) (-2226.992) (-2227.056) * [-2226.509] (-2226.858) (-2225.460) (-2227.323) -- 0:00:47

      Average standard deviation of split frequencies: 0.014232

      325500 -- (-2225.955) [-2226.288] (-2226.831) (-2228.670) * (-2226.195) [-2225.969] (-2226.648) (-2227.293) -- 0:00:47
      326000 -- (-2225.683) (-2225.714) (-2225.639) [-2226.290] * (-2226.846) (-2225.675) [-2226.700] (-2226.545) -- 0:00:47
      326500 -- (-2225.728) [-2228.843] (-2225.308) (-2226.787) * (-2226.846) (-2225.269) (-2227.771) [-2229.889] -- 0:00:47
      327000 -- (-2224.956) (-2227.354) [-2225.449] (-2228.361) * (-2228.057) (-2225.111) [-2229.937] (-2226.484) -- 0:00:47
      327500 -- (-2224.949) (-2227.240) (-2225.667) [-2231.569] * (-2228.957) [-2229.527] (-2227.455) (-2226.735) -- 0:00:47
      328000 -- (-2226.047) [-2225.676] (-2225.197) (-2227.060) * (-2226.556) (-2228.655) (-2226.106) [-2225.382] -- 0:00:47
      328500 -- (-2227.047) [-2225.621] (-2226.129) (-2227.472) * (-2227.345) (-2229.611) [-2226.329] (-2224.965) -- 0:00:47
      329000 -- (-2225.606) [-2226.366] (-2226.939) (-2225.417) * (-2227.345) (-2232.307) [-2229.024] (-2228.867) -- 0:00:46
      329500 -- [-2225.605] (-2225.795) (-2226.500) (-2225.467) * (-2224.701) (-2230.294) (-2225.470) [-2228.972] -- 0:00:46
      330000 -- (-2226.666) (-2227.949) (-2228.497) [-2225.655] * [-2226.108] (-2237.578) (-2226.548) (-2229.495) -- 0:00:46

      Average standard deviation of split frequencies: 0.013781

      330500 -- [-2230.238] (-2227.401) (-2227.578) (-2226.862) * [-2226.439] (-2230.920) (-2228.339) (-2225.658) -- 0:00:46
      331000 -- (-2228.958) (-2227.445) (-2226.108) [-2227.194] * (-2225.953) (-2229.023) (-2225.419) [-2225.329] -- 0:00:46
      331500 -- (-2227.919) [-2226.404] (-2226.663) (-2225.767) * [-2225.743] (-2227.876) (-2224.986) (-2225.367) -- 0:00:46
      332000 -- (-2225.063) [-2228.508] (-2226.895) (-2225.857) * (-2225.808) [-2225.258] (-2224.683) (-2225.944) -- 0:00:46
      332500 -- (-2225.702) (-2226.774) (-2226.895) [-2226.301] * (-2225.901) (-2226.362) (-2226.722) [-2225.986] -- 0:00:46
      333000 -- [-2226.401] (-2227.108) (-2225.651) (-2227.750) * (-2225.714) [-2226.498] (-2225.567) (-2225.200) -- 0:00:46
      333500 -- (-2227.265) (-2225.538) [-2227.443] (-2225.923) * (-2225.725) (-2225.682) [-2226.970] (-2225.245) -- 0:00:45
      334000 -- [-2230.777] (-2225.067) (-2227.602) (-2229.853) * [-2225.713] (-2225.643) (-2226.370) (-2227.425) -- 0:00:45
      334500 -- (-2226.971) [-2225.939] (-2226.246) (-2225.058) * (-2225.412) (-2225.602) (-2226.147) [-2225.544] -- 0:00:45
      335000 -- (-2227.927) [-2225.061] (-2229.371) (-2230.674) * (-2226.972) (-2225.804) (-2225.060) [-2224.887] -- 0:00:45

