--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:54:13 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1829/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -509.72 -512.97
2 -509.70 -513.14
--------------------------------------
TOTAL -509.71 -513.06
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896317 0.091299 0.370767 1.497552 0.861194 1301.42 1401.21 1.000
r(A<->C){all} 0.173371 0.021769 0.000006 0.477635 0.133155 230.30 287.97 1.000
r(A<->G){all} 0.158302 0.017592 0.000055 0.424371 0.125572 277.87 343.90 1.002
r(A<->T){all} 0.170954 0.019100 0.000026 0.444903 0.140646 201.74 239.85 1.000
r(C<->G){all} 0.163259 0.019414 0.000192 0.438593 0.125586 191.08 206.50 1.003
r(C<->T){all} 0.168732 0.020077 0.000066 0.443045 0.132555 179.13 221.88 1.001
r(G<->T){all} 0.165381 0.020818 0.000006 0.455956 0.126109 206.18 225.82 1.000
pi(A){all} 0.224445 0.000439 0.184482 0.267419 0.224292 1201.86 1297.81 1.002
pi(C){all} 0.332292 0.000589 0.286077 0.382628 0.331999 1048.97 1121.39 1.001
pi(G){all} 0.276871 0.000510 0.235466 0.324590 0.276586 1054.69 1097.69 1.000
pi(T){all} 0.166392 0.000364 0.129413 0.201974 0.165688 1062.95 1200.26 1.000
alpha{1,2} 0.412611 0.225093 0.000183 1.367010 0.242858 1091.46 1119.08 1.000
alpha{3} 0.459195 0.240542 0.000246 1.457568 0.306271 1288.39 1335.07 1.000
pinvar{all} 0.995592 0.000029 0.985125 0.999997 0.997325 1473.41 1487.20 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -488.955332
Model 2: PositiveSelection -488.95533
Model 0: one-ratio -488.95534
Model 7: beta -488.955334
Model 8: beta&w>1 -488.955333
Model 0 vs 1 1.5999999959603883E-5
Model 2 vs 1 3.999999989900971E-6
Model 8 vs 7 1.9999999949504854E-6
>C1
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C2
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C3
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C4
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C5
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C6
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=125
C1 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C2 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C3 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C4 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C5 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C6 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
**************************************************
C1 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C2 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C3 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C4 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C5 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C6 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
**************************************************
C1 FGVDNHVDAEWLKLTSLGLRPRAIR
C2 FGVDNHVDAEWLKLTSLGLRPRAIR
C3 FGVDNHVDAEWLKLTSLGLRPRAIR
C4 FGVDNHVDAEWLKLTSLGLRPRAIR
C5 FGVDNHVDAEWLKLTSLGLRPRAIR
C6 FGVDNHVDAEWLKLTSLGLRPRAIR
*************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3750]--->[3750]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.460 Mb, Max= 30.654 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C2 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C3 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C4 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C5 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C6 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
**************************************************
C1 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C2 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C3 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C4 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C5 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C6 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
**************************************************
C1 FGVDNHVDAEWLKLTSLGLRPRAIR
C2 FGVDNHVDAEWLKLTSLGLRPRAIR
C3 FGVDNHVDAEWLKLTSLGLRPRAIR
C4 FGVDNHVDAEWLKLTSLGLRPRAIR
C5 FGVDNHVDAEWLKLTSLGLRPRAIR
C6 FGVDNHVDAEWLKLTSLGLRPRAIR
*************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
C2 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
C3 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
C4 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
C5 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
C6 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
**************************************************
C1 ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
C2 ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
C3 ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
C4 ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
C5 ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
C6 ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
**************************************************
C1 ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
C2 ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
C3 ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
C4 ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
C5 ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
C6 ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
**************************************************
C1 GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
C2 GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
C3 GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
C4 GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
C5 GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
C6 GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
**************************************************
C1 CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
C2 CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
C3 CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
C4 CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
C5 CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
C6 CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
**************************************************
C1 ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
C2 ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
C3 ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
C4 ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
C5 ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
C6 ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
**************************************************
C1 TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
C2 TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
C3 TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
C4 TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
C5 TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
C6 TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
**************************************************
C1 AGGCCTTAGGCCGCGTGCAATTAGG
C2 AGGCCTTAGGCCGCGTGCAATTAGG
C3 AGGCCTTAGGCCGCGTGCAATTAGG
C4 AGGCCTTAGGCCGCGTGCAATTAGG
C5 AGGCCTTAGGCCGCGTGCAATTAGG
C6 AGGCCTTAGGCCGCGTGCAATTAGG
*************************
>C1
GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
AGGCCTTAGGCCGCGTGCAATTAGG
>C2
GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
AGGCCTTAGGCCGCGTGCAATTAGG
>C3
GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
AGGCCTTAGGCCGCGTGCAATTAGG
>C4
GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
AGGCCTTAGGCCGCGTGCAATTAGG
>C5
GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
AGGCCTTAGGCCGCGTGCAATTAGG
>C6
GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
AGGCCTTAGGCCGCGTGCAATTAGG
>C1
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C2
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C3
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C4
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C5
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C6
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 375 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579859576
Setting output file names to "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 119450550
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5299824772
Seed = 1845484020
Swapseed = 1579859576
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -839.267981 -- -24.965149
Chain 2 -- -839.267933 -- -24.965149
Chain 3 -- -839.267981 -- -24.965149
Chain 4 -- -839.267933 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -839.267933 -- -24.965149
Chain 2 -- -839.267981 -- -24.965149
Chain 3 -- -839.267981 -- -24.965149
Chain 4 -- -839.267981 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-839.268] (-839.268) (-839.268) (-839.268) * [-839.268] (-839.268) (-839.268) (-839.268)
500 -- (-522.676) (-520.007) (-530.036) [-520.075] * (-527.828) (-515.009) (-528.880) [-531.408] -- 0:00:00
1000 -- (-518.820) (-515.527) (-520.184) [-519.297] * (-521.667) (-523.264) [-518.512] (-518.394) -- 0:00:00
1500 -- (-522.159) (-523.459) (-515.860) [-517.241] * (-522.895) (-525.974) [-524.969] (-523.204) -- 0:00:00
2000 -- (-526.384) (-516.951) [-520.785] (-514.840) * (-518.632) (-516.333) (-524.640) [-515.088] -- 0:00:00
2500 -- [-521.798] (-525.609) (-516.155) (-521.425) * (-521.064) (-519.982) [-521.867] (-524.842) -- 0:00:00
3000 -- (-520.342) [-520.642] (-524.186) (-523.755) * (-521.019) [-516.134] (-514.228) (-526.419) -- 0:00:00
3500 -- (-525.578) (-526.141) (-512.925) [-518.880] * (-521.969) (-516.320) (-518.217) [-519.339] -- 0:00:00
4000 -- (-527.410) [-516.031] (-522.127) (-516.658) * (-520.038) (-516.684) (-521.998) [-518.551] -- 0:00:00
4500 -- (-514.822) (-517.134) [-519.956] (-521.173) * (-518.161) [-516.789] (-519.346) (-520.525) -- 0:00:00
5000 -- [-521.166] (-516.539) (-515.581) (-517.363) * (-524.961) (-522.046) [-520.306] (-514.843) -- 0:00:00
Average standard deviation of split frequencies: 0.081983
5500 -- (-520.278) (-519.113) (-524.054) [-521.266] * (-516.984) (-523.335) (-518.325) [-517.909] -- 0:00:00
6000 -- (-514.897) (-523.935) (-518.806) [-519.873] * (-519.867) (-522.722) [-521.761] (-520.846) -- 0:00:00
6500 -- [-520.083] (-516.176) (-520.396) (-532.468) * (-530.188) [-516.521] (-522.387) (-520.853) -- 0:00:00
7000 -- (-527.398) (-528.093) (-519.422) [-520.525] * (-519.378) (-521.353) [-520.867] (-524.231) -- 0:00:00
7500 -- [-519.598] (-525.053) (-516.958) (-530.598) * (-523.566) (-521.021) [-522.512] (-520.792) -- 0:02:12
8000 -- (-523.103) (-521.773) (-520.342) [-524.089] * (-524.931) (-516.357) (-524.206) [-517.522] -- 0:02:04
8500 -- (-528.786) (-525.615) (-529.446) [-532.374] * (-510.781) [-517.584] (-525.305) (-519.987) -- 0:01:56
9000 -- [-525.836] (-511.850) (-522.839) (-529.609) * (-509.329) (-524.999) (-530.279) [-516.715] -- 0:01:50
9500 -- [-526.085] (-524.159) (-521.897) (-517.655) * (-513.194) (-517.046) [-516.995] (-524.833) -- 0:01:44
10000 -- [-517.140] (-522.234) (-521.024) (-514.442) * (-513.279) (-521.383) [-520.014] (-518.202) -- 0:01:39
Average standard deviation of split frequencies: 0.064991
10500 -- [-516.269] (-547.162) (-524.558) (-511.632) * (-515.241) (-518.292) [-520.819] (-526.008) -- 0:01:34
11000 -- (-521.209) (-520.036) (-524.123) [-513.732] * (-510.295) (-523.065) (-519.912) [-512.190] -- 0:01:29
11500 -- (-525.287) (-517.209) (-528.461) [-509.974] * (-510.953) (-518.871) [-518.114] (-510.269) -- 0:01:25
12000 -- (-526.772) [-513.271] (-531.906) (-509.819) * (-510.846) [-523.328] (-519.172) (-510.042) -- 0:01:22
12500 -- (-523.799) (-508.774) (-522.399) [-509.974] * (-511.053) (-517.821) [-515.540] (-515.666) -- 0:01:19
13000 -- [-521.590] (-510.801) (-520.219) (-509.800) * (-516.819) (-519.191) [-518.308] (-511.161) -- 0:01:15
13500 -- (-514.316) [-510.501] (-526.054) (-513.497) * (-510.096) (-535.586) (-524.471) [-510.887] -- 0:01:13
14000 -- [-519.905] (-512.236) (-517.325) (-508.825) * (-509.014) [-521.478] (-516.546) (-510.448) -- 0:01:10
14500 -- (-517.552) (-510.303) (-523.602) [-510.802] * (-509.694) [-524.621] (-519.735) (-515.176) -- 0:01:07
15000 -- (-518.838) (-510.416) (-516.764) [-509.670] * [-511.088] (-541.252) (-518.127) (-514.267) -- 0:01:05
Average standard deviation of split frequencies: 0.051560
15500 -- (-515.544) [-510.811] (-520.538) (-508.838) * (-509.556) (-524.422) [-521.035] (-511.229) -- 0:01:03
16000 -- (-521.379) (-510.888) [-516.164] (-511.405) * (-510.603) [-508.518] (-528.279) (-511.391) -- 0:01:01
16500 -- (-519.009) (-509.289) [-516.304] (-512.036) * (-513.584) [-508.782] (-517.759) (-510.530) -- 0:00:59
17000 -- (-527.334) [-510.217] (-523.329) (-509.124) * [-508.590] (-510.358) (-522.656) (-510.005) -- 0:00:57
17500 -- (-514.165) [-508.562] (-529.223) (-513.356) * [-511.672] (-509.257) (-515.234) (-510.039) -- 0:00:56
18000 -- (-521.284) (-510.720) (-528.972) [-510.661] * [-510.488] (-512.028) (-512.835) (-512.806) -- 0:00:54
18500 -- (-522.998) (-514.511) [-517.776] (-511.313) * [-510.395] (-510.271) (-522.783) (-509.341) -- 0:00:53
19000 -- (-519.186) (-512.573) (-525.852) [-509.186] * (-510.302) [-510.417] (-517.870) (-508.855) -- 0:00:51
19500 -- (-523.299) [-517.156] (-515.100) (-510.511) * [-508.561] (-509.150) (-522.217) (-513.014) -- 0:00:50
20000 -- (-527.326) (-511.927) (-525.153) [-508.824] * (-509.680) (-512.233) (-513.662) [-512.839] -- 0:00:49
Average standard deviation of split frequencies: 0.059876
20500 -- [-515.824] (-510.183) (-522.702) (-508.843) * (-510.723) (-511.002) [-514.554] (-510.204) -- 0:00:47
21000 -- [-517.250] (-508.562) (-518.409) (-510.532) * (-510.199) [-509.514] (-517.201) (-510.148) -- 0:00:46
21500 -- (-520.840) [-510.969] (-520.850) (-509.298) * (-509.687) (-509.501) (-519.520) [-511.285] -- 0:00:45
22000 -- (-520.683) [-509.611] (-516.662) (-508.811) * (-508.296) (-509.045) [-521.901] (-509.776) -- 0:01:28
22500 -- [-513.907] (-510.572) (-528.416) (-508.865) * (-510.743) (-508.562) (-525.276) [-508.753] -- 0:01:26
23000 -- (-519.152) (-510.760) [-517.932] (-512.287) * [-508.276] (-510.706) (-527.379) (-509.856) -- 0:01:24
23500 -- (-519.325) [-509.046] (-516.855) (-511.221) * (-511.101) (-513.003) [-514.542] (-511.839) -- 0:01:23
24000 -- (-518.614) (-512.917) [-520.064] (-513.262) * (-514.320) (-510.184) [-514.116] (-512.897) -- 0:01:21
24500 -- (-521.060) (-511.712) (-522.095) [-513.219] * (-511.858) (-509.671) (-519.788) [-509.199] -- 0:01:19
25000 -- (-518.674) (-510.691) (-522.782) [-509.373] * (-513.523) (-510.272) (-512.898) [-509.134] -- 0:01:18
Average standard deviation of split frequencies: 0.043061
25500 -- (-516.803) (-511.879) (-524.815) [-510.468] * (-512.336) [-510.199] (-519.120) (-512.624) -- 0:01:16
26000 -- (-522.456) (-509.706) [-514.808] (-510.499) * (-511.679) (-510.152) (-521.859) [-513.498] -- 0:01:14
26500 -- [-519.363] (-511.052) (-521.748) (-508.823) * (-514.149) (-510.160) [-521.879] (-510.581) -- 0:01:13
27000 -- (-518.614) (-510.982) [-523.372] (-512.846) * [-509.841] (-509.566) (-520.104) (-508.805) -- 0:01:12
27500 -- [-520.525] (-511.090) (-519.686) (-511.384) * [-509.357] (-511.826) (-526.652) (-510.934) -- 0:01:10
28000 -- [-518.853] (-511.541) (-522.204) (-509.894) * [-509.263] (-509.583) (-519.233) (-509.001) -- 0:01:09
28500 -- (-519.624) (-509.695) [-516.788] (-509.612) * (-512.110) [-510.905] (-518.833) (-510.276) -- 0:01:08
29000 -- (-518.937) (-509.312) [-514.258] (-512.158) * [-509.385] (-508.574) (-519.035) (-511.825) -- 0:01:06
29500 -- [-512.488] (-509.682) (-522.323) (-509.547) * (-510.128) (-512.756) [-516.896] (-511.747) -- 0:01:05
30000 -- (-518.841) (-509.367) [-516.084] (-509.489) * (-511.322) [-512.779] (-519.985) (-510.342) -- 0:01:04
Average standard deviation of split frequencies: 0.043689
30500 -- (-515.823) [-513.210] (-528.167) (-511.237) * (-509.841) (-511.228) (-526.094) [-513.162] -- 0:01:03
31000 -- (-527.116) [-508.673] (-516.017) (-511.022) * (-513.384) [-511.970] (-526.064) (-510.978) -- 0:01:02
31500 -- (-517.993) [-509.723] (-529.915) (-509.386) * (-510.377) (-514.236) [-517.969] (-508.283) -- 0:01:01