      Average standard deviation of split frequencies: 0.014186

      335500 -- [-2226.599] (-2226.605) (-2230.435) (-2226.289) * (-2226.002) (-2228.910) (-2225.032) [-2226.178] -- 0:00:45
      336000 -- (-2229.594) [-2225.453] (-2228.419) (-2226.946) * [-2226.957] (-2227.004) (-2225.041) (-2227.271) -- 0:00:47
      336500 -- (-2230.243) (-2225.522) (-2229.690) [-2225.938] * [-2225.407] (-2225.955) (-2226.356) (-2225.841) -- 0:00:47
      337000 -- (-2227.469) [-2225.240] (-2226.790) (-2227.993) * (-2228.175) (-2227.009) [-2225.984] (-2226.152) -- 0:00:47
      337500 -- [-2227.669] (-2226.768) (-2230.904) (-2229.064) * [-2230.550] (-2228.058) (-2227.414) (-2226.347) -- 0:00:47
      338000 -- (-2226.484) [-2227.463] (-2227.873) (-2228.612) * (-2227.785) [-2227.477] (-2227.892) (-2228.121) -- 0:00:47
      338500 -- [-2226.304] (-2227.447) (-2225.904) (-2229.301) * [-2225.280] (-2227.909) (-2227.695) (-2229.488) -- 0:00:46
      339000 -- (-2226.614) [-2225.860] (-2227.580) (-2226.692) * (-2226.566) (-2225.632) (-2227.688) [-2228.282] -- 0:00:46
      339500 -- (-2227.981) [-2228.170] (-2228.130) (-2225.973) * (-2226.977) [-2227.796] (-2229.025) (-2227.337) -- 0:00:46
      340000 -- [-2230.216] (-2231.236) (-2231.095) (-2229.313) * (-2228.221) [-2227.661] (-2227.493) (-2226.022) -- 0:00:46

      Average standard deviation of split frequencies: 0.015145

      340500 -- [-2226.559] (-2231.236) (-2229.039) (-2226.753) * (-2230.438) (-2231.588) [-2228.985] (-2225.822) -- 0:00:46
      341000 -- [-2225.208] (-2227.049) (-2227.198) (-2225.618) * (-2228.318) (-2228.402) [-2225.297] (-2226.751) -- 0:00:46
      341500 -- (-2225.165) [-2225.173] (-2229.293) (-2231.265) * (-2229.120) [-2229.051] (-2225.299) (-2226.270) -- 0:00:46
      342000 -- [-2226.940] (-2225.170) (-2226.402) (-2231.047) * [-2226.751] (-2229.803) (-2226.229) (-2226.379) -- 0:00:46
      342500 -- (-2227.848) (-2226.937) (-2227.674) [-2225.931] * (-2226.202) (-2226.357) [-2226.242] (-2226.167) -- 0:00:46
      343000 -- (-2228.305) (-2226.360) (-2227.775) [-2224.893] * (-2225.109) (-2226.208) (-2228.205) [-2225.938] -- 0:00:45
      343500 -- (-2225.927) (-2225.299) (-2226.571) [-2226.730] * [-2224.887] (-2226.224) (-2225.975) (-2227.675) -- 0:00:45
      344000 -- (-2228.951) (-2225.919) [-2230.815] (-2226.609) * (-2225.609) (-2225.875) (-2226.624) [-2225.114] -- 0:00:45
      344500 -- (-2231.650) (-2226.075) [-2227.689] (-2226.542) * (-2226.746) (-2226.505) (-2225.584) [-2225.973] -- 0:00:45
      345000 -- (-2228.822) (-2225.906) [-2224.668] (-2226.326) * (-2225.641) (-2229.417) (-2225.864) [-2226.116] -- 0:00:45

      Average standard deviation of split frequencies: 0.014154

      345500 -- [-2228.128] (-2226.127) (-2226.410) (-2226.811) * (-2226.010) [-2226.098] (-2226.035) (-2227.416) -- 0:00:45
      346000 -- (-2233.057) (-2225.800) [-2226.769] (-2226.826) * [-2225.241] (-2225.541) (-2226.706) (-2226.997) -- 0:00:45
      346500 -- (-2232.604) (-2224.932) (-2228.114) [-2226.591] * (-2225.413) [-2224.921] (-2226.654) (-2227.431) -- 0:00:45
      347000 -- [-2227.290] (-2226.662) (-2225.538) (-2225.346) * [-2226.108] (-2225.740) (-2227.797) (-2227.038) -- 0:00:45
      347500 -- (-2227.109) [-2227.502] (-2229.530) (-2228.036) * (-2227.516) [-2227.968] (-2233.720) (-2230.342) -- 0:00:45
      348000 -- [-2227.002] (-2228.286) (-2228.987) (-2224.630) * [-2229.658] (-2227.826) (-2230.339) (-2231.267) -- 0:00:44
      348500 -- (-2226.645) (-2228.722) [-2225.282] (-2227.361) * (-2225.228) [-2225.691] (-2236.525) (-2232.095) -- 0:00:44
      349000 -- [-2227.521] (-2226.167) (-2225.373) (-2225.222) * (-2226.224) [-2226.187] (-2232.335) (-2225.801) -- 0:00:44
      349500 -- (-2227.406) (-2226.427) [-2227.512] (-2226.591) * [-2225.995] (-2228.691) (-2228.516) (-2225.628) -- 0:00:44
      350000 -- (-2228.381) (-2226.175) [-2226.084] (-2226.069) * (-2225.100) [-2225.339] (-2226.861) (-2225.184) -- 0:00:44