32000 -- (-521.949) [-510.207] (-531.264) (-509.082) * (-508.945) (-511.237) [-522.494] (-512.949) -- 0:01:00
32500 -- [-519.100] (-510.371) (-510.562) (-510.371) * (-509.052) [-509.785] (-533.258) (-514.549) -- 0:00:59
33000 -- (-519.639) (-513.109) [-512.283] (-510.274) * (-508.713) (-509.042) (-526.293) [-510.234] -- 0:00:58
33500 -- (-520.366) (-510.109) (-512.550) [-510.897] * (-509.102) (-513.645) [-516.066] (-513.912) -- 0:00:57
34000 -- (-549.052) (-511.399) (-508.648) [-510.558] * (-510.795) (-509.653) [-520.329] (-513.486) -- 0:00:56
34500 -- (-514.635) [-508.300] (-509.526) (-512.614) * [-513.343] (-514.041) (-528.355) (-509.759) -- 0:00:55
35000 -- (-511.927) (-512.192) (-510.662) [-509.150] * (-510.691) (-509.240) (-519.901) [-510.167] -- 0:00:55
Average standard deviation of split frequencies: 0.031703
35500 -- (-513.817) [-509.064] (-513.821) (-508.652) * (-511.048) [-508.467] (-515.060) (-511.476) -- 0:00:54
36000 -- (-511.843) [-515.033] (-508.730) (-509.277) * (-515.040) (-513.247) [-523.297] (-509.447) -- 0:00:53
36500 -- (-508.545) (-510.419) (-509.090) [-510.116] * (-509.217) (-517.411) [-521.845] (-510.004) -- 0:00:52
37000 -- [-509.560] (-514.117) (-509.892) (-511.342) * [-511.834] (-510.265) (-529.000) (-515.460) -- 0:00:52
37500 -- (-509.981) [-509.243] (-509.744) (-510.930) * (-514.118) [-511.105] (-519.010) (-509.988) -- 0:00:51
38000 -- (-510.014) [-510.035] (-510.012) (-508.688) * [-517.099] (-514.175) (-516.312) (-510.388) -- 0:00:50
38500 -- (-509.194) (-511.830) (-511.602) [-512.923] * (-513.011) (-512.907) (-516.094) [-509.505] -- 0:01:14
39000 -- (-513.831) [-509.804] (-510.485) (-511.495) * [-508.752] (-510.727) (-522.168) (-514.142) -- 0:01:13
39500 -- (-509.219) (-516.897) (-510.134) [-509.590] * (-510.417) (-513.076) [-521.570] (-513.756) -- 0:01:12
40000 -- (-508.707) (-510.239) (-509.793) [-510.546] * (-511.185) [-508.848] (-522.904) (-511.479) -- 0:01:12
Average standard deviation of split frequencies: 0.028980
40500 -- (-509.426) [-511.615] (-514.042) (-510.601) * [-511.259] (-512.215) (-529.701) (-513.342) -- 0:01:11
41000 -- (-509.545) (-508.850) (-510.861) [-509.251] * (-511.539) [-509.441] (-526.821) (-514.542) -- 0:01:10
41500 -- [-512.358] (-509.642) (-509.597) (-513.009) * [-510.483] (-509.175) (-519.600) (-512.342) -- 0:01:09
42000 -- (-511.175) (-513.073) [-510.173] (-512.869) * (-510.526) (-510.050) [-515.893] (-516.260) -- 0:01:08
42500 -- (-511.157) (-513.026) (-512.491) [-510.634] * (-511.386) (-508.493) [-517.722] (-513.174) -- 0:01:07
43000 -- [-509.808] (-511.916) (-516.160) (-510.149) * (-512.066) (-509.145) [-527.024] (-512.061) -- 0:01:06
43500 -- (-511.135) [-509.000] (-508.843) (-513.670) * (-512.412) (-513.693) (-521.116) [-510.184] -- 0:01:05
44000 -- (-512.213) (-509.172) (-508.931) [-509.160] * [-512.268] (-513.754) (-523.081) (-512.939) -- 0:01:05
44500 -- (-512.009) (-508.603) (-509.001) [-510.275] * (-516.379) (-512.911) (-513.699) [-513.841] -- 0:01:04
45000 -- (-514.037) (-508.847) (-509.823) [-510.300] * (-514.296) [-510.013] (-520.273) (-514.870) -- 0:01:03
Average standard deviation of split frequencies: 0.025620
45500 -- (-514.515) [-509.165] (-508.633) (-510.309) * (-510.430) [-509.495] (-516.889) (-511.539) -- 0:01:02
46000 -- (-510.694) [-510.310] (-509.282) (-512.124) * (-513.351) [-509.530] (-516.278) (-509.857) -- 0:01:02
46500 -- [-509.023] (-510.326) (-510.281) (-513.191) * (-514.427) (-508.901) (-517.716) [-509.988] -- 0:01:01
47000 -- (-509.698) [-509.822] (-510.529) (-509.074) * (-508.957) (-509.594) (-520.985) [-511.547] -- 0:01:00
47500 -- (-509.036) (-511.263) [-508.290] (-510.908) * (-510.229) (-508.944) [-512.855] (-511.646) -- 0:01:00
48000 -- [-513.690] (-510.627) (-511.860) (-511.984) * (-511.586) (-511.854) [-515.602] (-511.407) -- 0:00:59
48500 -- (-511.888) [-509.254] (-509.910) (-510.815) * (-512.821) [-510.524] (-518.718) (-514.998) -- 0:00:58
49000 -- (-511.234) (-512.736) (-512.370) [-510.760] * (-509.384) [-510.145] (-519.179) (-509.806) -- 0:00:58
49500 -- (-508.299) (-510.450) (-508.613) [-508.969] * [-510.047] (-508.895) (-519.230) (-513.224) -- 0:00:57
50000 -- (-510.470) [-511.510] (-512.110) (-508.720) * (-509.137) [-512.281] (-520.858) (-509.397) -- 0:00:57
Average standard deviation of split frequencies: 0.029604
50500 -- (-509.362) (-510.438) (-510.345) [-510.717] * (-509.616) (-511.716) [-516.462] (-508.689) -- 0:00:56
51000 -- (-509.918) (-509.572) [-508.400] (-514.594) * (-512.075) (-510.148) [-520.576] (-509.706) -- 0:00:55
51500 -- (-508.934) [-510.785] (-509.778) (-510.996) * [-511.459] (-517.281) (-519.120) (-508.336) -- 0:00:55
52000 -- (-509.781) (-513.329) [-509.181] (-509.198) * (-511.128) (-513.729) [-516.212] (-510.486) -- 0:00:54
52500 -- [-511.636] (-511.397) (-508.740) (-508.939) * (-510.964) (-512.477) [-518.065] (-509.973) -- 0:00:54
53000 -- (-510.905) (-514.569) (-509.264) [-508.887] * (-510.370) (-516.749) (-523.748) [-511.489] -- 0:00:53
53500 -- (-514.591) (-510.522) (-509.670) [-508.544] * (-512.954) (-512.516) (-520.265) [-513.704] -- 0:00:53
54000 -- [-508.880] (-513.939) (-513.947) (-512.757) * (-510.178) (-511.718) (-517.728) [-511.138] -- 0:00:52
54500 -- [-510.640] (-509.685) (-509.885) (-508.659) * [-511.000] (-508.853) (-522.770) (-511.453) -- 0:00:52
55000 -- (-510.600) (-509.044) (-513.273) [-511.208] * (-510.460) (-510.163) (-538.412) [-508.903] -- 0:01:08
Average standard deviation of split frequencies: 0.029884
55500 -- (-509.266) (-511.208) [-514.079] (-508.910) * (-511.721) [-510.983] (-527.050) (-509.036) -- 0:01:08
56000 -- (-509.433) (-508.456) [-509.736] (-509.715) * (-509.692) (-509.677) (-510.925) [-508.526] -- 0:01:07
56500 -- (-509.411) (-509.374) [-510.477] (-509.969) * (-511.672) [-509.109] (-510.773) (-514.969) -- 0:01:06
57000 -- (-509.732) (-510.091) [-511.656] (-515.053) * (-509.228) [-509.160] (-511.270) (-510.747) -- 0:01:06
57500 -- (-509.605) (-510.180) (-509.803) [-510.664] * (-512.875) (-509.130) (-514.337) [-509.303] -- 0:01:05
58000 -- (-510.105) [-511.638] (-511.445) (-510.471) * (-509.731) (-510.334) (-513.686) [-511.170] -- 0:01:04
58500 -- (-510.264) (-510.217) (-515.320) [-510.029] * [-508.626] (-511.016) (-512.731) (-513.260) -- 0:01:04
59000 -- (-514.723) (-510.272) (-511.231) [-513.016] * [-509.312] (-515.422) (-512.456) (-511.369) -- 0:01:03
59500 -- (-509.675) [-510.106] (-512.909) (-510.685) * (-510.302) (-509.287) (-512.883) [-509.849] -- 0:01:03
60000 -- (-511.660) (-510.472) (-509.341) [-510.314] * (-510.439) (-509.466) [-509.886] (-509.872) -- 0:01:02
Average standard deviation of split frequencies: 0.028121
60500 -- (-509.426) [-509.681] (-509.509) (-511.171) * (-510.348) (-510.125) [-510.663] (-510.801) -- 0:01:02
61000 -- (-510.507) [-509.537] (-509.547) (-512.965) * [-511.522] (-511.137) (-514.027) (-509.108) -- 0:01:01
61500 -- (-512.486) (-509.240) [-509.852] (-510.725) * (-511.406) (-509.566) [-512.844] (-508.360) -- 0:01:01
62000 -- (-510.835) [-510.205] (-509.936) (-513.963) * (-510.426) [-509.430] (-510.660) (-510.138) -- 0:01:00
62500 -- (-512.007) (-516.024) (-514.122) [-509.327] * (-510.587) [-511.400] (-512.418) (-512.258) -- 0:01:00
63000 -- [-511.386] (-509.524) (-509.361) (-511.815) * (-512.299) [-508.968] (-510.325) (-510.864) -- 0:00:59
63500 -- (-509.686) (-511.790) [-509.179] (-509.188) * (-509.970) [-508.232] (-510.115) (-510.953) -- 0:00:58
64000 -- (-510.987) (-508.701) [-509.221] (-509.585) * [-512.698] (-509.483) (-509.993) (-512.074) -- 0:00:58
64500 -- (-509.248) (-510.024) (-510.151) [-510.135] * (-511.213) [-508.279] (-509.473) (-512.421) -- 0:00:58
65000 -- (-509.479) (-511.436) [-509.073] (-509.179) * (-510.988) (-509.582) [-509.640] (-511.429) -- 0:00:57
Average standard deviation of split frequencies: 0.024025
65500 -- (-512.316) [-510.793] (-508.966) (-509.135) * (-514.032) [-509.478] (-511.924) (-510.734) -- 0:00:57
66000 -- [-509.908] (-510.662) (-509.062) (-510.676) * (-510.384) [-509.537] (-509.465) (-509.815) -- 0:00:56
66500 -- (-509.736) [-509.915] (-510.079) (-512.600) * (-512.002) [-509.451] (-510.757) (-509.586) -- 0:00:56
67000 -- (-511.342) [-512.665] (-509.791) (-510.475) * (-508.753) [-512.080] (-512.594) (-513.640) -- 0:00:55
67500 -- (-508.415) (-512.263) (-509.203) [-509.375] * (-510.223) [-511.235] (-509.924) (-509.793) -- 0:00:55
68000 -- (-509.666) (-514.389) [-508.787] (-508.472) * (-509.104) [-513.102] (-509.694) (-510.574) -- 0:00:54
68500 -- (-510.102) (-509.247) (-510.310) [-509.595] * (-514.905) (-511.303) [-508.640] (-510.980) -- 0:00:54
69000 -- (-511.048) [-508.951] (-513.869) (-511.723) * [-515.658] (-513.525) (-508.119) (-509.240) -- 0:00:53
69500 -- (-510.385) [-511.704] (-513.353) (-509.209) * (-513.780) [-512.153] (-508.454) (-509.229) -- 0:00:53
70000 -- (-509.572) [-511.561] (-510.363) (-510.758) * (-514.085) [-508.873] (-509.167) (-508.478) -- 0:00:53
Average standard deviation of split frequencies: 0.028790
70500 -- (-508.961) [-510.461] (-510.964) (-515.707) * [-508.678] (-513.332) (-509.883) (-514.265) -- 0:00:52
71000 -- [-508.364] (-509.094) (-509.764) (-512.704) * (-509.186) (-509.376) [-508.643] (-511.661) -- 0:00:52
71500 -- (-509.003) (-511.124) [-511.119] (-509.748) * [-512.302] (-508.811) (-509.176) (-510.538) -- 0:00:51
72000 -- (-509.778) (-508.527) (-510.854) [-510.296] * [-509.572] (-509.862) (-509.031) (-511.582) -- 0:01:04
72500 -- (-512.006) (-511.150) [-510.833] (-511.486) * (-509.924) [-510.528] (-510.286) (-511.480) -- 0:01:03
73000 -- (-511.318) (-509.098) [-511.544] (-510.764) * [-512.244] (-510.537) (-508.398) (-508.868) -- 0:01:03
73500 -- (-512.260) (-509.532) [-509.385] (-509.660) * (-509.975) [-509.407] (-509.774) (-511.521) -- 0:01:03
74000 -- (-509.646) [-508.363] (-509.447) (-511.186) * (-517.081) (-510.411) (-511.651) [-510.941] -- 0:01:02
74500 -- [-509.681] (-509.700) (-511.072) (-509.323) * (-512.636) (-509.307) (-510.581) [-512.894] -- 0:01:02
75000 -- [-508.190] (-510.018) (-510.796) (-508.955) * (-512.705) (-509.482) (-511.923) [-511.407] -- 0:01:01
Average standard deviation of split frequencies: 0.031666
75500 -- [-511.376] (-508.674) (-508.739) (-509.205) * (-510.884) (-509.811) [-508.970] (-510.571) -- 0:01:01
76000 -- (-508.491) (-508.503) (-509.159) [-509.691] * (-511.613) [-510.313] (-509.129) (-509.317) -- 0:01:00
76500 -- (-511.166) [-510.660] (-510.003) (-509.785) * (-510.232) (-512.151) (-512.345) [-509.213] -- 0:01:00
77000 -- [-508.837] (-511.114) (-508.921) (-512.021) * (-512.203) (-515.505) [-510.731] (-513.859) -- 0:00:59
77500 -- (-511.497) (-508.799) (-514.838) [-511.257] * (-509.624) (-510.968) [-509.764] (-511.703) -- 0:00:59
78000 -- (-512.384) (-512.269) [-513.166] (-509.806) * (-510.010) (-510.525) [-509.896] (-510.667) -- 0:00:59
78500 -- (-510.432) (-512.916) [-509.514] (-512.944) * (-511.559) (-512.777) (-510.362) [-513.823] -- 0:00:58
79000 -- (-511.228) (-523.133) (-513.061) [-508.789] * [-511.306] (-512.288) (-509.003) (-509.268) -- 0:00:58
79500 -- [-509.234] (-510.754) (-514.537) (-510.757) * (-509.270) [-510.881] (-510.730) (-509.562) -- 0:00:57
80000 -- (-512.097) (-513.157) (-516.284) [-509.833] * (-509.062) (-510.789) [-509.849] (-510.704) -- 0:00:57
Average standard deviation of split frequencies: 0.032141
80500 -- (-517.321) [-511.303] (-509.644) (-509.863) * (-509.346) (-509.511) (-511.518) [-510.809] -- 0:00:57
81000 -- [-510.313] (-510.371) (-509.913) (-509.602) * (-508.929) (-512.061) (-510.315) [-508.858] -- 0:00:56
81500 -- (-509.292) (-510.163) [-509.370] (-508.962) * (-509.866) (-511.531) [-509.823] (-512.299) -- 0:00:56
82000 -- [-513.311] (-511.039) (-510.188) (-515.136) * [-510.404] (-508.704) (-509.760) (-511.241) -- 0:00:55
82500 -- (-509.653) [-509.534] (-510.585) (-511.755) * [-513.540] (-511.018) (-513.503) (-510.988) -- 0:00:55
83000 -- (-508.929) [-510.097] (-508.875) (-509.356) * [-510.447] (-509.251) (-513.004) (-512.864) -- 0:00:55
83500 -- (-510.829) (-510.206) [-509.773] (-511.972) * (-510.730) (-509.454) (-509.459) [-510.735] -- 0:00:54
84000 -- (-510.005) [-511.079] (-511.953) (-509.819) * (-512.163) [-509.344] (-513.829) (-509.437) -- 0:00:54
84500 -- (-510.719) [-510.589] (-512.134) (-510.357) * [-509.414] (-510.639) (-511.019) (-509.602) -- 0:00:54
85000 -- (-511.513) (-513.891) [-508.590] (-509.138) * (-511.141) (-515.622) [-509.609] (-510.370) -- 0:00:53
Average standard deviation of split frequencies: 0.032889
85500 -- (-510.249) (-511.009) [-510.326] (-510.967) * (-511.546) [-515.077] (-510.908) (-517.604) -- 0:00:53
86000 -- (-510.173) (-514.646) (-512.540) [-508.807] * (-512.379) (-509.204) [-510.914] (-513.785) -- 0:00:53
86500 -- (-513.659) (-511.660) (-509.420) [-508.877] * (-511.751) (-512.697) [-508.907] (-508.887) -- 0:00:52
87000 -- (-510.331) (-513.399) [-509.080] (-510.674) * [-509.827] (-511.263) (-510.006) (-510.105) -- 0:00:52
87500 -- (-513.354) [-509.313] (-513.841) (-510.739) * (-510.053) (-513.300) [-510.227] (-510.844) -- 0:00:52
88000 -- [-513.073] (-511.648) (-513.855) (-508.129) * (-509.928) (-508.814) (-509.990) [-515.332] -- 0:00:51
88500 -- (-508.707) (-509.284) (-511.493) [-508.278] * (-508.965) (-513.717) [-509.455] (-514.053) -- 0:01:01
89000 -- [-509.606] (-510.563) (-511.055) (-509.218) * (-512.246) (-515.884) (-512.103) [-510.989] -- 0:01:01
89500 -- [-509.509] (-511.685) (-517.224) (-509.563) * (-510.460) [-510.512] (-509.631) (-510.879) -- 0:01:01
90000 -- (-509.469) [-511.065] (-511.094) (-510.502) * [-515.777] (-509.146) (-509.499) (-512.427) -- 0:01:00
Average standard deviation of split frequencies: 0.033919
90500 -- [-509.191] (-515.837) (-510.181) (-509.138) * [-511.527] (-511.394) (-509.534) (-512.049) -- 0:01:00
91000 -- [-509.918] (-512.229) (-509.059) (-509.806) * (-509.906) [-510.036] (-509.475) (-508.226) -- 0:00:59
91500 -- (-509.030) (-509.105) (-511.832) [-509.374] * [-510.679] (-509.408) (-511.456) (-509.143) -- 0:00:59
92000 -- (-513.346) (-509.311) [-511.994] (-509.312) * [-511.318] (-511.061) (-511.437) (-508.227) -- 0:00:59
92500 -- (-509.306) (-514.408) (-509.612) [-509.581] * [-511.168] (-510.210) (-509.482) (-508.208) -- 0:00:58
93000 -- [-512.416] (-515.346) (-509.543) (-509.384) * (-512.211) (-512.798) (-512.286) [-509.773] -- 0:00:58
93500 -- (-510.201) (-510.589) [-509.501] (-509.734) * (-513.482) (-510.239) [-509.098] (-511.390) -- 0:00:58
94000 -- (-514.627) (-510.818) (-509.464) [-508.826] * (-513.918) (-509.892) [-512.065] (-509.727) -- 0:00:57
94500 -- (-511.271) [-510.266] (-508.898) (-510.216) * (-509.284) (-512.638) [-510.526] (-509.565) -- 0:00:57
95000 -- (-509.166) (-509.859) [-512.727] (-508.983) * (-508.664) (-510.686) [-508.254] (-512.595) -- 0:00:57
Average standard deviation of split frequencies: 0.032047
95500 -- (-508.434) (-508.969) [-508.771] (-509.286) * [-511.368] (-509.186) (-511.188) (-510.239) -- 0:00:56
96000 -- (-510.672) [-508.757] (-511.577) (-509.441) * (-510.172) [-510.682] (-510.984) (-508.982) -- 0:00:56
96500 -- [-510.228] (-509.139) (-510.229) (-509.113) * [-510.434] (-508.908) (-510.785) (-511.829) -- 0:00:56
97000 -- (-511.995) [-509.730] (-510.958) (-509.551) * (-511.513) [-510.966] (-511.733) (-508.951) -- 0:00:55
97500 -- (-511.364) (-508.913) [-508.811] (-512.182) * (-514.870) [-510.475] (-509.027) (-508.592) -- 0:00:55
98000 -- (-512.018) (-511.807) [-512.967] (-510.250) * (-510.486) (-508.499) [-509.538] (-508.989) -- 0:00:55
98500 -- (-512.463) (-509.597) (-510.033) [-509.749] * (-511.870) (-508.873) [-509.070] (-510.666) -- 0:00:54
99000 -- (-515.015) (-513.685) (-516.284) [-509.316] * (-509.744) [-509.682] (-510.163) (-511.527) -- 0:00:54
99500 -- (-511.800) (-509.003) (-511.574) [-509.419] * (-510.897) (-510.532) [-511.520] (-511.262) -- 0:00:54
100000 -- [-511.126] (-511.443) (-510.359) (-511.346) * (-511.019) (-510.051) [-509.669] (-510.282) -- 0:00:54
Average standard deviation of split frequencies: 0.029398