      Average standard deviation of split frequencies: 0.014041

      350500 -- (-2230.714) (-2231.670) [-2227.764] (-2225.552) * [-2232.690] (-2227.912) (-2226.801) (-2225.626) -- 0:00:46
      351000 -- (-2232.500) (-2229.905) (-2226.899) [-2225.571] * [-2225.574] (-2227.676) (-2228.181) (-2225.296) -- 0:00:46
      351500 -- (-2230.181) [-2227.585] (-2228.135) (-2225.037) * [-2225.319] (-2227.348) (-2227.779) (-2225.091) -- 0:00:46
      352000 -- (-2229.349) [-2225.421] (-2226.004) (-2224.936) * (-2225.340) (-2226.563) [-2225.337] (-2228.812) -- 0:00:46
      352500 -- [-2228.339] (-2225.551) (-2226.210) (-2228.006) * [-2225.357] (-2227.533) (-2226.148) (-2229.865) -- 0:00:45
      353000 -- (-2228.028) (-2227.621) (-2226.525) [-2228.323] * (-2225.453) (-2227.543) (-2228.717) [-2227.949] -- 0:00:45
      353500 -- (-2229.146) (-2226.378) (-2226.234) [-2227.749] * (-2225.209) [-2227.077] (-2227.149) (-2227.857) -- 0:00:45
      354000 -- (-2226.403) (-2228.305) [-2224.803] (-2226.524) * (-2228.753) (-2226.129) [-2227.331] (-2227.131) -- 0:00:45
      354500 -- (-2226.253) (-2229.038) [-2225.469] (-2227.496) * (-2227.574) (-2225.884) [-2225.929] (-2227.634) -- 0:00:45
      355000 -- (-2226.179) (-2227.700) (-2227.467) [-2227.505] * (-2228.440) (-2225.894) [-2226.655] (-2229.400) -- 0:00:45

      Average standard deviation of split frequencies: 0.013904

      355500 -- (-2228.565) (-2227.843) [-2226.221] (-2225.304) * [-2228.027] (-2226.406) (-2228.122) (-2229.667) -- 0:00:45
      356000 -- (-2227.211) (-2229.355) [-2225.692] (-2225.797) * [-2226.138] (-2226.513) (-2226.196) (-2226.801) -- 0:00:45
      356500 -- (-2227.550) (-2226.175) [-2226.402] (-2228.784) * [-2225.955] (-2226.322) (-2227.841) (-2226.665) -- 0:00:45
      357000 -- (-2226.476) (-2224.716) (-2231.022) [-2226.946] * (-2226.773) [-2226.322] (-2225.335) (-2227.284) -- 0:00:45
      357500 -- (-2227.714) [-2227.838] (-2230.222) (-2226.390) * (-2226.720) [-2226.316] (-2227.794) (-2228.551) -- 0:00:44
      358000 -- (-2227.684) (-2227.834) [-2227.087] (-2225.991) * (-2225.250) (-2227.588) [-2227.609] (-2228.506) -- 0:00:44
      358500 -- (-2227.818) (-2228.277) [-2228.082] (-2228.498) * (-2225.831) [-2226.509] (-2225.802) (-2227.248) -- 0:00:44
      359000 -- (-2227.449) (-2225.432) (-2229.629) [-2227.002] * (-2227.089) (-2226.914) [-2227.511] (-2229.072) -- 0:00:44
      359500 -- (-2226.793) (-2228.017) [-2227.917] (-2227.201) * (-2227.258) [-2225.238] (-2227.941) (-2230.125) -- 0:00:44
      360000 -- [-2227.581] (-2226.877) (-2225.759) (-2225.385) * (-2226.350) (-2225.662) [-2227.946] (-2230.114) -- 0:00:44

      Average standard deviation of split frequencies: 0.014301

      360500 -- (-2226.968) (-2226.215) (-2226.430) [-2225.416] * [-2229.499] (-2229.289) (-2228.385) (-2229.607) -- 0:00:44
      361000 -- (-2225.229) (-2229.420) [-2227.992] (-2226.619) * (-2229.660) [-2226.187] (-2225.881) (-2228.940) -- 0:00:44
      361500 -- (-2225.271) [-2227.063] (-2225.532) (-2226.064) * (-2228.490) (-2226.485) (-2230.331) [-2230.889] -- 0:00:44
      362000 -- [-2227.752] (-2227.273) (-2226.753) (-2225.064) * (-2225.183) (-2225.487) [-2229.992] (-2233.500) -- 0:00:44
      362500 -- [-2226.564] (-2225.000) (-2227.447) (-2225.428) * (-2226.472) (-2227.314) [-2225.542] (-2229.700) -- 0:00:43
      363000 -- [-2226.869] (-2224.826) (-2227.349) (-2226.515) * (-2226.477) [-2225.997] (-2225.525) (-2225.331) -- 0:00:43
      363500 -- (-2227.716) (-2224.762) [-2229.088] (-2226.665) * (-2227.116) (-2233.204) [-222