100500 -- (-510.502) (-511.209) [-509.696] (-512.401) * (-508.816) [-510.018] (-510.573) (-510.985) -- 0:00:53
101000 -- (-509.651) (-509.857) [-508.198] (-511.745) * [-508.206] (-512.166) (-512.563) (-513.200) -- 0:00:53
101500 -- [-511.257] (-509.580) (-510.990) (-513.421) * (-509.197) (-509.276) [-510.382] (-513.271) -- 0:00:53
102000 -- (-514.976) (-510.035) (-511.921) [-511.279] * (-508.187) (-510.515) (-518.277) [-511.378] -- 0:00:52
102500 -- [-513.032] (-509.560) (-514.149) (-511.978) * (-508.249) (-514.148) [-508.980] (-510.056) -- 0:00:52
103000 -- (-510.048) (-510.706) [-511.472] (-513.729) * (-510.253) [-511.932] (-508.568) (-512.628) -- 0:00:52
103500 -- [-512.570] (-510.342) (-510.394) (-509.613) * (-511.032) (-512.909) [-510.362] (-509.715) -- 0:00:51
104000 -- [-511.674] (-516.606) (-511.110) (-509.333) * (-512.298) (-512.973) [-511.518] (-511.047) -- 0:00:51
104500 -- [-510.231] (-510.551) (-510.997) (-510.035) * [-510.718] (-510.559) (-510.729) (-510.503) -- 0:00:51
105000 -- (-511.511) (-510.391) (-510.288) [-510.211] * (-513.334) [-509.291] (-511.517) (-511.145) -- 0:00:59
Average standard deviation of split frequencies: 0.028556
105500 -- (-509.841) (-511.803) (-512.837) [-511.720] * (-510.210) [-510.086] (-510.041) (-510.400) -- 0:00:59
106000 -- [-510.905] (-517.885) (-511.992) (-512.196) * (-510.884) [-511.260] (-508.816) (-509.596) -- 0:00:59
106500 -- (-512.707) [-511.238] (-509.077) (-510.486) * [-511.637] (-509.070) (-514.690) (-511.338) -- 0:00:58
107000 -- (-515.369) [-515.729] (-512.300) (-511.098) * (-510.395) (-512.048) [-508.922] (-510.648) -- 0:00:58
107500 -- (-511.660) [-509.017] (-508.740) (-510.219) * (-511.670) (-515.231) (-508.554) [-510.681] -- 0:00:58
108000 -- (-509.202) (-509.128) (-509.648) [-509.066] * (-509.025) (-515.441) [-508.256] (-512.256) -- 0:00:57
108500 -- (-511.681) (-511.240) (-510.004) [-512.173] * (-508.373) (-510.782) (-514.824) [-509.914] -- 0:00:57
109000 -- (-509.458) (-512.748) [-512.200] (-510.459) * (-511.972) [-511.616] (-513.415) (-510.660) -- 0:00:57
109500 -- (-508.990) (-508.818) (-512.740) [-510.955] * (-514.787) [-509.328] (-516.758) (-514.557) -- 0:00:56
110000 -- (-510.689) [-508.734] (-515.977) (-512.549) * (-511.410) [-510.352] (-509.165) (-509.560) -- 0:00:56
Average standard deviation of split frequencies: 0.028114
110500 -- (-514.702) [-508.567] (-512.781) (-509.312) * (-510.229) (-511.321) [-508.715] (-511.770) -- 0:00:56
111000 -- (-508.841) (-511.133) [-510.395] (-510.604) * (-509.603) (-510.528) (-509.529) [-508.791] -- 0:00:56
111500 -- [-510.979] (-510.329) (-511.278) (-508.890) * (-510.864) (-510.464) (-508.521) [-510.437] -- 0:00:55
112000 -- [-510.766] (-508.876) (-514.715) (-514.774) * [-508.641] (-512.415) (-509.160) (-508.059) -- 0:00:55
112500 -- (-511.338) [-510.029] (-510.111) (-509.473) * (-508.211) (-512.189) (-508.871) [-509.320] -- 0:00:55
113000 -- (-508.859) (-508.697) (-511.473) [-511.008] * (-508.199) (-510.117) (-512.111) [-510.760] -- 0:00:54
113500 -- [-510.208] (-511.093) (-513.015) (-509.965) * [-509.828] (-510.030) (-511.147) (-509.109) -- 0:00:54
114000 -- (-509.196) (-509.991) (-513.294) [-509.559] * (-512.719) (-512.014) (-509.715) [-508.226] -- 0:00:54
114500 -- (-509.677) [-510.491] (-510.438) (-508.551) * [-508.835] (-511.166) (-510.617) (-510.497) -- 0:00:54
115000 -- (-516.603) (-509.700) (-510.106) [-508.694] * [-508.218] (-515.625) (-508.966) (-513.362) -- 0:00:53
Average standard deviation of split frequencies: 0.028447
115500 -- (-513.526) (-511.949) [-512.270] (-508.860) * [-509.600] (-508.366) (-510.156) (-509.680) -- 0:00:53
116000 -- (-511.573) (-513.326) (-509.561) [-509.359] * [-508.962] (-508.439) (-515.398) (-509.912) -- 0:00:53
116500 -- (-509.591) (-511.827) [-509.680] (-508.697) * (-509.088) (-509.836) (-515.023) [-509.111] -- 0:00:53
117000 -- (-508.262) (-511.560) (-509.586) [-508.607] * [-509.407] (-511.851) (-509.133) (-511.718) -- 0:00:52
117500 -- (-509.076) (-513.572) (-510.738) [-510.070] * (-510.178) [-510.163] (-510.220) (-512.801) -- 0:00:52
118000 -- [-509.891] (-511.321) (-511.839) (-514.957) * (-510.943) [-509.486] (-508.769) (-509.222) -- 0:00:52
118500 -- (-509.873) (-510.076) (-511.144) [-510.687] * (-511.265) [-510.521] (-511.881) (-512.561) -- 0:00:52
119000 -- (-509.682) (-509.970) (-513.443) [-509.296] * [-508.236] (-511.066) (-513.694) (-509.325) -- 0:00:51
119500 -- (-509.822) (-510.777) [-511.115] (-508.713) * (-508.299) (-510.348) (-510.983) [-509.518] -- 0:00:51
120000 -- (-514.226) [-510.174] (-511.129) (-511.600) * (-510.236) (-509.187) [-512.662] (-512.053) -- 0:00:51
Average standard deviation of split frequencies: 0.026524
120500 -- (-511.704) (-508.742) (-515.494) [-511.889] * (-510.778) (-510.006) [-510.621] (-509.970) -- 0:00:51
121000 -- (-516.256) (-510.506) (-509.944) [-510.228] * [-509.506] (-510.129) (-510.793) (-509.285) -- 0:00:50
121500 -- [-512.390] (-512.971) (-513.957) (-514.523) * [-511.150] (-512.295) (-508.358) (-511.176) -- 0:00:57
122000 -- (-511.812) (-509.410) [-509.667] (-510.776) * (-513.091) [-510.454] (-508.453) (-509.852) -- 0:00:57
122500 -- [-509.542] (-509.268) (-508.805) (-511.798) * (-510.353) [-510.288] (-513.620) (-510.219) -- 0:00:57
123000 -- (-509.461) [-508.891] (-510.117) (-515.781) * (-510.728) [-511.840] (-515.236) (-511.460) -- 0:00:57
123500 -- [-510.231] (-508.875) (-509.601) (-513.515) * (-510.525) (-509.334) [-512.832] (-508.488) -- 0:00:56
124000 -- (-509.235) [-509.098] (-512.804) (-514.524) * (-508.844) (-513.289) [-510.575] (-510.626) -- 0:00:56
124500 -- (-510.747) (-509.262) (-512.505) [-511.411] * (-513.905) [-509.984] (-509.794) (-509.605) -- 0:00:56
125000 -- (-509.069) [-509.783] (-513.321) (-512.580) * [-509.174] (-511.683) (-509.615) (-510.665) -- 0:00:56
Average standard deviation of split frequencies: 0.027644
125500 -- (-508.454) (-509.277) [-509.288] (-510.585) * (-512.645) (-509.900) [-510.450] (-510.550) -- 0:00:55
126000 -- (-512.127) (-511.845) (-509.154) [-510.213] * (-512.689) [-509.768] (-508.636) (-509.911) -- 0:00:55
126500 -- [-510.517] (-511.901) (-509.730) (-511.386) * (-510.139) (-514.707) [-512.273] (-510.041) -- 0:00:55
127000 -- (-509.986) [-508.508] (-513.444) (-509.879) * [-513.504] (-513.107) (-512.064) (-510.204) -- 0:00:54
127500 -- (-510.457) (-513.268) (-509.002) [-509.238] * (-510.831) [-512.436] (-510.877) (-509.974) -- 0:00:54
128000 -- (-511.715) (-509.006) [-509.199] (-509.124) * (-511.668) (-511.965) (-509.402) [-508.622] -- 0:00:54
128500 -- [-511.797] (-512.289) (-510.161) (-510.048) * (-511.855) [-512.188] (-511.861) (-510.930) -- 0:00:54
129000 -- (-509.715) (-509.395) (-513.770) [-508.706] * (-513.051) (-509.877) (-511.669) [-509.744] -- 0:00:54
129500 -- (-511.070) (-511.585) [-508.726] (-511.584) * (-515.213) (-512.429) (-510.632) [-512.238] -- 0:00:53
130000 -- (-514.635) (-515.103) [-511.889] (-510.378) * (-512.800) (-512.061) [-512.051] (-510.790) -- 0:00:53
Average standard deviation of split frequencies: 0.024874
130500 -- (-514.112) (-510.383) [-509.989] (-514.329) * [-510.358] (-508.801) (-516.942) (-511.796) -- 0:00:53
131000 -- [-509.892] (-510.398) (-511.957) (-515.769) * (-512.639) (-508.700) [-511.426] (-511.847) -- 0:00:53
131500 -- (-511.219) (-512.806) [-512.033] (-509.072) * (-511.733) (-510.272) (-509.312) [-509.844] -- 0:00:52
132000 -- (-509.312) (-510.384) (-510.291) [-508.925] * [-511.681] (-512.881) (-513.318) (-510.376) -- 0:00:52
132500 -- [-510.221] (-509.841) (-512.592) (-508.598) * (-512.885) (-522.166) [-510.794] (-510.347) -- 0:00:52
133000 -- (-510.149) [-513.781] (-511.185) (-509.752) * (-510.803) (-509.671) (-512.192) [-511.190] -- 0:00:52
133500 -- (-509.398) (-514.452) (-511.658) [-514.545] * (-510.562) [-511.610] (-510.176) (-509.483) -- 0:00:51
134000 -- (-511.295) (-509.175) [-508.573] (-513.687) * (-508.499) (-509.459) (-511.640) [-508.683] -- 0:00:51
134500 -- (-508.789) (-511.329) [-509.881] (-515.094) * (-509.296) [-514.612] (-513.631) (-510.622) -- 0:00:51
135000 -- [-509.210] (-510.988) (-508.974) (-509.671) * (-509.046) (-510.339) (-509.068) [-509.683] -- 0:00:51
Average standard deviation of split frequencies: 0.025540
135500 -- (-514.014) (-512.293) [-510.314] (-510.285) * (-510.134) (-509.482) [-509.167] (-511.307) -- 0:00:51
136000 -- (-513.575) [-510.757] (-508.804) (-512.608) * (-509.035) (-513.260) (-512.659) [-509.358] -- 0:00:50
136500 -- (-514.620) [-509.988] (-511.692) (-511.555) * [-509.959] (-515.481) (-513.492) (-509.053) -- 0:00:50
137000 -- (-515.298) [-511.000] (-512.367) (-511.689) * (-510.342) [-511.983] (-512.412) (-509.498) -- 0:00:50
137500 -- (-512.239) (-512.987) (-511.737) [-509.003] * [-513.475] (-509.308) (-508.971) (-509.200) -- 0:00:50
138000 -- (-511.667) [-512.542] (-511.623) (-509.923) * [-514.099] (-509.270) (-513.930) (-510.311) -- 0:00:56
138500 -- (-512.030) [-512.678] (-511.759) (-510.835) * (-513.476) (-514.201) (-510.696) [-509.160] -- 0:00:55
139000 -- (-514.343) (-512.090) [-509.329] (-508.507) * (-510.526) (-510.217) [-510.487] (-509.957) -- 0:00:55
139500 -- (-510.997) (-511.398) [-511.086] (-508.438) * [-509.978] (-509.600) (-514.917) (-511.191) -- 0:00:55
140000 -- (-511.621) (-513.934) [-508.609] (-512.743) * (-510.643) (-509.728) [-509.101] (-513.076) -- 0:00:55
Average standard deviation of split frequencies: 0.026139
140500 -- (-513.572) (-513.057) [-510.511] (-513.269) * (-510.311) [-510.068] (-511.135) (-513.324) -- 0:00:55
141000 -- (-510.734) (-512.523) (-510.350) [-509.615] * (-510.328) (-509.731) (-512.577) [-510.258] -- 0:00:54
141500 -- (-509.391) (-512.120) [-510.505] (-512.072) * (-510.237) [-512.773] (-517.298) (-509.740) -- 0:00:54
142000 -- (-510.429) (-511.203) [-510.758] (-511.885) * (-510.874) (-509.170) (-513.566) [-510.241] -- 0:00:54
142500 -- (-509.580) (-509.664) [-510.576] (-511.375) * (-508.697) [-509.594] (-510.533) (-509.829) -- 0:00:54
143000 -- (-509.648) (-509.177) [-509.561] (-513.615) * (-508.570) [-509.067] (-510.220) (-509.665) -- 0:00:53
143500 -- [-510.935] (-508.632) (-509.946) (-511.181) * [-510.946] (-509.501) (-511.937) (-510.409) -- 0:00:53
144000 -- (-509.246) [-511.916] (-509.984) (-510.565) * [-508.968] (-511.062) (-511.738) (-511.411) -- 0:00:53
144500 -- (-513.912) (-509.903) [-508.453] (-509.267) * [-510.488] (-512.018) (-511.639) (-508.884) -- 0:00:53
145000 -- [-508.995] (-509.031) (-509.332) (-508.631) * (-509.763) [-509.966] (-509.902) (-510.299) -- 0:00:53
Average standard deviation of split frequencies: 0.025992
145500 -- (-508.978) (-510.122) (-512.127) [-515.526] * [-509.901] (-511.201) (-513.585) (-511.224) -- 0:00:52
146000 -- (-508.732) (-509.315) [-509.043] (-511.760) * (-511.662) [-510.253] (-514.184) (-511.163) -- 0:00:52
146500 -- [-508.172] (-509.770) (-510.242) (-512.713) * (-513.172) (-508.580) [-510.299] (-512.174) -- 0:00:52
147000 -- (-509.121) [-511.660] (-508.324) (-511.959) * (-510.805) (-509.109) (-511.056) [-513.471] -- 0:00:52
147500 -- (-511.760) (-511.734) [-509.155] (-509.719) * (-511.946) [-511.144] (-512.582) (-508.848) -- 0:00:52
148000 -- [-511.270] (-512.605) (-511.795) (-509.098) * (-515.605) (-510.333) (-510.772) [-508.243] -- 0:00:51
148500 -- (-512.891) [-512.278] (-510.297) (-516.075) * [-513.472] (-508.744) (-510.011) (-511.670) -- 0:00:51
149000 -- (-510.579) (-512.957) (-512.997) [-510.740] * (-508.834) [-510.132] (-509.766) (-510.206) -- 0:00:51
149500 -- (-511.996) [-510.278] (-510.384) (-509.470) * (-511.720) (-510.110) (-515.245) [-509.136] -- 0:00:51
150000 -- (-510.771) (-512.303) (-510.831) [-509.846] * (-511.814) (-511.973) [-511.068] (-508.875) -- 0:00:51
Average standard deviation of split frequencies: 0.025656
150500 -- (-509.630) (-513.800) [-509.920] (-509.021) * (-510.281) [-508.940] (-515.570) (-511.529) -- 0:00:50
151000 -- (-514.167) [-509.940] (-514.997) (-512.829) * (-509.604) [-509.230] (-515.705) (-509.620) -- 0:00:50
151500 -- [-512.867] (-509.161) (-509.177) (-508.664) * (-510.514) (-510.330) (-513.963) [-509.059] -- 0:00:50
152000 -- (-513.371) (-508.897) [-509.619] (-512.154) * [-511.298] (-512.299) (-514.118) (-508.252) -- 0:00:50
152500 -- (-511.817) (-509.623) [-510.138] (-510.709) * (-509.482) [-510.451] (-509.058) (-508.647) -- 0:00:50
153000 -- [-510.235] (-517.731) (-510.522) (-511.171) * (-511.953) (-508.483) (-509.647) [-510.432] -- 0:00:49
153500 -- [-511.262] (-510.729) (-511.560) (-513.066) * [-509.991] (-509.532) (-508.600) (-512.352) -- 0:00:49
154000 -- (-512.902) (-508.369) [-510.859] (-515.123) * [-509.195] (-508.309) (-509.674) (-509.594) -- 0:00:49
154500 -- (-509.300) [-509.226] (-509.546) (-510.910) * (-509.756) [-510.227] (-509.955) (-511.838) -- 0:00:54
155000 -- (-511.872) (-511.102) (-515.502) [-509.596] * [-511.437] (-509.226) (-513.220) (-510.749) -- 0:00:54
Average standard deviation of split frequencies: 0.023721
155500 -- (-512.922) (-510.075) (-513.735) [-510.936] * (-512.220) (-510.845) [-511.144] (-514.934) -- 0:00:54
156000 -- (-509.577) (-509.988) [-510.354] (-509.311) * [-509.361] (-509.605) (-514.304) (-512.869) -- 0:00:54
156500 -- (-509.485) (-511.005) [-511.141] (-513.064) * (-511.781) (-513.346) (-512.358) [-511.923] -- 0:00:53
157000 -- (-508.137) (-517.341) (-510.859) [-509.578] * (-508.823) [-510.545] (-511.395) (-515.249) -- 0:00:53
157500 -- (-510.724) (-509.610) [-511.147] (-509.748) * (-508.931) (-510.539) [-511.708] (-509.585) -- 0:00:53
158000 -- (-509.465) (-511.543) [-508.252] (-511.208) * [-509.206] (-511.899) (-515.261) (-509.321) -- 0:00:53
158500 -- (-511.951) (-509.680) [-508.736] (-511.013) * [-511.305] (-511.328) (-511.313) (-509.769) -- 0:00:53
159000 -- [-511.556] (-512.160) (-510.488) (-510.302) * (-509.264) (-508.869) [-511.972] (-509.808) -- 0:00:52
159500 -- (-509.307) [-508.675] (-511.285) (-508.937) * (-508.288) (-508.802) (-509.400) [-508.397] -- 0:00:52
160000 -- [-508.801] (-509.962) (-513.824) (-511.862) * (-510.643) [-512.974] (-509.848) (-509.998) -- 0:00:52
Average standard deviation of split frequencies: 0.024499
160500 -- (-510.724) (-510.253) (-510.211) [-510.352] * (-511.259) (-512.046) (-510.620) [-509.773] -- 0:00:52
161000 -- [-509.971] (-509.269) (-511.283) (-509.666) * (-509.881) (-510.117) [-511.270] (-509.967) -- 0:00:52
161500 -- [-511.236] (-509.599) (-509.587) (-508.591) * (-509.886) [-509.668] (-514.892) (-510.094) -- 0:00:51
162000 -- (-513.489) (-509.340) [-510.039] (-510.047) * (-510.954) [-510.629] (-511.776) (-508.679) -- 0:00:51
162500 -- (-508.520) [-511.994] (-512.495) (-513.775) * (-511.752) (-514.722) (-510.908) [-510.369] -- 0:00:51
163000 -- [-512.636] (-511.377) (-510.897) (-514.721) * (-514.648) [-511.927] (-510.935) (-510.880) -- 0:00:51
163500 -- (-510.353) [-513.548] (-514.706) (-516.393) * (-518.705) [-512.286] (-510.904) (-522.132) -- 0:00:51
164000 -- (-510.707) (-514.406) [-512.781] (-509.836) * (-509.802) (-510.161) (-511.245) [-512.485] -- 0:00:50
164500 -- (-509.131) [-508.509] (-514.677) (-509.410) * [-512.477] (-514.427) (-515.155) (-512.802) -- 0:00:50
165000 -- (-508.472) (-508.914) [-511.672] (-509.675) * (-513.228) (-512.129) (-512.606) [-509.683] -- 0:00:50
Average standard deviation of split frequencies: 0.023765
165500 -- (-511.495) (-508.985) (-512.225) [-510.957] * (-510.911) [-512.150] (-510.957) (-512.176) -- 0:00:50
166000 -- (-512.804) (-511.658) [-508.959] (-511.665) * (-511.980) [-509.865] (-510.073) (-510.248) -- 0:00:50
166500 -- (-509.033) (-510.407) [-514.653] (-514.657) * (-508.728) (-510.576) [-509.314] (-509.846) -- 0:00:50
167000 -- (-508.543) (-509.992) (-513.974) [-513.788] * (-509.682) [-508.673] (-512.511) (-510.777) -- 0:00:49
167500 -- (-509.970) (-510.805) (-509.695) [-511.299] * (-509.150) (-510.391) (-508.949) [-510.853] -- 0:00:49
168000 -- (-509.457) (-508.455) [-509.409] (-511.977) * (-508.777) [-512.108] (-513.202) (-509.694) -- 0:00:49
168500 -- [-509.280] (-509.039) (-510.376) (-512.316) * (-510.170) (-511.475) (-510.388) [-510.424] -- 0:00:49
169000 -- (-509.372) (-510.038) [-509.326] (-510.364) * (-510.729) (-513.758) (-509.235) [-511.017] -- 0:00:49
169500 -- (-510.934) (-510.885) (-510.429) [-511.692] * (-511.515) [-510.932] (-512.423) (-513.225) -- 0:00:48
170000 -- [-510.095] (-509.642) (-512.232) (-509.784) * (-508.944) [-510.395] (-512.587) (-513.236) -- 0:00:48
Average standard deviation of split frequencies: 0.023785
170500 -- (-510.436) (-511.549) [-509.744] (-509.747) * [-509.531] (-513.389) (-512.229) (-511.763) -- 0:00:48
171000 -- (-509.624) (-511.684) [-509.443] (-508.774) * (-510.080) [-508.739] (-509.680) (-510.196) -- 0:00:53
171500 -- [-508.475] (-509.013) (-510.863) (-513.171) * (-512.574) (-510.266) [-510.976] (-508.286) -- 0:00:53
172000 -- (-510.651) (-509.006) (-514.087) [-509.663] * (-509.841) (-509.261) [-511.365] (-508.315) -- 0:00:52
172500 -- (-509.452) (-512.912) (-512.384) [-509.833] * (-510.287) (-509.324) [-510.035] (-509.030) -- 0:00:52
173000 -- (-511.873) (-510.020) [-509.305] (-510.034) * (-510.464) [-509.639] (-509.419) (-509.032) -- 0:00:52
173500 -- (-512.820) (-509.700) [-510.416] (-512.333) * [-511.397] (-510.324) (-510.376) (-512.640) -- 0:00:52
174000 -- (-510.913) (-512.236) [-510.828] (-511.798) * (-512.494) [-509.919] (-508.829) (-508.432) -- 0:00:52
174500 -- (-513.444) (-509.995) [-510.242] (-511.637) * (-509.393) (-508.171) (-508.465) [-508.365] -- 0:00:52
175000 -- (-510.332) [-510.373] (-514.907) (-510.597) * [-513.061] (-510.029) (-508.459) (-511.024) -- 0:00:51
Average standard deviation of split frequencies: 0.023362
175500 -- [-509.336] (-510.148) (-510.964) (-510.152) * (-513.225) (-508.595) [-509.220] (-511.097) -- 0:00:51
176000 -- (-511.916) (-511.077) [-510.971] (-511.126) * [-513.160] (-509.334) (-514.540) (-512.429) -- 0:00:51
176500 -- (-511.074) (-509.833) (-508.383) [-514.673] * (-513.352) [-508.348] (-510.516) (-509.683) -- 0:00:51
177000 -- (-516.173) (-511.887) (-511.643) [-509.111] * [-509.949] (-508.405) (-509.744) (-511.767) -- 0:00:51
177500 -- (-513.431) (-515.338) [-511.529] (-511.016) * [-514.690] (-509.191) (-511.009) (-508.619) -- 0:00:50
178000 -- [-509.974] (-510.757) (-509.298) (-508.952) * (-514.708) [-509.226] (-516.445) (-508.652) -- 0:00:50
178500 -- (-509.062) (-509.398) (-508.578) [-509.330] * (-508.802) (-514.658) [-515.611] (-511.472) -- 0:00:50
179000 -- [-511.959] (-509.417) (-510.982) (-508.336) * (-510.189) (-513.856) [-510.011] (-511.454) -- 0:00:50
179500 -- (-511.811) [-509.467] (-512.661) (-509.063) * (-511.330) (-508.732) [-515.002] (-511.391) -- 0:00:50
180000 -- (-509.321) (-511.334) (-511.392) [-509.550] * (-509.436) (-509.217) (-512.502) [-511.597] -- 0:00:50
Average standard deviation of split frequencies: 0.021889
180500 -- (-510.585) (-509.931) [-511.573] (-509.819) * [-511.487] (-511.282) (-510.143) (-511.222) -- 0:00:49
181000 -- [-510.791] (-508.847) (-511.330) (-509.653) * (-511.071) (-512.285) [-511.618] (-510.528) -- 0:00:49
181500 -- (-509.812) [-510.013] (-510.830) (-512.673) * [-508.864] (-511.639) (-509.421) (-510.090) -- 0:00:49
182000 -- [-511.661] (-511.779) (-511.288) (-514.960) * [-509.135] (-511.273) (-510.372) (-510.902) -- 0:00:49
182500 -- [-510.788] (-510.160) (-513.729) (-509.791) * (-519.901) (-514.379) [-509.815] (-512.508) -- 0:00:49
183000 -- [-510.221] (-508.594) (-515.800) (-510.018) * [-511.487] (-510.307) (-509.612) (-509.567) -- 0:00:49
183500 -- [-508.477] (-510.549) (-513.113) (-509.142) * (-508.896) (-515.065) [-510.060] (-510.082) -- 0:00:48
184000 -- [-512.889] (-509.494) (-512.592) (-508.636) * (-511.018) [-511.139] (-509.731) (-509.009) -- 0:00:48
184500 -- (-512.032) [-507.999] (-509.150) (-509.814) * (-515.580) (-513.046) [-509.166] (-511.447) -- 0:00:48
185000 -- (-511.696) [-509.089] (-514.379) (-509.194) * (-509.281) [-512.226] (-510.270) (-511.979) -- 0:00:48
Average standard deviation of split frequencies: 0.019381
185500 -- (-512.080) (-508.757) [-510.022] (-512.946) * (-509.488) [-513.306] (-509.612) (-509.752) -- 0:00:48
186000 -- (-510.174) (-509.907) [-510.818] (-510.963) * (-508.396) (-513.139) [-509.893] (-510.485) -- 0:00:48
186500 -- (-510.872) (-512.424) [-510.514] (-509.971) * (-508.782) (-512.875) [-510.444] (-509.478) -- 0:00:47
187000 -- (-510.845) (-509.887) (-510.678) [-513.344] * (-509.129) (-509.348) [-509.116] (-517.022) -- 0:00:52
187500 -- (-510.462) [-508.418] (-510.986) (-517.367) * (-508.481) [-509.714] (-512.239) (-512.255) -- 0:00:52
188000 -- (-508.693) [-508.757] (-515.525) (-510.783) * (-512.593) (-509.042) (-510.402) [-509.467] -- 0:00:51
188500 -- (-511.457) (-509.196) (-511.219) [-511.511] * (-509.005) [-509.656] (-508.781) (-511.687) -- 0:00:51
189000 -- (-512.374) (-510.021) (-509.653) [-509.613] * [-509.198] (-509.226) (-511.765) (-510.316) -- 0:00:51
189500 -- (-511.958) (-511.222) (-511.346) [-508.888] * (-513.197) (-510.034) [-510.407] (-510.164) -- 0:00:51
190000 -- (-510.223) (-512.249) (-509.831) [-510.310] * (-509.576) (-516.796) (-510.215) [-509.490] -- 0:00:51
Average standard deviation of split frequencies: 0.019488
190500 -- (-510.582) [-508.431] (-511.317) (-511.351) * (-509.894) [-511.136] (-511.860) (-508.441) -- 0:00:50
191000 -- [-509.683] (-512.583) (-510.335) (-512.820) * (-510.653) (-510.680) [-509.327] (-510.610) -- 0:00:50
191500 -- (-513.104) (-510.658) (-510.361) [-509.797] * (-508.659) [-509.692] (-513.407) (-509.939) -- 0:00:50
192000 -- (-509.329) (-511.663) (-509.620) [-513.056] * (-508.940) [-510.037] (-509.647) (-510.172) -- 0:00:50
192500 -- [-509.517] (-508.313) (-513.562) (-509.496) * (-509.640) (-510.402) [-509.350] (-515.328) -- 0:00:50
193000 -- [-509.526] (-509.506) (-514.190) (-508.279) * (-508.940) (-509.837) (-508.921) [-512.093] -- 0:00:50
193500 -- (-514.661) (-510.214) [-508.792] (-509.659) * (-515.400) (-509.804) (-511.203) [-511.846] -- 0:00:50
194000 -- (-513.738) (-510.168) [-510.715] (-512.043) * (-509.735) [-510.836] (-510.140) (-512.303) -- 0:00:49
194500 -- (-513.326) (-509.478) [-509.427] (-510.497) * [-508.612] (-509.818) (-508.820) (-511.195) -- 0:00:49
195000 -- (-513.355) [-508.491] (-511.107) (-512.671) * (-510.332) (-510.464) (-508.404) [-510.403] -- 0:00:49
Average standard deviation of split frequencies: 0.019241
195500 -- (-514.909) (-508.681) (-510.405) [-510.022] * (-514.568) (-512.419) (-509.115) [-513.169] -- 0:00:49
196000 -- (-510.074) (-509.984) (-509.637) [-511.904] * (-510.993) (-514.888) (-510.663) [-509.120] -- 0:00:49
196500 -- (-511.533) (-510.120) (-510.144) [-511.213] * (-511.366) (-514.042) (-509.899) [-511.461] -- 0:00:49
197000 -- (-509.169) (-509.239) (-509.285) [-511.351] * (-511.282) (-509.509) [-509.489] (-509.486) -- 0:00:48
197500 -- (-510.075) (-508.435) [-508.120] (-513.117) * (-510.628) (-509.484) [-512.549] (-509.452) -- 0:00:48
198000 -- (-511.437) (-509.824) [-509.075] (-513.191) * [-511.445] (-511.316) (-510.780) (-509.246) -- 0:00:48
198500 -- (-513.744) [-509.949] (-509.271) (-510.056) * [-512.808] (-510.323) (-512.269) (-509.344) -- 0:00:48
199000 -- [-510.949] (-510.018) (-510.767) (-511.312) * [-509.229] (-510.329) (-509.504) (-512.088) -- 0:00:48
199500 -- (-511.421) (-509.381) [-509.374] (-513.450) * [-510.343] (-509.735) (-511.359) (-512.980) -- 0:00:48
200000 -- (-509.359) (-508.944) (-511.623) [-513.543] * (-514.448) (-512.818) [-509.222] (-517.544) -- 0:00:48
Average standard deviation of split frequencies: 0.020175
200500 -- (-509.843) [-508.828] (-509.608) (-509.976) * (-508.133) [-508.510] (-511.323) (-511.623) -- 0:00:47
201000 -- (-509.762) (-508.511) (-511.369) [-516.403] * (-508.239) (-511.470) [-510.291] (-510.940) -- 0:00:47
201500 -- (-514.231) (-510.408) [-508.320] (-512.415) * (-509.003) (-515.167) (-513.607) [-508.383] -- 0:00:47
202000 -- (-511.437) (-512.324) [-510.917] (-512.450) * (-512.287) (-511.858) (-508.474) [-509.930] -- 0:00:47
202500 -- [-508.603] (-516.238) (-512.569) (-509.665) * (-510.315) (-514.681) (-510.505) [-509.115] -- 0:00:47
203000 -- (-508.252) (-515.311) [-510.904] (-509.953) * (-509.296) (-511.527) (-510.523) [-510.478] -- 0:00:51
203500 -- (-508.343) (-512.097) [-508.746] (-510.209) * (-509.964) (-509.920) (-510.223) [-508.989] -- 0:00:50
204000 -- [-509.582] (-510.642) (-509.054) (-509.712) * (-509.121) (-508.865) [-510.570] (-514.229) -- 0:00:50
204500 -- (-509.735) (-510.172) (-511.688) [-508.531] * (-510.218) [-512.115] (-509.797) (-511.057) -- 0:00:50
205000 -- [-509.855] (-514.089) (-509.782) (-515.067) * (-511.666) (-514.828) [-509.002] (-509.086) -- 0:00:50
Average standard deviation of split frequencies: 0.021268
205500 -- (-510.157) (-511.053) (-508.696) [-516.148] * (-511.529) (-514.907) [-508.955] (-511.672) -- 0:00:50
206000 -- (-514.728) (-510.602) (-509.259) [-513.213] * (-511.031) (-511.618) [-508.848] (-512.201) -- 0:00:50
206500 -- (-514.188) [-508.749] (-508.434) (-510.485) * [-509.045] (-508.656) (-508.713) (-513.513) -- 0:00:49
207000 -- [-509.893] (-509.433) (-509.784) (-512.085) * [-510.144] (-511.695) (-509.145) (-512.353) -- 0:00:49
207500 -- (-513.832) [-509.866] (-509.671) (-511.575) * [-508.947] (-510.254) (-509.722) (-510.695) -- 0:00:49
208000 -- (-510.220) (-509.031) [-511.255] (-511.028) * (-511.625) [-510.077] (-509.436) (-510.587) -- 0:00:49
208500 -- (-510.132) [-509.701] (-508.820) (-512.216) * [-511.779] (-508.641) (-509.331) (-516.459) -- 0:00:49
209000 -- (-511.093) [-509.360] (-510.078) (-513.226) * (-511.206) [-511.807] (-512.501) (-508.823) -- 0:00:49
209500 -- (-511.031) [-508.967] (-510.237) (-512.894) * (-509.122) (-510.192) (-511.307) [-509.326] -- 0:00:49
210000 -- (-508.989) [-510.429] (-510.935) (-508.772) * (-510.753) (-511.124) [-510.391] (-512.254) -- 0:00:48
Average standard deviation of split frequencies: 0.021507
210500 -- (-508.901) [-512.250] (-514.205) (-508.527) * (-511.504) (-509.550) (-510.822) [-511.145] -- 0:00:48
211000 -- (-513.058) [-508.147] (-510.179) (-508.446) * (-512.323) [-509.721] (-511.466) (-511.443) -- 0:00:48
211500 -- (-514.935) (-512.565) (-512.563) [-509.667] * (-509.471) (-514.739) (-510.127) [-509.112] -- 0:00:48
212000 -- (-510.599) (-508.903) [-510.286] (-512.621) * [-509.861] (-515.945) (-509.205) (-510.589) -- 0:00:48
212500 -- (-518.860) [-510.164] (-510.182) (-510.169) * [-510.229] (-511.320) (-510.735) (-510.422) -- 0:00:48
213000 -- (-509.504) [-509.375] (-513.088) (-510.074) * (-508.831) (-513.036) (-512.902) [-512.648] -- 0:00:48
213500 -- [-508.268] (-508.692) (-510.881) (-512.117) * [-508.731] (-510.047) (-509.954) (-509.678) -- 0:00:47
214000 -- (-508.703) [-511.495] (-510.621) (-513.292) * (-508.924) (-511.317) (-509.624) [-508.533] -- 0:00:47
214500 -- (-508.852) [-509.673] (-511.576) (-509.274) * (-510.648) (-511.990) [-509.615] (-513.746) -- 0:00:47
215000 -- (-510.843) (-513.530) (-508.612) [-511.027] * (-511.971) (-512.758) [-508.720] (-513.482) -- 0:00:47
Average standard deviation of split frequencies: 0.021461
215500 -- (-509.655) (-512.457) (-509.604) [-510.722] * (-510.824) (-509.789) (-509.093) [-513.586] -- 0:00:47
216000 -- (-515.897) [-509.063] (-514.006) (-510.181) * (-509.809) (-508.347) [-508.515] (-511.623) -- 0:00:47
216500 -- (-510.859) (-511.791) (-510.485) [-510.592] * (-510.847) (-513.673) [-509.776] (-509.242) -- 0:00:47
217000 -- (-514.065) [-513.517] (-510.065) (-510.013) * [-511.982] (-511.906) (-512.592) (-510.740) -- 0:00:46
217500 -- [-510.462] (-515.628) (-510.918) (-513.136) * (-513.885) [-514.447] (-513.670) (-510.934) -- 0:00:46
218000 -- (-509.907) (-510.884) (-510.896) [-508.621] * (-511.111) (-509.672) (-509.521) [-509.829] -- 0:00:46
218500 -- (-509.502) (-510.615) (-513.277) [-509.413] * (-509.326) (-513.132) [-510.021] (-509.179) -- 0:00:46
219000 -- (-512.231) [-508.863] (-510.148) (-509.352) * (-508.964) (-512.836) [-511.163] (-510.309) -- 0:00:49
219500 -- [-509.728] (-508.977) (-508.727) (-508.990) * (-510.011) (-509.765) [-514.263] (-512.374) -- 0:00:49
220000 -- (-508.498) (-509.961) [-508.777] (-508.357) * (-510.955) (-513.305) [-510.622] (-508.660) -- 0:00:49
Average standard deviation of split frequencies: 0.020860
220500 -- (-509.501) (-512.402) (-512.478) [-509.700] * (-510.232) (-511.022) (-510.947) [-508.538] -- 0:00:49
221000 -- (-511.859) (-510.396) (-513.013) [-513.025] * (-509.803) (-510.865) (-511.544) [-509.956] -- 0:00:49
221500 -- [-510.234] (-508.639) (-512.804) (-514.243) * (-514.037) [-509.064] (-512.245) (-515.942) -- 0:00:49
222000 -- (-509.916) (-511.554) (-511.917) [-509.967] * (-510.762) (-512.497) [-510.436] (-515.938) -- 0:00:49
222500 -- (-511.933) (-509.926) (-509.479) [-512.028] * (-508.746) (-513.850) [-510.402] (-511.352) -- 0:00:48
223000 -- [-511.490] (-509.107) (-510.188) (-510.245) * (-514.960) (-510.561) (-510.351) [-510.724] -- 0:00:48
223500 -- [-510.315] (-509.290) (-509.726) (-510.869) * [-511.083] (-510.198) (-509.094) (-510.112) -- 0:00:48
224000 -- (-509.832) (-514.923) (-513.801) [-509.955] * (-508.480) (-510.541) (-510.505) [-510.462] -- 0:00:48
224500 -- (-510.448) (-510.319) (-509.286) [-508.242] * [-509.763] (-509.647) (-511.294) (-512.811) -- 0:00:48
225000 -- (-509.051) (-511.445) (-509.185) [-508.078] * (-510.380) (-511.178) [-511.051] (-514.110) -- 0:00:48
Average standard deviation of split frequencies: 0.018541
225500 -- (-512.333) (-511.454) (-509.232) [-510.085] * (-509.038) [-509.502] (-508.366) (-511.643) -- 0:00:48
226000 -- [-514.475] (-510.856) (-509.010) (-511.957) * [-509.666] (-508.919) (-513.397) (-510.443) -- 0:00:47
226500 -- [-512.265] (-510.107) (-513.845) (-511.292) * (-511.503) (-509.787) [-511.726] (-509.701) -- 0:00:47
227000 -- (-512.341) (-509.332) (-512.544) [-513.168] * (-508.608) (-511.428) [-511.858] (-510.531) -- 0:00:47
227500 -- (-510.914) [-509.257] (-515.076) (-509.593) * (-512.565) (-510.646) (-516.853) [-509.463] -- 0:00:47
228000 -- (-509.854) (-511.033) [-510.499] (-513.501) * (-513.022) [-510.931] (-511.603) (-513.255) -- 0:00:47
228500 -- (-511.510) [-511.717] (-510.932) (-511.200) * (-511.208) (-508.651) [-510.316] (-511.893) -- 0:00:47
229000 -- [-509.563] (-510.337) (-511.085) (-514.242) * (-510.781) [-516.232] (-510.415) (-512.859) -- 0:00:47
229500 -- (-509.090) (-511.388) [-508.910] (-510.800) * (-508.474) [-512.511] (-511.482) (-508.703) -- 0:00:47
230000 -- [-508.427] (-508.090) (-508.766) (-509.376) * (-509.356) (-513.372) (-509.464) [-508.467] -- 0:00:46
Average standard deviation of split frequencies: 0.018279
230500 -- (-509.394) [-510.072] (-509.831) (-512.468) * (-509.503) (-517.164) [-509.442] (-510.064) -- 0:00:46
231000 -- (-509.943) [-510.010] (-509.589) (-514.464) * (-509.706) (-510.736) [-509.106] (-510.607) -- 0:00:46
231500 -- (-512.776) (-509.424) (-512.508) [-512.005] * [-512.324] (-508.192) (-510.186) (-510.879) -- 0:00:46
232000 -- (-509.633) [-509.153] (-517.054) (-514.002) * (-514.483) (-508.430) (-512.490) [-509.022] -- 0:00:46
232500 -- (-510.070) (-508.470) (-516.957) [-509.614] * (-512.985) [-508.379] (-509.584) (-513.863) -- 0:00:46
233000 -- [-509.952] (-509.639) (-510.349) (-510.037) * (-514.713) (-509.880) (-510.962) [-510.037] -- 0:00:46
233500 -- (-511.041) (-509.798) [-510.064] (-513.370) * [-508.763] (-510.635) (-514.004) (-511.796) -- 0:00:45
234000 -- (-513.131) (-511.717) (-509.625) [-512.055] * (-513.196) (-510.431) [-510.009] (-509.428) -- 0:00:45
234500 -- (-512.202) (-511.223) (-514.438) [-511.785] * [-509.203] (-511.637) (-511.091) (-512.780) -- 0:00:45
235000 -- (-513.323) [-509.870] (-512.059) (-512.690) * (-509.050) (-509.790) [-508.815] (-512.454) -- 0:00:45
Average standard deviation of split frequencies: 0.017136
235500 -- (-510.364) (-510.707) [-509.692] (-510.500) * (-519.313) (-509.144) [-517.320] (-510.535) -- 0:00:48
236000 -- (-510.471) [-515.167] (-510.955) (-511.043) * (-511.034) (-508.173) [-508.857] (-512.367) -- 0:00:48
236500 -- [-511.983] (-512.211) (-509.639) (-511.260) * (-511.199) [-508.490] (-512.513) (-509.322) -- 0:00:48
237000 -- (-509.335) (-512.333) [-513.439] (-509.230) * (-508.512) [-511.130] (-510.226) (-512.092) -- 0:00:48
237500 -- (-511.521) (-509.264) (-514.141) [-509.362] * (-509.831) (-508.838) [-508.388] (-512.034) -- 0:00:48
238000 -- (-509.682) [-509.818] (-510.541) (-512.071) * [-508.859] (-509.122) (-508.139) (-510.358) -- 0:00:48
238500 -- (-513.639) [-510.356] (-510.135) (-510.520) * [-508.452] (-508.881) (-508.487) (-510.688) -- 0:00:47
239000 -- (-510.046) (-510.545) (-509.151) [-508.317] * (-510.746) (-512.660) (-512.977) [-509.968] -- 0:00:47
239500 -- [-509.215] (-508.849) (-515.496) (-510.389) * (-509.816) (-509.739) [-511.582] (-513.099) -- 0:00:47
240000 -- [-515.305] (-513.454) (-514.300) (-510.857) * (-508.804) (-509.128) [-509.885] (-515.093) -- 0:00:47
Average standard deviation of split frequencies: 0.017423
240500 -- (-511.239) (-512.993) [-510.430] (-515.568) * (-509.425) (-509.899) (-509.882) [-510.563] -- 0:00:47
241000 -- [-511.775] (-512.189) (-513.688) (-508.571) * (-508.935) (-509.272) (-509.890) [-512.031] -- 0:00:47
241500 -- (-509.323) (-513.679) (-511.180) [-508.468] * (-508.325) [-508.793] (-509.303) (-509.850) -- 0:00:47
242000 -- (-509.969) [-510.748] (-511.645) (-509.659) * (-511.800) (-511.281) [-509.384] (-509.974) -- 0:00:46
242500 -- (-508.685) (-511.706) (-511.625) [-509.748] * (-512.213) [-509.094] (-512.292) (-508.360) -- 0:00:46
243000 -- (-513.997) (-511.791) [-509.059] (-513.383) * [-511.385] (-508.816) (-512.239) (-508.604) -- 0:00:46
243500 -- (-516.454) (-521.032) [-509.673] (-512.025) * (-511.054) [-509.177] (-511.237) (-513.066) -- 0:00:46
244000 -- (-512.043) (-510.823) (-510.919) [-510.291] * [-511.010] (-508.659) (-510.545) (-511.822) -- 0:00:46
244500 -- [-510.899] (-515.551) (-510.590) (-510.097) * (-513.785) (-509.679) [-511.291] (-510.663) -- 0:00:46
245000 -- [-509.398] (-512.477) (-509.867) (-511.870) * [-509.971] (-511.367) (-512.549) (-513.564) -- 0:00:46
Average standard deviation of split frequencies: 0.016036
245500 -- (-509.010) (-513.593) [-512.664] (-510.331) * (-510.086) [-511.948] (-509.713) (-511.018) -- 0:00:46
246000 -- [-510.109] (-508.761) (-513.230) (-512.452) * [-511.908] (-511.749) (-509.637) (-510.793) -- 0:00:45
246500 -- (-512.119) [-509.587] (-513.368) (-512.993) * (-512.928) (-509.047) [-510.281] (-517.334) -- 0:00:45
247000 -- (-512.091) (-509.490) (-510.689) [-509.437] * [-509.590] (-509.018) (-509.070) (-514.966) -- 0:00:45
247500 -- [-508.963] (-508.739) (-512.285) (-509.358) * (-509.890) [-509.081] (-509.827) (-513.573) -- 0:00:45
248000 -- (-508.556) (-509.980) (-510.101) [-508.413] * (-508.991) (-511.106) [-511.144] (-508.577) -- 0:00:45
248500 -- (-508.424) (-511.342) [-510.542] (-509.191) * (-511.446) [-510.126] (-509.174) (-509.848) -- 0:00:45
249000 -- (-509.911) (-511.600) [-509.035] (-510.550) * (-513.641) (-517.152) (-515.680) [-509.109] -- 0:00:45
249500 -- [-509.148] (-510.965) (-508.844) (-511.229) * [-510.314] (-513.202) (-516.167) (-510.223) -- 0:00:45
250000 -- (-513.319) (-510.145) [-512.036] (-509.447) * (-509.111) (-511.996) (-508.926) [-509.632] -- 0:00:45
Average standard deviation of split frequencies: 0.015254
250500 -- (-511.440) [-509.041] (-511.903) (-510.584) * (-512.226) [-508.668] (-511.602) (-509.600) -- 0:00:44
251000 -- (-510.485) [-509.453] (-513.827) (-510.614) * [-510.700] (-511.021) (-510.501) (-509.125) -- 0:00:44
251500 -- (-510.398) (-511.231) (-509.958) [-509.774] * [-510.593] (-510.230) (-509.564) (-509.930) -- 0:00:44
252000 -- [-509.546] (-514.506) (-509.208) (-509.814) * (-510.460) (-510.465) (-509.786) [-512.293] -- 0:00:47
252500 -- [-511.210] (-509.749) (-510.395) (-511.461) * [-512.326] (-510.987) (-509.031) (-511.064) -- 0:00:47
253000 -- (-510.705) (-511.231) (-510.323) [-512.439] * [-513.219] (-509.714) (-510.692) (-510.844) -- 0:00:47
253500 -- (-510.526) (-509.015) [-511.856] (-509.276) * (-513.674) (-511.895) [-511.376] (-512.068) -- 0:00:47
254000 -- [-509.117] (-511.268) (-513.796) (-510.482) * (-510.251) (-511.545) (-511.130) [-508.515] -- 0:00:46
254500 -- (-508.520) [-509.664] (-514.463) (-512.915) * (-509.203) (-510.968) (-509.230) [-508.385] -- 0:00:46
255000 -- [-509.950] (-511.245) (-509.404) (-511.322) * (-508.459) [-509.232] (-509.215) (-508.993) -- 0:00:46
Average standard deviation of split frequencies: 0.015652
255500 -- [-509.508] (-509.662) (-510.587) (-510.556) * (-508.861) (-513.091) [-510.108] (-509.679) -- 0:00:46
256000 -- (-511.150) (-510.043) (-513.982) [-510.587] * [-509.950] (-510.701) (-512.455) (-510.182) -- 0:00:46
256500 -- [-510.564] (-510.924) (-512.189) (-512.868) * (-509.690) (-510.792) [-508.586] (-511.757) -- 0:00:46
257000 -- (-513.144) (-517.054) (-512.020) [-513.618] * [-508.545] (-508.371) (-508.864) (-510.643) -- 0:00:46
257500 -- (-508.941) (-513.981) [-508.166] (-509.279) * (-511.411) (-509.879) [-509.771] (-509.085) -- 0:00:46
258000 -- [-511.448] (-511.725) (-509.634) (-509.617) * [-508.513] (-509.454) (-511.066) (-510.442) -- 0:00:46
258500 -- (-509.745) (-512.709) [-513.942] (-512.616) * (-511.874) (-509.274) (-510.304) [-509.661] -- 0:00:45
259000 -- (-509.068) [-513.527] (-514.304) (-508.340) * [-510.448] (-509.464) (-510.525) (-508.823) -- 0:00:45
259500 -- (-511.898) [-511.521] (-512.450) (-509.270) * (-513.145) (-516.413) [-511.605] (-511.556) -- 0:00:45
260000 -- (-511.025) (-510.312) (-510.593) [-509.779] * (-514.839) (-510.048) (-511.167) [-509.744] -- 0:00:45
Average standard deviation of split frequencies: 0.014166
260500 -- (-508.820) [-509.699] (-510.402) (-512.200) * (-510.402) [-510.449] (-511.876) (-511.180) -- 0:00:45
261000 -- (-508.216) [-509.683] (-511.853) (-508.745) * (-509.396) (-510.473) [-509.265] (-511.623) -- 0:00:45
261500 -- (-508.993) (-509.922) [-508.894] (-508.922) * (-516.351) (-512.381) [-508.540] (-509.109) -- 0:00:45
262000 -- (-510.250) (-511.614) [-510.696] (-510.150) * [-512.484] (-511.894) (-508.609) (-511.030) -- 0:00:45
262500 -- [-509.807] (-513.112) (-508.210) (-510.345) * [-513.935] (-514.690) (-509.614) (-510.834) -- 0:00:44
263000 -- (-511.036) (-511.825) [-508.237] (-511.442) * (-513.301) (-511.210) (-509.430) [-511.380] -- 0:00:44
263500 -- [-511.068] (-511.266) (-509.375) (-509.913) * (-511.365) (-510.383) (-508.541) [-511.412] -- 0:00:44
264000 -- (-512.099) [-511.734] (-509.444) (-509.528) * (-512.492) (-513.159) [-512.217] (-511.807) -- 0:00:44
264500 -- [-509.611] (-510.531) (-511.483) (-509.988) * (-513.296) (-514.846) [-509.698] (-509.495) -- 0:00:44
265000 -- (-509.546) (-513.509) (-509.892) [-508.409] * (-513.013) [-508.289] (-510.211) (-509.951) -- 0:00:44
Average standard deviation of split frequencies: 0.013525
265500 -- (-510.598) (-509.065) [-510.877] (-511.280) * [-508.890] (-508.619) (-509.715) (-512.634) -- 0:00:44
266000 -- (-509.620) (-513.714) [-511.502] (-509.699) * [-508.242] (-517.004) (-512.018) (-512.885) -- 0:00:44
266500 -- (-513.191) (-512.224) [-510.752] (-509.743) * (-512.290) (-513.209) [-512.445] (-512.536) -- 0:00:44
267000 -- (-510.103) (-510.564) (-511.092) [-508.261] * [-514.477] (-511.188) (-513.957) (-510.468) -- 0:00:43
267500 -- [-508.373] (-509.533) (-512.377) (-509.569) * (-512.293) (-512.247) [-508.669] (-508.812) -- 0:00:43
268000 -- [-509.062] (-513.650) (-509.869) (-512.853) * (-510.222) (-509.221) (-511.420) [-509.744] -- 0:00:43
268500 -- [-508.844] (-510.949) (-510.382) (-510.863) * [-511.096] (-510.558) (-510.961) (-508.528) -- 0:00:43
269000 -- (-509.266) (-509.790) (-511.444) [-510.036] * [-512.037] (-513.089) (-515.334) (-512.877) -- 0:00:46
269500 -- [-512.050] (-509.432) (-510.051) (-509.502) * (-510.158) (-513.841) (-511.239) [-511.184] -- 0:00:46
270000 -- (-510.358) [-511.094] (-509.193) (-510.998) * (-511.955) [-510.421] (-511.401) (-509.802) -- 0:00:45
Average standard deviation of split frequencies: 0.013566
270500 -- (-511.252) (-508.620) (-510.864) [-511.362] * [-509.380] (-508.923) (-510.047) (-514.220) -- 0:00:45
271000 -- (-510.267) (-508.838) (-515.263) [-512.005] * (-509.300) [-509.406] (-508.213) (-515.679) -- 0:00:45
271500 -- [-509.466] (-508.124) (-509.204) (-511.054) * (-509.405) (-511.281) [-508.464] (-509.753) -- 0:00:45
272000 -- (-509.339) (-509.958) (-508.421) [-513.225] * [-510.953] (-508.968) (-508.539) (-515.755) -- 0:00:45
272500 -- (-508.764) (-514.227) (-509.845) [-510.779] * (-510.354) (-509.078) (-511.153) [-512.507] -- 0:00:45
273000 -- (-511.694) [-510.126] (-511.368) (-510.772) * [-508.539] (-512.468) (-509.715) (-513.806) -- 0:00:45
273500 -- (-510.626) [-510.219] (-509.515) (-510.194) * [-509.710] (-512.855) (-510.539) (-514.531) -- 0:00:45
274000 -- (-513.040) (-511.039) (-509.536) [-510.619] * (-510.674) (-512.971) (-512.730) [-510.397] -- 0:00:45
274500 -- (-510.828) (-515.557) [-510.237] (-508.439) * (-510.294) (-511.462) (-512.575) [-510.978] -- 0:00:44
275000 -- [-510.269] (-512.711) (-510.417) (-508.164) * (-512.159) (-510.989) (-511.557) [-509.289] -- 0:00:44
Average standard deviation of split frequencies: 0.012525
275500 -- (-509.686) (-514.014) [-512.233] (-512.416) * (-512.031) (-509.323) [-511.812] (-513.216) -- 0:00:44
276000 -- (-510.761) [-509.945] (-510.342) (-512.849) * [-510.423] (-510.190) (-509.954) (-510.044) -- 0:00:44
276500 -- (-509.163) (-512.556) (-511.830) [-510.233] * (-515.015) (-510.742) [-509.626] (-511.967) -- 0:00:44
277000 -- [-509.672] (-512.269) (-510.541) (-513.425) * (-509.316) (-511.551) [-515.405] (-509.536) -- 0:00:44
277500 -- (-508.382) (-512.062) (-509.665) [-510.941] * (-510.535) (-511.972) [-511.049] (-508.568) -- 0:00:44
278000 -- (-512.894) [-509.367] (-509.878) (-510.616) * (-510.901) (-509.640) [-511.715] (-509.314) -- 0:00:44
278500 -- (-510.810) [-510.405] (-510.187) (-513.140) * [-509.980] (-511.701) (-511.268) (-509.841) -- 0:00:44
279000 -- (-512.050) (-509.042) [-511.198] (-510.207) * (-509.400) (-510.677) (-514.712) [-509.025] -- 0:00:43
279500 -- (-511.336) [-509.953] (-510.594) (-510.292) * [-509.581] (-513.330) (-511.829) (-511.215) -- 0:00:43
280000 -- (-514.013) (-511.764) [-514.167] (-511.254) * [-508.245] (-517.517) (-509.018) (-510.940) -- 0:00:43
Average standard deviation of split frequencies: 0.012877
280500 -- (-509.406) (-511.795) [-510.232] (-513.868) * [-513.479] (-516.960) (-511.150) (-511.678) -- 0:00:43
281000 -- (-509.541) (-509.275) [-509.802] (-515.340) * (-510.739) [-513.668] (-508.630) (-513.234) -- 0:00:43
281500 -- (-508.171) (-513.509) (-509.201) [-512.462] * (-508.612) (-510.171) (-509.517) [-510.390] -- 0:00:43
282000 -- (-509.552) [-509.459] (-512.427) (-512.356) * (-509.925) (-509.206) (-508.981) [-510.069] -- 0:00:43
282500 -- (-510.914) (-511.175) (-508.833) [-509.984] * (-515.396) (-510.491) [-512.414] (-508.695) -- 0:00:43
283000 -- (-510.066) [-512.094] (-511.083) (-514.529) * (-508.957) (-511.020) (-511.312) [-509.125] -- 0:00:43
283500 -- (-510.054) [-515.520] (-509.682) (-513.799) * [-511.988] (-511.250) (-509.296) (-509.096) -- 0:00:42
284000 -- [-509.385] (-510.923) (-509.664) (-511.022) * [-512.830] (-515.053) (-510.408) (-513.736) -- 0:00:42
284500 -- (-511.149) (-510.592) (-509.279) [-510.600] * [-510.006] (-511.142) (-509.277) (-509.261) -- 0:00:42
285000 -- [-513.731] (-510.241) (-512.634) (-512.556) * (-509.244) (-511.656) (-511.922) [-509.301] -- 0:00:45
Average standard deviation of split frequencies: 0.013003
285500 -- (-511.522) (-509.137) [-508.450] (-512.094) * (-511.077) (-509.885) (-511.855) [-508.344] -- 0:00:45
286000 -- [-510.857] (-511.420) (-511.240) (-509.120) * (-510.461) (-514.058) [-511.912] (-510.783) -- 0:00:44
286500 -- (-509.908) (-511.970) (-512.855) [-510.463] * [-510.093] (-512.381) (-509.418) (-513.250) -- 0:00:44
287000 -- (-509.172) (-509.379) [-509.831] (-515.658) * (-513.372) (-512.428) (-509.505) [-509.153] -- 0:00:44
287500 -- (-512.979) [-511.950] (-509.065) (-517.422) * (-511.934) (-513.184) (-511.342) [-509.126] -- 0:00:44
288000 -- (-509.724) (-509.846) [-513.855] (-509.856) * (-511.585) [-511.372] (-510.995) (-509.752) -- 0:00:44
288500 -- (-509.053) [-509.116] (-509.241) (-512.779) * (-509.612) (-509.459) [-509.967] (-509.787) -- 0:00:44
289000 -- [-509.242] (-508.645) (-510.203) (-514.152) * (-512.895) [-512.223] (-512.846) (-509.537) -- 0:00:44
289500 -- (-508.965) [-515.382] (-509.527) (-509.762) * (-510.387) (-512.236) [-509.919] (-509.363) -- 0:00:44
290000 -- (-509.568) [-509.412] (-508.832) (-509.582) * [-510.392] (-509.817) (-510.297) (-509.325) -- 0:00:44
Average standard deviation of split frequencies: 0.011263
290500 -- (-510.882) (-510.351) [-508.530] (-512.254) * [-512.784] (-510.460) (-510.241) (-510.674) -- 0:00:43
291000 -- (-512.961) [-508.308] (-509.247) (-511.377) * (-511.611) (-509.095) [-508.322] (-511.335) -- 0:00:43
291500 -- [-511.298] (-510.814) (-513.808) (-515.945) * [-509.469] (-509.156) (-508.951) (-509.645) -- 0:00:43
292000 -- (-511.914) (-513.285) [-511.002] (-509.365) * (-511.094) [-510.817] (-510.707) (-511.247) -- 0:00:43
292500 -- (-510.786) (-511.520) [-512.274] (-511.170) * [-509.720] (-509.460) (-512.485) (-509.974) -- 0:00:43
293000 -- (-510.128) (-511.792) (-510.527) [-509.465] * (-512.953) (-510.445) (-510.069) [-509.519] -- 0:00:43
293500 -- (-510.323) (-513.058) [-510.574] (-513.757) * [-508.751] (-511.646) (-509.508) (-511.113) -- 0:00:43
294000 -- (-509.765) (-511.557) (-508.516) [-511.360] * (-508.931) (-511.996) [-508.836] (-510.788) -- 0:00:43
294500 -- [-511.506] (-513.763) (-509.347) (-514.481) * (-509.060) [-511.865] (-511.567) (-509.388) -- 0:00:43
295000 -- (-512.459) (-512.404) (-509.581) [-513.896] * [-512.204] (-513.347) (-513.413) (-510.429) -- 0:00:43
Average standard deviation of split frequencies: 0.011325
295500 -- (-509.178) [-508.531] (-511.520) (-513.172) * [-509.227] (-511.504) (-512.350) (-510.054) -- 0:00:42
296000 -- (-510.847) (-510.468) (-509.002) [-511.883] * (-511.452) (-509.959) (-511.562) [-511.309] -- 0:00:42
296500 -- (-514.164) (-511.167) (-508.545) [-509.435] * (-509.565) [-510.416] (-511.210) (-515.133) -- 0:00:42
297000 -- [-511.563] (-513.712) (-508.693) (-511.981) * [-515.258] (-508.972) (-512.883) (-508.945) -- 0:00:42
297500 -- (-510.361) [-511.563] (-508.593) (-509.078) * (-508.719) [-512.794] (-508.273) (-508.839) -- 0:00:42
298000 -- [-512.869] (-510.149) (-509.859) (-509.510) * (-509.145) [-509.184] (-508.158) (-508.570) -- 0:00:42
298500 -- (-516.378) (-510.127) [-509.380] (-512.639) * (-511.265) (-513.765) [-510.550] (-511.900) -- 0:00:42
299000 -- (-518.728) [-509.210] (-510.319) (-513.173) * (-513.391) (-510.115) (-513.112) [-510.516] -- 0:00:42
299500 -- (-510.794) [-516.102] (-512.962) (-513.411) * (-514.518) [-508.714] (-510.445) (-509.944) -- 0:00:42
300000 -- (-511.553) [-512.528] (-509.432) (-508.752) * (-510.790) [-509.541] (-510.345) (-511.071) -- 0:00:42
Average standard deviation of split frequencies: 0.012635
300500 -- (-510.397) [-508.944] (-511.969) (-510.054) * (-509.317) (-509.550) (-509.431) [-513.078] -- 0:00:44
301000 -- (-510.401) (-509.947) (-514.902) [-510.511] * (-514.679) (-512.149) [-509.319] (-510.125) -- 0:00:44
301500 -- (-509.118) [-511.918] (-509.600) (-510.273) * (-510.540) (-511.115) (-510.771) [-509.145] -- 0:00:44
302000 -- (-510.001) (-512.746) (-512.141) [-511.276] * (-509.325) [-509.512] (-509.610) (-510.697) -- 0:00:43
302500 -- (-516.431) (-509.902) (-509.315) [-509.952] * (-509.841) (-510.290) [-515.008] (-511.213) -- 0:00:43
303000 -- (-509.206) (-508.818) [-510.430] (-512.626) * (-512.340) (-513.068) (-510.664) [-510.565] -- 0:00:43
303500 -- (-508.548) (-509.992) [-509.359] (-511.197) * (-512.428) (-512.114) (-509.201) [-510.205] -- 0:00:43
304000 -- (-509.740) (-509.224) [-509.135] (-511.208) * (-510.611) [-509.453] (-509.607) (-510.155) -- 0:00:43
304500 -- (-511.425) [-508.670] (-509.365) (-509.572) * (-510.318) [-509.757] (-512.366) (-510.009) -- 0:00:43
305000 -- (-515.485) (-509.784) [-510.243] (-508.976) * (-508.673) (-509.006) [-510.265] (-509.732) -- 0:00:43
Average standard deviation of split frequencies: 0.011690
305500 -- [-508.692] (-510.875) (-509.485) (-510.051) * (-515.204) (-516.952) [-509.126] (-509.031) -- 0:00:43
306000 -- [-510.039] (-510.902) (-509.336) (-509.402) * [-510.522] (-510.668) (-512.022) (-510.595) -- 0:00:43
306500 -- (-510.356) [-509.466] (-509.455) (-510.961) * (-510.131) (-509.825) [-509.613] (-512.054) -- 0:00:42
307000 -- (-510.200) (-515.112) (-511.057) [-512.215] * (-509.288) [-509.831] (-510.269) (-513.909) -- 0:00:42
307500 -- [-512.567] (-515.068) (-511.188) (-518.248) * [-511.807] (-522.448) (-508.426) (-511.516) -- 0:00:42
308000 -- [-509.039] (-513.798) (-510.340) (-508.838) * [-508.781] (-509.833) (-510.946) (-510.494) -- 0:00:42
308500 -- (-513.116) (-512.216) (-508.330) [-510.288] * (-511.333) (-510.912) [-510.375] (-510.726) -- 0:00:42
309000 -- (-512.908) (-511.108) (-509.893) [-510.976] * (-508.756) (-509.802) (-510.177) [-510.319] -- 0:00:42
309500 -- (-509.144) (-510.486) [-510.005] (-509.903) * (-509.717) (-508.877) (-512.663) [-510.473] -- 0:00:42
310000 -- (-508.685) [-511.215] (-513.459) (-511.254) * [-511.737] (-509.046) (-514.592) (-508.855) -- 0:00:42
Average standard deviation of split frequencies: 0.011855
310500 -- [-511.329] (-510.621) (-508.686) (-512.432) * (-509.916) (-509.474) (-511.276) [-508.998] -- 0:00:42
311000 -- (-509.597) [-509.746] (-509.301) (-509.185) * (-513.064) [-509.458] (-512.847) (-509.394) -- 0:00:42
311500 -- [-511.196] (-510.388) (-516.032) (-509.614) * (-510.967) (-508.781) (-509.551) [-512.096] -- 0:00:41
312000 -- (-514.826) (-511.373) [-510.103] (-512.010) * (-513.689) [-513.295] (-509.079) (-511.077) -- 0:00:41
312500 -- (-509.411) [-510.200] (-512.956) (-513.159) * (-510.574) (-511.386) (-510.857) [-513.301] -- 0:00:41
313000 -- [-511.387] (-508.487) (-512.103) (-512.608) * (-510.709) (-510.410) (-509.421) [-510.208] -- 0:00:41
313500 -- (-510.638) (-514.332) [-509.823] (-511.965) * (-508.997) (-509.763) [-510.136] (-511.211) -- 0:00:41
314000 -- (-514.965) (-512.600) [-513.665] (-508.587) * (-512.713) (-512.302) (-511.245) [-509.368] -- 0:00:41
314500 -- [-510.213] (-517.454) (-512.412) (-508.163) * (-511.335) (-509.654) (-509.655) [-511.602] -- 0:00:41
315000 -- (-511.033) (-511.724) (-508.703) [-510.338] * (-512.800) [-509.263] (-512.711) (-511.116) -- 0:00:41
Average standard deviation of split frequencies: 0.012400
315500 -- [-509.402] (-510.711) (-509.931) (-509.311) * (-510.726) (-511.003) [-508.920] (-511.117) -- 0:00:41
316000 -- [-509.593] (-513.377) (-510.847) (-511.933) * [-510.486] (-511.217) (-511.408) (-508.922) -- 0:00:41
316500 -- (-510.984) (-516.725) [-511.196] (-509.280) * [-511.054] (-509.266) (-509.998) (-512.314) -- 0:00:41
317000 -- [-516.789] (-515.429) (-510.262) (-510.465) * [-514.265] (-510.976) (-509.114) (-510.196) -- 0:00:43
317500 -- (-512.152) (-512.329) (-511.765) [-509.063] * (-510.751) (-511.637) (-520.842) [-509.936] -- 0:00:42
318000 -- (-511.163) (-508.427) (-510.706) [-509.837] * [-509.375] (-511.127) (-514.695) (-510.880) -- 0:00:42
318500 -- (-509.343) [-511.040] (-513.139) (-510.400) * (-509.710) (-512.215) (-514.852) [-509.324] -- 0:00:42
319000 -- (-510.390) (-509.685) [-510.464] (-510.070) * [-508.423] (-509.224) (-510.799) (-508.806) -- 0:00:42
319500 -- (-512.378) (-510.436) (-510.220) [-514.943] * (-515.943) [-508.480] (-509.478) (-511.997) -- 0:00:42
320000 -- (-516.656) (-510.092) (-508.981) [-510.052] * (-516.767) [-511.455] (-509.813) (-512.731) -- 0:00:42
Average standard deviation of split frequencies: 0.011577
320500 -- (-511.830) (-512.096) (-509.511) [-509.521] * (-509.258) [-510.737] (-510.275) (-513.840) -- 0:00:42
321000 -- (-513.990) [-509.554] (-512.780) (-511.999) * (-509.859) [-510.803] (-509.172) (-510.265) -- 0:00:42
321500 -- [-509.555] (-508.548) (-511.612) (-516.211) * (-510.063) (-508.230) [-510.335] (-509.518) -- 0:00:42
322000 -- (-512.503) [-510.961] (-511.077) (-509.487) * (-509.479) [-508.983] (-511.071) (-511.567) -- 0:00:42
322500 -- (-511.966) (-509.177) (-509.247) [-510.580] * (-510.980) (-509.606) (-508.722) [-510.597] -- 0:00:42
323000 -- (-510.145) (-509.642) [-508.344] (-510.394) * (-511.267) (-509.629) (-509.856) [-509.283] -- 0:00:41
323500 -- (-511.089) (-512.571) (-508.675) [-508.967] * (-511.680) [-510.561] (-509.122) (-512.516) -- 0:00:41
324000 -- (-509.179) (-512.266) (-512.129) [-510.260] * (-510.533) (-510.131) [-508.547] (-510.345) -- 0:00:41
324500 -- (-511.868) (-510.004) [-510.055] (-512.240) * (-510.965) (-510.594) [-509.863] (-508.565) -- 0:00:41
325000 -- (-510.447) (-509.162) (-511.273) [-510.040] * (-512.170) (-511.205) (-511.008) [-510.209] -- 0:00:41
Average standard deviation of split frequencies: 0.011483
325500 -- [-509.085] (-508.910) (-509.250) (-514.642) * (-512.554) (-510.783) [-511.979] (-511.468) -- 0:00:41
326000 -- (-512.744) [-510.174] (-510.322) (-508.936) * [-511.075] (-513.751) (-511.392) (-510.216) -- 0:00:41
326500 -- [-515.261] (-509.346) (-512.817) (-509.815) * [-508.306] (-510.728) (-511.670) (-515.365) -- 0:00:41
327000 -- (-514.093) (-509.396) [-508.805] (-511.616) * (-509.581) [-508.543] (-514.504) (-513.628) -- 0:00:41
327500 -- [-510.604] (-508.621) (-512.731) (-512.401) * [-513.981] (-511.215) (-510.989) (-509.615) -- 0:00:41
328000 -- [-511.374] (-510.082) (-513.384) (-512.781) * (-513.858) (-509.618) [-509.461] (-509.626) -- 0:00:40
328500 -- (-510.364) (-511.305) (-510.166) [-509.244] * (-514.258) [-510.049] (-509.970) (-510.350) -- 0:00:40
329000 -- (-512.156) [-510.958] (-510.390) (-510.723) * (-509.078) (-512.331) [-508.334] (-510.004) -- 0:00:40
329500 -- (-508.801) (-510.090) (-509.639) [-510.408] * (-510.750) (-512.325) [-510.512] (-516.751) -- 0:00:40
330000 -- [-509.639] (-509.686) (-510.606) (-509.230) * (-514.237) [-508.845] (-509.543) (-510.889) -- 0:00:40
Average standard deviation of split frequencies: 0.011850
330500 -- (-508.822) (-508.586) [-509.696] (-515.777) * [-511.574] (-511.834) (-508.875) (-513.345) -- 0:00:40
331000 -- (-509.438) (-511.242) (-509.651) [-511.066] * (-511.444) (-510.769) (-514.056) [-511.025] -- 0:00:40
331500 -- [-511.131] (-512.478) (-511.194) (-512.123) * (-513.411) (-509.901) [-509.773] (-509.210) -- 0:00:40
332000 -- [-512.928] (-510.170) (-509.405) (-511.556) * [-512.601] (-511.272) (-509.207) (-514.523) -- 0:00:40
332500 -- (-512.816) [-512.909] (-513.226) (-511.723) * (-511.616) [-509.776] (-509.665) (-510.384) -- 0:00:40
333000 -- (-512.957) (-510.110) (-509.422) [-508.346] * [-513.883] (-511.126) (-509.428) (-510.119) -- 0:00:40
333500 -- (-514.279) (-510.950) (-509.793) [-510.924] * (-509.665) [-511.027] (-510.404) (-510.969) -- 0:00:41
334000 -- (-509.383) [-508.466] (-509.455) (-514.805) * [-512.194] (-511.432) (-510.797) (-510.396) -- 0:00:41
334500 -- (-508.548) (-510.346) [-510.448] (-514.561) * (-510.404) [-508.613] (-510.784) (-511.077) -- 0:00:41
335000 -- (-510.091) [-509.363] (-508.539) (-516.747) * (-510.099) [-509.862] (-509.074) (-511.419) -- 0:00:41
Average standard deviation of split frequencies: 0.010976
335500 -- [-511.560] (-510.272) (-512.243) (-517.366) * (-512.643) (-510.294) (-511.399) [-512.747] -- 0:00:41
336000 -- [-508.850] (-510.252) (-516.160) (-510.267) * [-510.544] (-510.428) (-511.497) (-513.559) -- 0:00:41
336500 -- [-509.018] (-512.662) (-514.392) (-511.331) * [-510.068] (-510.515) (-509.349) (-515.674) -- 0:00:41
337000 -- (-509.315) [-510.491] (-510.990) (-511.232) * (-510.326) [-508.615] (-510.561) (-511.201) -- 0:00:41
337500 -- (-510.412) [-508.633] (-511.926) (-510.220) * (-510.510) [-508.885] (-514.713) (-509.063) -- 0:00:41
338000 -- [-509.766] (-509.088) (-508.519) (-508.287) * [-508.909] (-511.738) (-514.863) (-508.916) -- 0:00:41
338500 -- (-510.697) [-508.852] (-509.070) (-511.554) * (-511.464) [-512.506] (-510.201) (-510.750) -- 0:00:41
339000 -- (-508.925) [-512.967] (-511.624) (-509.184) * (-511.014) (-511.662) [-510.288] (-508.877) -- 0:00:40
339500 -- (-511.239) (-514.924) [-513.986] (-509.634) * (-510.388) [-509.124] (-510.308) (-511.424) -- 0:00:40
340000 -- [-511.457] (-510.225) (-509.901) (-509.782) * (-511.893) (-508.793) [-509.920] (-510.290) -- 0:00:40
Average standard deviation of split frequencies: 0.009686
340500 -- (-510.594) (-511.046) [-510.386] (-514.639) * (-509.067) (-514.434) [-508.595] (-508.802) -- 0:00:40
341000 -- (-512.079) (-511.262) [-510.068] (-508.648) * (-510.278) (-511.805) (-509.915) [-509.470] -- 0:00:40
341500 -- [-508.953] (-511.681) (-516.637) (-509.717) * [-510.308] (-509.023) (-513.348) (-509.729) -- 0:00:40
342000 -- [-511.206] (-512.824) (-509.256) (-510.295) * (-509.774) (-509.492) (-510.798) [-512.590] -- 0:00:40
342500 -- (-514.877) (-511.304) (-508.685) [-511.289] * (-509.364) [-509.822] (-510.147) (-510.085) -- 0:00:40
343000 -- (-513.362) [-509.678] (-508.690) (-508.710) * (-511.759) [-509.129] (-511.268) (-509.263) -- 0:00:40
343500 -- (-515.439) (-508.131) (-509.326) [-511.392] * (-515.461) [-513.464] (-512.112) (-511.863) -- 0:00:40
344000 -- (-510.586) (-509.713) (-509.847) [-512.779] * (-515.733) (-510.429) [-508.906] (-510.861) -- 0:00:40
344500 -- (-509.428) (-510.171) (-509.513) [-510.298] * (-513.947) (-509.201) [-510.778] (-510.132) -- 0:00:39
345000 -- (-512.172) [-510.071] (-511.295) (-511.864) * (-508.475) (-509.010) (-512.722) [-511.291] -- 0:00:39
Average standard deviation of split frequencies: 0.009234
345500 -- (-513.575) (-510.249) [-511.689] (-509.662) * (-508.691) [-511.077] (-509.270) (-514.369) -- 0:00:39
346000 -- (-512.339) [-510.421] (-512.685) (-510.810) * (-510.251) (-515.105) [-508.229] (-509.358) -- 0:00:39
346500 -- (-510.461) (-509.248) (-514.609) [-509.913] * (-511.022) [-511.091] (-508.620) (-510.483) -- 0:00:39
347000 -- [-508.885] (-509.269) (-510.534) (-508.548) * (-508.947) [-509.917] (-510.440) (-518.101) -- 0:00:39
347500 -- (-509.299) [-510.456] (-510.766) (-508.244) * (-512.683) (-510.322) [-509.745] (-511.675) -- 0:00:39
348000 -- [-512.425] (-509.521) (-512.535) (-508.962) * (-513.981) (-510.998) [-510.780] (-510.779) -- 0:00:39
348500 -- (-509.151) [-509.873] (-512.488) (-509.543) * (-511.544) (-513.773) [-508.701] (-510.448) -- 0:00:39
349000 -- (-508.994) [-510.498] (-510.645) (-509.527) * (-512.127) (-512.544) [-511.378] (-509.352) -- 0:00:39
349500 -- (-509.242) (-508.665) (-509.043) [-509.295] * [-509.826] (-509.696) (-511.225) (-510.832) -- 0:00:39
350000 -- (-510.541) (-511.403) [-510.673] (-509.296) * [-511.846] (-510.692) (-510.589) (-511.265) -- 0:00:40
Average standard deviation of split frequencies: 0.008813
350500 -- (-510.473) (-509.953) [-511.142] (-512.819) * (-509.465) (-509.280) [-511.563] (-510.263) -- 0:00:40
351000 -- [-510.886] (-510.065) (-512.259) (-509.642) * [-512.941] (-510.545) (-511.366) (-509.823) -- 0:00:40
351500 -- [-511.069] (-509.239) (-513.438) (-510.343) * [-511.453] (-511.075) (-509.063) (-511.605) -- 0:00:40
352000 -- (-509.244) [-510.166] (-509.218) (-510.723) * (-512.844) [-509.594] (-513.034) (-509.719) -- 0:00:40
352500 -- (-513.094) (-512.559) (-508.273) [-510.369] * (-512.678) (-509.378) [-510.142] (-512.387) -- 0:00:40
353000 -- (-511.135) (-511.339) [-509.035] (-509.907) * (-512.249) (-510.615) (-511.062) [-509.433] -- 0:00:40
353500 -- (-509.172) (-511.358) (-513.125) [-509.997] * (-510.078) [-508.718] (-510.733) (-513.807) -- 0:00:40
354000 -- (-510.056) [-508.622] (-511.810) (-510.803) * (-511.539) (-510.191) (-509.702) [-513.751] -- 0:00:40
354500 -- (-509.947) [-511.992] (-509.900) (-517.805) * (-511.345) (-509.927) (-514.182) [-510.055] -- 0:00:40
355000 -- (-510.376) [-512.542] (-509.833) (-517.936) * [-510.502] (-511.558) (-519.438) (-509.940) -- 0:00:39
Average standard deviation of split frequencies: 0.008901
355500 -- (-511.068) [-509.672] (-512.431) (-510.519) * [-510.915] (-511.349) (-508.465) (-514.582) -- 0:00:39
356000 -- [-510.871] (-513.964) (-513.715) (-509.436) * (-509.852) [-513.395] (-514.609) (-510.042) -- 0:00:39
356500 -- (-509.298) (-511.489) (-511.721) [-509.908] * (-514.381) (-511.955) (-509.237) [-514.005] -- 0:00:39
357000 -- [-510.756] (-509.633) (-510.244) (-510.201) * (-509.347) [-510.794] (-511.687) (-510.618) -- 0:00:39
357500 -- (-509.221) (-512.380) [-508.839] (-509.399) * (-509.772) [-514.543] (-511.255) (-509.783) -- 0:00:39
358000 -- (-513.732) [-513.284] (-510.474) (-509.912) * (-509.732) [-509.143] (-510.601) (-511.059) -- 0:00:39
358500 -- (-513.401) (-509.556) [-514.558] (-512.482) * (-511.102) (-513.579) [-510.301] (-512.865) -- 0:00:39
359000 -- (-515.924) [-510.731] (-512.251) (-514.013) * [-509.230] (-508.742) (-509.517) (-509.767) -- 0:00:39
359500 -- (-510.310) (-512.127) [-512.124] (-517.392) * (-513.217) (-508.754) (-510.847) [-508.613] -- 0:00:39
360000 -- (-511.066) (-510.341) [-509.954] (-512.224) * (-511.439) [-511.754] (-510.370) (-512.451) -- 0:00:39
Average standard deviation of split frequencies: 0.007761
360500 -- (-512.903) (-509.539) [-508.415] (-512.105) * [-509.560] (-511.207) (-511.744) (-509.559) -- 0:00:39
361000 -- [-509.258] (-510.140) (-509.336) (-511.328) * (-509.580) [-509.149] (-509.074) (-508.207) -- 0:00:38
361500 -- (-509.300) (-509.363) (-508.289) [-508.577] * (-509.093) [-512.180] (-509.253) (-508.705) -- 0:00:38
362000 -- (-512.425) (-509.599) (-510.418) [-508.937] * (-508.377) [-513.198] (-509.354) (-510.436) -- 0:00:38
362500 -- (-510.075) (-513.284) [-511.795] (-509.215) * (-509.456) (-509.892) [-509.064] (-512.100) -- 0:00:38
363000 -- (-511.754) [-511.575] (-508.789) (-511.553) * (-509.978) (-512.593) [-509.090] (-512.500) -- 0:00:38
363500 -- (-510.499) (-513.395) [-509.952] (-514.066) * [-510.673] (-509.440) (-512.052) (-512.525) -- 0:00:38
364000 -- (-511.628) (-510.360) [-511.495] (-510.462) * (-511.502) [-509.296] (-513.535) (-512.292) -- 0:00:38
364500 -- (-511.528) (-508.671) [-512.284] (-509.923) * (-512.134) (-510.119) [-509.290] (-511.920) -- 0:00:38
365000 -- (-513.278) [-509.635] (-510.771) (-509.054) * [-508.969] (-515.091) (-511.722) (-510.300) -- 0:00:38
Average standard deviation of split frequencies: 0.008183
365500 -- [-509.410] (-509.606) (-516.634) (-509.511) * (-513.973) (-512.006) (-508.774) [-509.250] -- 0:00:38
366000 -- (-511.226) (-512.169) (-510.093) [-509.493] * (-510.723) (-508.608) [-511.327] (-508.421) -- 0:00:38
366500 -- [-509.843] (-509.770) (-509.680) (-509.135) * (-514.777) [-511.213] (-509.114) (-508.400) -- 0:00:39
367000 -- [-509.613] (-511.718) (-510.789) (-510.735) * (-509.225) (-512.120) (-511.325) [-509.554] -- 0:00:39
367500 -- (-509.525) (-510.064) [-511.133] (-510.928) * (-510.108) (-509.114) [-511.153] (-512.016) -- 0:00:39
368000 -- (-509.625) (-515.030) [-511.093] (-509.747) * (-517.072) (-509.436) (-509.671) [-508.936] -- 0:00:39
368500 -- (-514.193) [-508.956] (-510.899) (-508.488) * (-512.315) [-509.449] (-509.568) (-509.680) -- 0:00:39
369000 -- (-508.802) [-509.928] (-511.867) (-509.296) * [-509.010] (-509.474) (-513.852) (-508.715) -- 0:00:39
369500 -- (-510.473) (-513.180) (-509.156) [-509.458] * (-511.102) (-508.246) [-511.113] (-515.724) -- 0:00:39
370000 -- (-511.016) [-511.456] (-512.251) (-509.216) * (-509.596) (-510.939) [-515.347] (-515.581) -- 0:00:39
Average standard deviation of split frequencies: 0.007233
370500 -- (-512.887) (-510.018) (-511.740) [-510.901] * (-513.728) [-509.963] (-509.561) (-510.777) -- 0:00:39
371000 -- [-510.699] (-509.943) (-510.731) (-511.113) * (-512.183) (-510.122) [-509.742] (-509.329) -- 0:00:38
371500 -- (-511.089) (-512.950) (-508.298) [-511.216] * [-514.752] (-514.762) (-513.762) (-510.355) -- 0:00:38
372000 -- (-509.280) (-511.823) [-509.218] (-511.476) * [-508.879] (-510.954) (-512.016) (-509.619) -- 0:00:38
372500 -- [-511.935] (-510.494) (-510.436) (-509.875) * [-509.137] (-512.619) (-510.742) (-512.030) -- 0:00:38
373000 -- (-513.468) [-517.201] (-518.058) (-512.633) * (-511.293) [-509.066] (-509.671) (-512.557) -- 0:00:38
373500 -- (-509.769) [-511.430] (-512.539) (-508.830) * [-509.440] (-509.861) (-515.445) (-510.399) -- 0:00:38
374000 -- (-508.591) (-515.703) [-511.093] (-508.722) * (-509.415) (-513.763) (-510.800) [-511.061] -- 0:00:38
374500 -- (-509.583) [-508.873] (-515.819) (-508.187) * (-509.956) (-510.943) (-513.538) [-508.955] -- 0:00:38
375000 -- (-509.905) [-510.594] (-517.487) (-510.188) * (-508.612) (-509.762) [-513.167] (-512.035) -- 0:00:38
Average standard deviation of split frequencies: 0.007052
375500 -- (-510.400) (-512.794) (-513.497) [-510.374] * (-509.385) (-515.712) [-510.299] (-512.760) -- 0:00:38
376000 -- [-510.613] (-510.137) (-510.056) (-511.514) * (-508.532) (-510.379) [-510.182] (-512.469) -- 0:00:38
376500 -- (-510.443) (-515.381) (-511.536) [-509.168] * (-509.972) (-511.742) [-510.605] (-512.442) -- 0:00:38
377000 -- [-512.345] (-510.247) (-510.273) (-510.634) * (-508.701) (-509.484) (-514.220) [-508.998] -- 0:00:38
377500 -- (-511.357) (-508.496) (-509.557) [-509.383] * (-511.107) (-511.812) (-508.056) [-508.439] -- 0:00:37
378000 -- (-512.647) [-509.731] (-509.630) (-508.846) * (-513.957) (-510.139) [-510.684] (-508.752) -- 0:00:37
378500 -- (-509.707) (-512.027) (-511.471) [-515.772] * [-512.204] (-511.436) (-509.483) (-509.683) -- 0:00:37
379000 -- (-510.256) (-509.841) (-511.979) [-509.335] * [-508.382] (-510.320) (-512.329) (-510.131) -- 0:00:37
379500 -- (-508.562) (-509.934) (-511.742) [-508.961] * [-508.094] (-509.871) (-510.899) (-508.928) -- 0:00:37
380000 -- [-509.977] (-509.432) (-510.159) (-511.016) * (-508.629) (-510.947) (-510.320) [-509.343] -- 0:00:37
Average standard deviation of split frequencies: 0.007649
380500 -- (-509.479) (-513.151) [-508.419] (-510.596) * [-510.995] (-509.427) (-512.305) (-509.102) -- 0:00:37
381000 -- [-508.854] (-510.600) (-508.971) (-511.746) * (-510.577) (-509.023) [-512.768] (-514.180) -- 0:00:37
381500 -- (-511.976) (-508.649) (-510.826) [-510.856] * (-510.802) [-510.922] (-508.988) (-514.507) -- 0:00:37
382000 -- [-509.687] (-511.624) (-509.664) (-510.547) * [-509.090] (-510.128) (-510.356) (-514.007) -- 0:00:37
382500 -- (-510.728) [-512.326] (-508.345) (-510.138) * (-510.076) (-511.181) [-511.204] (-515.919) -- 0:00:37
383000 -- (-508.422) (-510.750) (-509.199) [-509.243] * (-509.206) (-511.988) [-509.066] (-513.115) -- 0:00:38
383500 -- (-513.441) [-510.729] (-509.965) (-513.260) * (-510.734) (-510.516) (-510.147) [-508.581] -- 0:00:38
384000 -- (-509.370) (-508.792) (-510.284) [-510.860] * (-511.971) (-510.511) [-510.009] (-511.303) -- 0:00:38
384500 -- (-509.022) (-509.390) [-511.750] (-517.462) * (-514.827) [-510.051] (-510.300) (-512.005) -- 0:00:38
385000 -- (-509.241) [-509.538] (-509.496) (-508.690) * (-511.520) [-511.533] (-515.496) (-510.147) -- 0:00:38
Average standard deviation of split frequencies: 0.008477
385500 -- (-511.462) (-514.136) [-511.228] (-510.769) * (-511.696) (-510.415) (-510.249) [-508.803] -- 0:00:38
386000 -- (-508.501) (-514.042) (-509.952) [-511.044] * (-510.415) [-508.571] (-509.342) (-510.749) -- 0:00:38
386500 -- (-509.637) (-514.132) [-510.302] (-509.694) * [-511.507] (-510.638) (-509.638) (-511.389) -- 0:00:38
387000 -- (-509.865) (-511.139) [-512.013] (-510.626) * (-509.868) [-509.964] (-511.434) (-508.327) -- 0:00:38
387500 -- (-511.510) (-508.977) (-511.206) [-510.015] * (-509.541) (-511.595) (-511.280) [-509.033] -- 0:00:37
388000 -- (-515.724) [-509.111] (-512.155) (-510.089) * (-510.100) [-509.525] (-509.983) (-511.708) -- 0:00:37
388500 -- [-510.815] (-511.831) (-509.464) (-511.069) * [-516.964] (-511.136) (-512.458) (-511.438) -- 0:00:37
389000 -- [-509.034] (-509.547) (-509.785) (-511.032) * (-511.921) [-512.542] (-511.491) (-510.521) -- 0:00:37
389500 -- (-509.108) [-514.128] (-512.303) (-508.764) * (-515.142) (-513.678) (-511.060) [-509.967] -- 0:00:37
390000 -- (-510.160) [-511.938] (-512.454) (-512.842) * (-510.399) [-511.644] (-513.542) (-508.882) -- 0:00:37
Average standard deviation of split frequencies: 0.008205
390500 -- (-509.160) [-509.707] (-511.003) (-511.432) * [-509.359] (-512.608) (-512.939) (-511.254) -- 0:00:37
391000 -- (-510.516) [-512.339] (-510.177) (-513.278) * (-508.784) (-511.940) [-513.506] (-512.579) -- 0:00:37
391500 -- (-511.778) (-510.340) [-510.140] (-512.272) * (-512.841) [-515.244] (-517.569) (-510.765) -- 0:00:37
392000 -- (-510.566) [-508.642] (-513.475) (-510.222) * [-510.198] (-512.517) (-515.611) (-512.512) -- 0:00:37
392500 -- (-513.488) (-511.634) [-509.054] (-515.726) * (-511.529) (-510.366) (-510.472) [-512.707] -- 0:00:37
393000 -- (-512.138) (-509.385) [-509.711] (-508.500) * [-508.708] (-511.804) (-510.397) (-510.107) -- 0:00:37
393500 -- (-510.369) (-516.619) (-508.902) [-509.585] * (-510.766) (-511.644) (-509.424) [-508.808] -- 0:00:36
394000 -- (-509.499) (-513.194) (-513.938) [-508.744] * (-513.319) (-511.652) [-508.408] (-512.305) -- 0:00:36
394500 -- (-509.901) (-511.258) [-509.916] (-510.959) * (-510.570) (-510.106) (-508.883) [-509.417] -- 0:00:36
395000 -- (-510.743) (-509.396) [-510.594] (-511.942) * (-511.171) [-508.252] (-513.403) (-510.133) -- 0:00:36
Average standard deviation of split frequencies: 0.008556
395500 -- (-510.597) [-509.500] (-513.075) (-509.036) * [-509.601] (-511.981) (-511.929) (-509.535) -- 0:00:36
396000 -- [-513.261] (-509.011) (-513.340) (-508.720) * (-509.571) (-511.307) [-509.686] (-509.237) -- 0:00:36
396500 -- (-510.464) (-510.980) (-514.500) [-508.797] * [-508.590] (-512.993) (-511.015) (-509.690) -- 0:00:36
397000 -- (-514.402) [-509.412] (-509.518) (-511.147) * (-508.900) (-512.310) [-509.156] (-509.919) -- 0:00:36
397500 -- (-508.997) (-508.995) (-509.109) [-508.587] * (-511.030) (-512.100) (-511.807) [-512.112] -- 0:00:36
398000 -- (-510.913) [-510.191] (-512.880) (-511.638) * (-511.392) (-509.654) (-511.324) [-510.630] -- 0:00:36
398500 -- (-510.329) (-509.261) [-511.735] (-510.259) * [-513.328] (-508.250) (-510.299) (-513.254) -- 0:00:36
399000 -- (-509.852) [-509.499] (-510.809) (-510.768) * (-512.864) [-511.468] (-509.927) (-508.847) -- 0:00:36
399500 -- [-509.669] (-511.860) (-511.312) (-510.076) * [-508.238] (-510.645) (-511.432) (-509.108) -- 0:00:37
400000 -- (-510.010) (-510.437) (-514.777) [-509.839] * (-513.907) [-509.734] (-510.364) (-508.329) -- 0:00:37
Average standard deviation of split frequencies: 0.008393
400500 -- [-510.775] (-508.665) (-511.564) (-508.205) * (-511.062) (-510.292) (-510.694) [-508.619] -- 0:00:37
401000 -- (-509.613) (-509.048) (-510.188) [-509.378] * (-510.303) (-510.933) [-509.594] (-510.569) -- 0:00:37
401500 -- (-509.098) [-512.330] (-511.801) (-511.374) * [-509.070] (-508.932) (-508.551) (-510.767) -- 0:00:37
402000 -- (-511.783) [-510.687] (-512.479) (-511.350) * [-509.158] (-511.286) (-508.650) (-514.683) -- 0:00:37
402500 -- (-510.528) [-512.044] (-513.737) (-509.560) * (-509.642) [-512.576] (-509.772) (-509.146) -- 0:00:37
403000 -- (-508.939) [-508.315] (-511.514) (-513.395) * (-512.100) [-508.728] (-509.660) (-511.647) -- 0:00:37
403500 -- [-509.396] (-513.357) (-509.940) (-510.694) * (-512.207) [-512.089] (-509.005) (-509.411) -- 0:00:36
404000 -- (-509.107) (-511.327) [-509.417] (-511.618) * (-511.390) (-510.419) [-510.579] (-509.610) -- 0:00:36
404500 -- (-512.706) (-509.065) [-509.706] (-509.711) * (-508.541) (-514.000) (-509.546) [-509.534] -- 0:00:36
405000 -- (-512.117) (-510.002) [-508.647] (-508.563) * (-508.175) [-511.211] (-513.941) (-513.365) -- 0:00:36
Average standard deviation of split frequencies: 0.008273
405500 -- (-511.695) [-514.037] (-511.618) (-509.860) * (-508.604) (-509.448) [-511.199] (-510.309) -- 0:00:36
406000 -- (-512.840) (-509.915) (-516.155) [-508.826] * (-515.513) (-511.007) (-508.725) [-510.344] -- 0:00:36
406500 -- (-508.439) (-511.164) (-512.968) [-509.935] * (-509.758) (-513.025) [-508.818] (-512.841) -- 0:00:36
407000 -- (-511.006) (-512.240) [-510.706] (-511.960) * [-509.248] (-512.939) (-509.469) (-513.070) -- 0:00:36
407500 -- (-509.578) [-512.525] (-510.704) (-510.360) * (-510.064) [-509.534] (-510.629) (-511.011) -- 0:00:36
408000 -- [-511.344] (-510.301) (-512.517) (-510.147) * [-510.935] (-509.913) (-511.944) (-511.623) -- 0:00:36
408500 -- (-510.299) [-510.645] (-508.266) (-513.680) * (-512.725) (-509.070) [-511.793] (-512.516) -- 0:00:36
409000 -- (-509.893) [-509.999] (-514.019) (-509.296) * (-509.958) (-508.450) [-508.448] (-512.652) -- 0:00:36
409500 -- [-510.545] (-509.700) (-514.558) (-511.167) * [-509.656] (-509.214) (-508.362) (-513.421) -- 0:00:36
410000 -- (-509.424) (-509.648) (-509.944) [-511.392] * [-508.599] (-511.551) (-510.115) (-513.134) -- 0:00:35
Average standard deviation of split frequencies: 0.007653
410500 -- (-509.612) (-510.337) (-510.087) [-509.170] * [-508.822] (-509.921) (-510.579) (-511.899) -- 0:00:35
411000 -- (-508.402) (-512.357) [-508.920] (-514.708) * (-508.023) [-510.160] (-509.159) (-516.274) -- 0:00:35
411500 -- (-508.949) (-511.669) (-511.924) [-509.811] * (-512.897) (-509.374) [-509.156] (-511.491) -- 0:00:35
412000 -- (-508.875) (-508.412) [-509.860] (-509.390) * [-509.130] (-509.427) (-514.418) (-512.314) -- 0:00:35
412500 -- [-508.653] (-508.496) (-512.937) (-509.401) * (-509.182) (-511.329) (-511.949) [-512.236] -- 0:00:35
413000 -- (-509.153) (-510.145) (-510.745) [-510.665] * (-508.720) (-509.932) (-512.320) [-508.874] -- 0:00:35
413500 -- (-508.846) (-509.454) (-508.920) [-510.844] * (-514.309) (-509.169) (-512.314) [-509.152] -- 0:00:35
414000 -- (-509.723) [-510.275] (-509.259) (-510.861) * (-510.653) (-513.374) [-514.395] (-508.615) -- 0:00:35
414500 -- (-510.645) [-509.213] (-510.276) (-511.498) * (-509.053) [-516.034] (-510.222) (-509.448) -- 0:00:35
415000 -- (-509.623) (-509.701) [-509.604] (-511.496) * [-508.618] (-508.387) (-509.935) (-509.257) -- 0:00:35
Average standard deviation of split frequencies: 0.008074
415500 -- [-509.038] (-512.527) (-509.512) (-509.997) * [-508.930] (-509.695) (-509.060) (-509.800) -- 0:00:35
416000 -- (-508.870) (-510.621) [-511.207] (-511.763) * [-510.911] (-508.614) (-508.793) (-513.974) -- 0:00:36
416500 -- (-509.563) (-509.790) [-509.556] (-513.593) * (-509.547) (-508.229) (-509.345) [-510.582] -- 0:00:36
417000 -- (-509.434) (-510.530) [-512.411] (-512.542) * (-510.713) (-509.058) [-510.909] (-511.044) -- 0:00:36
417500 -- (-511.157) (-508.950) (-511.629) [-509.346] * [-508.848] (-508.705) (-511.303) (-512.427) -- 0:00:36
418000 -- (-509.148) (-510.427) (-509.831) [-509.436] * [-509.047] (-511.818) (-511.638) (-509.180) -- 0:00:36
418500 -- (-508.715) (-511.525) [-508.700] (-510.707) * (-510.421) (-512.030) [-509.355] (-509.698) -- 0:00:36
419000 -- (-510.002) (-513.046) [-509.813] (-509.690) * (-510.039) (-510.616) (-509.766) [-508.875] -- 0:00:36
419500 -- (-513.038) [-510.694] (-513.517) (-510.039) * [-509.234] (-510.125) (-511.661) (-510.406) -- 0:00:35
420000 -- (-513.449) (-510.394) [-511.384] (-509.515) * (-509.205) [-510.746] (-510.040) (-513.335) -- 0:00:35
Average standard deviation of split frequencies: 0.007144
420500 -- (-508.601) (-509.304) (-510.593) [-510.510] * (-508.251) [-510.455] (-509.232) (-508.899) -- 0:00:35
421000 -- [-513.825] (-508.682) (-510.086) (-511.592) * (-513.754) (-509.783) [-508.962] (-509.371) -- 0:00:35
421500 -- (-510.002) (-508.912) (-509.527) [-512.642] * (-509.541) [-509.417] (-510.473) (-511.484) -- 0:00:35
422000 -- (-509.815) (-510.637) [-510.556] (-511.040) * (-515.134) (-511.042) (-511.821) [-510.160] -- 0:00:35
422500 -- (-509.662) (-510.340) (-509.407) [-510.033] * (-515.210) [-511.161] (-509.960) (-510.665) -- 0:00:35
423000 -- [-512.257] (-514.408) (-513.456) (-508.469) * [-511.709] (-515.074) (-509.193) (-509.215) -- 0:00:35
423500 -- [-508.673] (-508.513) (-511.095) (-513.162) * [-509.373] (-516.208) (-508.739) (-509.737) -- 0:00:35
424000 -- [-510.178] (-512.496) (-513.592) (-517.731) * (-509.733) [-511.690] (-509.616) (-511.931) -- 0:00:35
424500 -- [-509.829] (-514.288) (-514.499) (-510.319) * (-509.913) [-510.518] (-517.532) (-509.314) -- 0:00:35
425000 -- (-511.236) (-510.558) (-511.173) [-511.259] * (-514.361) (-508.557) (-510.938) [-508.503] -- 0:00:35
Average standard deviation of split frequencies: 0.006847
425500 -- (-509.874) (-513.281) [-510.007] (-509.095) * (-509.179) (-512.218) [-509.324] (-508.747) -- 0:00:35
426000 -- (-510.436) (-509.989) (-511.687) [-511.167] * (-513.410) (-512.683) [-509.307] (-509.658) -- 0:00:35
426500 -- [-509.135] (-510.730) (-512.110) (-509.030) * [-510.356] (-511.842) (-509.066) (-510.198) -- 0:00:34
427000 -- (-512.864) (-508.594) (-509.136) [-510.134] * (-513.632) (-509.913) [-510.005] (-509.723) -- 0:00:34
427500 -- [-510.422] (-508.977) (-515.529) (-512.547) * (-509.467) (-512.100) [-512.444] (-512.276) -- 0:00:34
428000 -- (-509.605) (-509.889) [-509.981] (-510.638) * (-509.724) (-509.498) (-509.926) [-512.496] -- 0:00:34
428500 -- (-511.174) (-509.833) [-509.065] (-508.850) * (-509.723) (-512.174) [-509.579] (-508.671) -- 0:00:34
429000 -- (-510.734) (-511.451) (-509.385) [-514.066] * (-512.033) (-511.331) (-508.826) [-508.585] -- 0:00:34
429500 -- (-509.678) (-513.754) (-511.795) [-509.903] * [-512.254] (-512.125) (-509.546) (-511.901) -- 0:00:34
430000 -- (-508.701) (-510.774) (-511.523) [-512.683] * (-514.831) [-510.486] (-514.083) (-510.377) -- 0:00:34
Average standard deviation of split frequencies: 0.006910
430500 -- (-509.112) [-509.201] (-511.312) (-510.835) * (-510.481) (-509.279) (-511.122) [-512.764] -- 0:00:34
431000 -- [-511.476] (-510.644) (-509.592) (-509.194) * [-509.610] (-511.362) (-510.442) (-516.417) -- 0:00:34
431500 -- (-515.774) (-508.606) [-512.186] (-516.423) * (-509.016) [-510.627] (-510.079) (-510.733) -- 0:00:35
432000 -- (-512.305) (-511.401) [-512.270] (-512.559) * (-509.254) [-512.675] (-509.499) (-510.463) -- 0:00:35
432500 -- [-509.247] (-509.017) (-509.975) (-509.391) * [-511.565] (-511.994) (-510.607) (-509.978) -- 0:00:35
433000 -- (-509.175) (-509.692) (-510.901) [-511.417] * (-516.831) (-513.729) (-515.691) [-510.485] -- 0:00:35
433500 -- (-509.189) [-511.354] (-510.063) (-512.654) * (-511.998) (-510.295) (-511.630) [-509.262] -- 0:00:35
434000 -- (-512.825) (-509.817) [-512.458] (-510.989) * (-509.795) (-510.310) [-510.319] (-510.329) -- 0:00:35
434500 -- [-515.959] (-511.623) (-510.364) (-511.570) * (-513.266) (-511.733) (-508.488) [-508.823] -- 0:00:35
435000 -- [-509.062] (-510.596) (-511.332) (-511.066) * (-509.243) (-509.479) (-510.829) [-508.620] -- 0:00:35
Average standard deviation of split frequencies: 0.007433
435500 -- (-508.959) (-514.407) [-508.746] (-509.465) * [-509.590] (-508.598) (-509.845) (-508.687) -- 0:00:34
436000 -- [-510.092] (-510.834) (-513.685) (-509.339) * (-511.567) (-511.992) [-512.759] (-509.551) -- 0:00:34
436500 -- (-514.127) (-510.244) (-509.939) [-515.496] * (-510.608) (-511.931) [-509.941] (-509.325) -- 0:00:34
437000 -- [-509.430] (-512.772) (-508.913) (-510.069) * (-510.694) (-510.907) (-510.385) [-511.781] -- 0:00:34
437500 -- (-509.335) (-514.319) (-510.222) [-510.262] * (-510.815) [-510.194] (-512.415) (-508.483) -- 0:00:34
438000 -- (-508.727) [-512.725] (-509.519) (-510.485) * (-510.348) (-510.371) (-508.861) [-509.197] -- 0:00:34
438500 -- [-512.067] (-511.506) (-511.121) (-510.002) * (-510.224) [-510.158] (-509.303) (-510.314) -- 0:00:34
439000 -- (-511.128) (-511.287) [-513.438] (-508.745) * (-510.582) [-508.731] (-510.972) (-514.346) -- 0:00:34
439500 -- [-512.979] (-510.618) (-508.584) (-510.826) * (-509.810) (-511.771) [-513.072] (-509.907) -- 0:00:34
440000 -- (-515.055) (-510.251) (-512.172) [-509.367] * (-511.654) (-511.208) (-510.038) [-511.787] -- 0:00:34
Average standard deviation of split frequencies: 0.007823
440500 -- (-511.617) [-511.260] (-509.839) (-509.443) * (-509.906) (-511.341) [-510.600] (-513.764) -- 0:00:34
441000 -- [-511.536] (-515.409) (-516.678) (-508.699) * (-509.909) (-511.322) [-508.500] (-511.722) -- 0:00:34
441500 -- (-509.585) [-508.467] (-511.258) (-513.690) * (-511.686) (-509.276) [-508.195] (-513.804) -- 0:00:34
442000 -- [-509.513] (-508.495) (-512.144) (-510.148) * (-512.369) (-513.815) [-509.376] (-510.914) -- 0:00:34
442500 -- (-516.183) (-510.935) (-509.519) [-510.993] * (-508.367) (-509.068) [-509.727] (-511.689) -- 0:00:34
443000 -- (-509.844) [-511.232] (-509.405) (-510.687) * (-511.083) (-508.928) (-510.134) [-509.639] -- 0:00:33
443500 -- (-510.517) [-509.234] (-511.963) (-510.876) * (-509.752) (-510.150) [-511.071] (-510.961) -- 0:00:33
444000 -- [-508.951] (-508.211) (-508.516) (-512.391) * [-510.179] (-511.354) (-509.464) (-508.444) -- 0:00:33
444500 -- (-509.474) (-522.164) (-509.692) [-508.360] * (-511.594) (-512.048) (-511.792) [-510.575] -- 0:00:33
445000 -- [-511.140] (-511.707) (-513.048) (-514.761) * [-510.764] (-509.138) (-521.559) (-510.266) -- 0:00:33
Average standard deviation of split frequencies: 0.009513
445500 -- (-509.638) [-511.096] (-509.461) (-512.457) * (-511.308) (-510.140) (-517.580) [-510.497] -- 0:00:33
446000 -- (-508.979) (-511.093) [-509.608] (-509.159) * [-509.625] (-512.837) (-514.787) (-508.325) -- 0:00:33
446500 -- [-509.603] (-510.671) (-511.603) (-508.757) * (-508.166) (-511.631) (-514.976) [-510.895] -- 0:00:34
447000 -- (-509.284) (-508.885) (-508.514) [-511.440] * (-510.270) [-509.082] (-511.212) (-509.316) -- 0:00:34
447500 -- (-509.478) (-508.841) (-509.050) [-508.586] * [-511.725] (-513.577) (-510.154) (-510.460) -- 0:00:34
448000 -- (-509.554) (-509.079) (-512.286) [-509.479] * (-510.992) (-510.286) (-509.413) [-510.147] -- 0:00:34
448500 -- [-509.040] (-509.494) (-510.387) (-509.167) * (-509.511) (-511.331) (-509.531) [-508.418] -- 0:00:34
449000 -- [-509.908] (-510.337) (-512.005) (-511.897) * [-509.847] (-513.046) (-510.034) (-510.879) -- 0:00:34
449500 -- (-508.926) (-511.081) [-509.960] (-511.222) * (-509.957) (-508.631) [-509.780] (-509.762) -- 0:00:34
450000 -- (-510.029) (-510.653) [-508.994] (-513.801) * (-509.287) (-509.592) [-510.021] (-511.173) -- 0:00:34
Average standard deviation of split frequencies: 0.009022
450500 -- (-517.346) [-511.755] (-510.032) (-510.625) * (-508.569) (-511.349) [-511.683] (-510.426) -- 0:00:34
451000 -- (-510.597) [-509.257] (-511.382) (-508.978) * [-508.409] (-515.033) (-513.191) (-512.112) -- 0:00:34
451500 -- (-517.058) [-509.495] (-510.989) (-510.487) * (-513.609) (-511.253) (-509.274) [-508.629] -- 0:00:34
452000 -- [-510.497] (-509.904) (-510.977) (-513.939) * (-511.630) (-510.904) (-510.216) [-508.687] -- 0:00:33
452500 -- [-508.799] (-513.834) (-509.873) (-513.497) * [-509.957] (-509.805) (-509.711) (-508.826) -- 0:00:33
453000 -- (-510.961) (-510.962) [-511.045] (-509.306) * (-512.620) (-508.919) [-511.249] (-509.170) -- 0:00:33
453500 -- [-508.906] (-510.984) (-508.309) (-511.274) * (-512.018) (-510.218) [-512.554] (-509.091) -- 0:00:33
454000 -- (-510.708) (-511.004) [-512.636] (-512.077) * (-511.947) (-508.398) (-511.410) [-510.392] -- 0:00:33
454500 -- [-511.427] (-509.933) (-510.939) (-508.898) * (-516.005) (-511.667) (-513.267) [-512.660] -- 0:00:33
455000 -- (-510.289) (-510.277) (-511.920) [-510.253] * (-513.631) (-509.864) (-510.209) [-509.113] -- 0:00:33
Average standard deviation of split frequencies: 0.008593
455500 -- (-511.300) (-510.681) (-511.346) [-510.693] * (-510.508) (-509.851) (-511.896) [-513.671] -- 0:00:33
456000 -- (-510.926) (-510.020) [-511.968] (-512.043) * (-509.139) (-511.807) [-512.504] (-514.283) -- 0:00:33
456500 -- (-508.584) (-511.941) [-509.290] (-511.361) * (-512.233) (-510.160) [-508.411] (-512.186) -- 0:00:33
457000 -- (-510.598) (-510.385) (-511.690) [-508.346] * (-511.840) (-518.474) (-509.412) [-511.957] -- 0:00:33
457500 -- (-510.380) [-510.902] (-514.862) (-514.459) * (-510.525) (-513.853) [-511.486] (-517.050) -- 0:00:33
458000 -- [-509.849] (-509.555) (-514.960) (-511.471) * (-510.104) (-511.170) (-510.969) [-509.863] -- 0:00:33
458500 -- (-511.709) [-510.683] (-512.664) (-512.692) * (-511.191) (-509.402) (-510.989) [-509.915] -- 0:00:33
459000 -- (-510.372) [-509.103] (-509.450) (-514.822) * (-515.433) (-512.356) [-511.526] (-509.120) -- 0:00:33
459500 -- (-514.335) [-514.592] (-510.929) (-509.555) * (-514.621) (-515.336) [-510.891] (-514.073) -- 0:00:32
460000 -- (-509.428) (-513.724) [-509.504] (-510.324) * (-512.475) (-513.400) [-512.502] (-509.418) -- 0:00:32
Average standard deviation of split frequencies: 0.008378
460500 -- (-509.271) [-512.121] (-510.046) (-510.094) * (-509.912) [-509.144] (-509.645) (-508.457) -- 0:00:32
461000 -- (-508.742) (-511.018) [-510.138] (-509.801) * [-513.276] (-513.011) (-509.456) (-509.209) -- 0:00:32
461500 -- (-509.579) [-511.598] (-511.226) (-510.810) * (-513.610) [-511.474] (-515.137) (-515.061) -- 0:00:32
462000 -- [-510.682] (-510.511) (-510.460) (-510.080) * (-511.303) [-511.060] (-512.633) (-511.555) -- 0:00:32
462500 -- (-510.404) (-513.061) [-511.048] (-511.698) * (-509.319) [-511.727] (-511.747) (-513.187) -- 0:00:32
463000 -- (-516.150) [-511.255] (-513.462) (-509.684) * [-510.175] (-513.279) (-513.653) (-512.957) -- 0:00:33
463500 -- [-511.496] (-515.335) (-510.900) (-508.275) * [-510.347] (-510.137) (-515.032) (-514.810) -- 0:00:33
464000 -- (-509.905) [-514.073] (-508.809) (-509.667) * (-510.529) (-508.674) [-511.270] (-510.126) -- 0:00:33
464500 -- (-508.880) [-510.437] (-508.852) (-511.808) * [-513.384] (-508.738) (-510.220) (-509.779) -- 0:00:33
465000 -- (-509.093) (-510.808) [-508.750] (-510.737) * (-515.012) (-508.652) [-508.958] (-509.875) -- 0:00:33
Average standard deviation of split frequencies: 0.008093
465500 -- [-509.230] (-514.135) (-508.906) (-509.484) * (-513.778) [-509.949] (-514.234) (-511.557) -- 0:00:33
466000 -- [-509.545] (-511.823) (-510.811) (-510.164) * (-509.535) [-510.026] (-512.715) (-517.153) -- 0:00:33
466500 -- [-508.988] (-515.613) (-510.616) (-508.357) * (-508.814) [-511.476] (-513.061) (-510.713) -- 0:00:33
467000 -- [-509.636] (-517.877) (-509.426) (-511.061) * (-511.127) (-511.313) (-510.741) [-511.840] -- 0:00:33
467500 -- (-509.765) (-510.361) (-509.115) [-511.151] * (-513.495) [-509.511] (-510.305) (-513.400) -- 0:00:33
468000 -- (-510.685) [-508.733] (-512.350) (-510.090) * (-515.078) (-509.921) (-510.247) [-509.626] -- 0:00:32
468500 -- (-512.276) [-509.348] (-512.445) (-510.120) * (-513.677) (-510.222) [-512.467] (-512.783) -- 0:00:32
469000 -- (-510.463) [-511.434] (-512.876) (-509.353) * (-512.338) [-508.530] (-510.815) (-510.025) -- 0:00:32
469500 -- (-509.825) [-510.122] (-513.878) (-511.795) * (-510.922) (-511.810) [-511.625] (-508.874) -- 0:00:32
470000 -- (-508.613) [-510.641] (-511.384) (-510.742) * (-511.834) (-510.435) [-510.671] (-514.603) -- 0:00:32
Average standard deviation of split frequencies: 0.007950
470500 -- (-511.097) (-508.814) (-510.209) [-508.373] * (-513.174) [-509.543] (-510.210) (-509.828) -- 0:00:32
471000 -- (-510.620) (-509.710) (-508.907) [-509.479] * (-512.427) [-510.133] (-509.795) (-512.966) -- 0:00:32
471500 -- [-510.128] (-508.992) (-511.600) (-509.550) * [-508.438] (-512.709) (-511.724) (-510.378) -- 0:00:32
472000 -- (-516.900) [-508.620] (-513.164) (-510.006) * (-511.100) [-510.384] (-510.489) (-510.717) -- 0:00:32
472500 -- [-511.467] (-509.263) (-512.379) (-509.911) * (-510.013) (-508.266) (-510.763) [-509.081] -- 0:00:32
473000 -- (-511.313) (-512.962) [-509.543] (-511.651) * (-510.790) [-508.740] (-511.902) (-509.161) -- 0:00:32
473500 -- (-514.323) [-512.407] (-509.951) (-516.600) * [-509.044] (-508.971) (-511.444) (-509.155) -- 0:00:32
474000 -- (-513.698) (-510.624) [-509.516] (-512.192) * [-509.692] (-511.170) (-517.024) (-510.254) -- 0:00:32
474500 -- (-512.116) (-510.678) (-508.135) [-509.652] * (-511.906) (-510.312) (-508.368) [-510.327] -- 0:00:32
475000 -- [-509.374] (-512.242) (-508.556) (-509.013) * (-509.947) (-513.177) (-509.626) [-509.110] -- 0:00:32
Average standard deviation of split frequencies: 0.007489
475500 -- (-509.501) (-514.303) (-508.888) [-509.828] * (-509.120) (-511.043) (-516.014) [-510.462] -- 0:00:31
476000 -- (-511.003) (-510.674) [-509.525] (-510.488) * [-512.947] (-510.267) (-511.546) (-512.681) -- 0:00:31
476500 -- [-508.714] (-510.860) (-510.144) (-510.749) * (-510.444) (-508.335) (-511.716) [-512.041] -- 0:00:31
477000 -- [-510.286] (-516.836) (-510.591) (-510.458) * [-509.441] (-510.604) (-510.944) (-513.461) -- 0:00:31
477500 -- (-510.226) (-513.652) (-510.820) [-509.444] * (-508.573) (-511.144) (-509.936) [-509.921] -- 0:00:31
478000 -- (-513.167) (-510.413) (-513.338) [-511.424] * (-511.460) (-509.278) (-510.763) [-512.751] -- 0:00:31
478500 -- (-509.568) (-510.237) [-509.811] (-510.185) * (-513.983) (-516.824) [-509.748] (-512.339) -- 0:00:31
479000 -- (-513.276) [-512.105] (-509.180) (-509.176) * (-512.841) [-509.504] (-511.109) (-510.781) -- 0:00:31
479500 -- (-509.346) [-509.727] (-509.475) (-508.579) * [-508.997] (-509.205) (-509.973) (-512.759) -- 0:00:32
480000 -- (-510.224) (-512.271) [-511.814] (-508.296) * (-511.812) [-509.324] (-509.475) (-508.683) -- 0:00:32
Average standard deviation of split frequencies: 0.007662
480500 -- (-509.754) (-514.746) [-511.362] (-508.465) * (-511.987) (-518.959) (-509.357) [-508.539] -- 0:00:32
481000 -- (-510.300) (-511.429) (-510.741) [-510.962] * [-508.966] (-509.267) (-512.013) (-510.612) -- 0:00:32
481500 -- (-512.542) (-508.657) (-510.382) [-512.582] * [-510.703] (-509.391) (-516.368) (-510.301) -- 0:00:32
482000 -- [-509.921] (-510.031) (-510.987) (-509.399) * (-509.826) (-512.118) (-510.106) [-512.275] -- 0:00:32
482500 -- [-509.631] (-508.328) (-512.176) (-511.969) * [-509.829] (-509.846) (-510.218) (-510.317) -- 0:00:32
483000 -- (-508.726) [-509.459] (-513.109) (-512.504) * (-512.836) [-513.511] (-512.766) (-510.399) -- 0:00:32
483500 -- (-508.862) (-508.682) [-509.369] (-512.581) * (-511.773) (-512.272) (-514.763) [-510.772] -- 0:00:32
484000 -- (-508.751) (-509.052) (-509.649) [-510.120] * (-509.587) (-512.513) [-512.629] (-511.439) -- 0:00:31
484500 -- (-512.816) (-511.560) [-508.752] (-511.906) * (-508.220) [-511.607] (-509.026) (-509.973) -- 0:00:31
485000 -- (-512.194) (-508.537) [-508.274] (-512.027) * (-511.714) (-513.866) [-509.688] (-510.610) -- 0:00:31
Average standard deviation of split frequencies: 0.007638
485500 -- (-514.476) (-508.751) (-508.544) [-513.614] * [-510.170] (-511.029) (-509.905) (-510.782) -- 0:00:31
486000 -- (-510.599) (-510.090) (-508.931) [-509.691] * [-510.963] (-514.114) (-508.441) (-513.632) -- 0:00:31
486500 -- [-510.094] (-512.000) (-510.046) (-512.747) * (-509.165) (-510.457) [-513.312] (-512.737) -- 0:00:31
487000 -- (-508.872) (-512.567) (-509.927) [-509.576] * (-509.375) (-512.723) [-509.843] (-509.780) -- 0:00:31
487500 -- (-508.519) (-515.199) [-511.047] (-511.708) * [-510.889] (-510.749) (-512.028) (-508.496) -- 0:00:31
488000 -- (-510.088) (-512.584) [-510.971] (-509.271) * (-509.499) [-510.759] (-510.007) (-510.205) -- 0:00:31
488500 -- (-508.870) [-511.696] (-509.238) (-510.187) * (-510.189) (-511.641) [-509.351] (-510.459) -- 0:00:31
489000 -- [-512.243] (-510.275) (-509.222) (-509.941) * [-511.209] (-508.579) (-510.649) (-511.255) -- 0:00:31
489500 -- (-514.563) (-510.742) (-509.144) [-509.019] * (-513.005) (-508.835) [-509.127] (-511.195) -- 0:00:31
490000 -- (-511.742) (-510.367) [-509.222] (-509.409) * (-509.251) (-513.892) (-508.927) [-510.739] -- 0:00:31
Average standard deviation of split frequencies: 0.007506
490500 -- (-516.856) (-517.441) (-511.547) [-508.814] * (-510.068) (-510.081) [-510.560] (-509.442) -- 0:00:31
491000 -- (-509.513) [-510.394] (-509.520) (-509.171) * (-509.624) [-515.423] (-512.536) (-512.227) -- 0:00:31
491500 -- [-512.953] (-509.733) (-511.409) (-509.107) * (-509.605) [-509.184] (-508.303) (-509.084) -- 0:00:31
492000 -- [-509.660] (-511.259) (-509.750) (-509.988) * [-510.287] (-510.168) (-509.798) (-510.488) -- 0:00:30
492500 -- (-513.910) (-517.417) (-509.061) [-508.758] * (-510.533) (-514.309) (-512.841) [-511.804] -- 0:00:30
493000 -- (-508.221) (-513.210) (-510.441) [-509.189] * [-509.463] (-510.956) (-510.296) (-508.989) -- 0:00:30
493500 -- (-510.797) [-511.816] (-511.159) (-511.118) * (-510.211) [-513.073] (-511.222) (-512.932) -- 0:00:30
494000 -- (-513.410) [-512.900] (-510.464) (-512.812) * (-509.015) (-509.088) (-511.272) [-509.104] -- 0:00:30
494500 -- (-511.307) (-509.888) (-511.091) [-510.750] * [-510.773] (-510.288) (-516.030) (-508.608) -- 0:00:30
495000 -- (-509.173) [-510.468] (-509.493) (-509.850) * [-513.492] (-513.769) (-511.182) (-511.655) -- 0:00:30
Average standard deviation of split frequencies: 0.007544
495500 -- [-513.832] (-514.972) (-508.408) (-511.397) * (-510.914) [-508.515] (-512.185) (-514.696) -- 0:00:30
496000 -- (-515.417) (-509.234) [-509.816] (-511.640) * (-509.578) [-511.387] (-510.879) (-510.970) -- 0:00:31
496500 -- (-511.260) [-508.726] (-512.020) (-512.520) * (-510.831) (-510.669) [-510.323] (-512.051) -- 0:00:31
497000 -- [-509.733] (-508.816) (-510.371) (-511.640) * (-509.951) [-512.414] (-510.108) (-511.141) -- 0:00:31
497500 -- (-511.764) (-515.502) (-509.587) [-512.182] * (-509.376) (-510.513) [-510.537] (-508.438) -- 0:00:31
498000 -- (-508.954) (-511.184) (-510.461) [-509.727] * [-511.160] (-509.625) (-509.183) (-511.539) -- 0:00:31
498500 -- (-508.929) (-511.509) [-515.272] (-509.686) * [-510.250] (-511.248) (-509.483) (-510.338) -- 0:00:31
499000 -- [-510.624] (-513.863) (-511.017) (-508.092) * [-511.452] (-512.183) (-510.401) (-510.941) -- 0:00:31
499500 -- (-510.817) [-512.245] (-514.482) (-508.548) * (-510.721) (-511.693) (-508.642) [-508.991] -- 0:00:31
500000 -- [-514.067] (-513.224) (-510.114) (-508.534) * [-510.540] (-512.136) (-509.527) (-508.982) -- 0:00:31
Average standard deviation of split frequencies: 0.008003
500500 -- (-508.830) (-513.789) [-509.859] (-511.001) * [-509.995] (-511.669) (-508.526) (-509.269) -- 0:00:30
501000 -- [-510.641] (-511.526) (-512.112) (-510.153) * (-508.316) (-513.431) [-509.638] (-511.199) -- 0:00:30
501500 -- (-510.279) (-511.127) [-509.911] (-509.869) * (-513.574) [-510.863] (-511.769) (-513.069) -- 0:00:30
502000 -- (-514.339) (-508.600) (-510.618) [-509.452] * (-511.513) (-512.275) [-509.802] (-510.229) -- 0:00:30
502500 -- (-508.735) (-510.492) [-509.521] (-512.696) * (-512.471) (-509.559) [-511.367] (-510.242) -- 0:00:30
503000 -- (-511.743) [-511.915] (-509.706) (-510.871) * [-510.390] (-509.965) (-510.192) (-508.275) -- 0:00:30
503500 -- (-510.245) [-508.573] (-510.370) (-508.727) * (-510.232) [-510.270] (-510.263) (-513.119) -- 0:00:30
504000 -- (-509.258) (-509.302) [-509.112] (-512.132) * (-510.884) [-510.963] (-509.849) (-510.041) -- 0:00:30
504500 -- (-509.512) (-512.905) (-509.170) [-510.384] * (-509.819) (-510.918) (-510.029) [-508.933] -- 0:00:30
505000 -- (-512.328) [-509.842] (-509.689) (-509.904) * (-511.971) [-509.235] (-510.111) (-511.956) -- 0:00:30
Average standard deviation of split frequencies: 0.007511
505500 -- (-509.792) (-508.768) (-514.452) [-511.776] * (-509.466) (-510.643) (-509.817) [-508.666] -- 0:00:30
506000 -- (-515.870) [-512.382] (-509.829) (-513.301) * [-508.343] (-510.873) (-511.871) (-510.411) -- 0:00:30
506500 -- (-513.002) (-513.479) (-509.594) [-513.264] * (-510.165) [-509.237] (-509.495) (-509.187) -- 0:00:30
507000 -- (-511.730) [-510.114] (-511.190) (-509.733) * [-511.052] (-509.656) (-509.942) (-510.785) -- 0:00:30
507500 -- (-509.521) (-514.840) (-509.636) [-508.892] * (-508.980) (-508.672) (-509.958) [-509.690] -- 0:00:30
508000 -- (-512.543) (-509.844) [-511.480] (-509.778) * (-513.547) (-508.666) [-512.130] (-514.250) -- 0:00:30
508500 -- (-510.818) [-508.613] (-510.190) (-512.372) * (-508.972) [-510.809] (-508.696) (-511.527) -- 0:00:29
509000 -- [-509.963] (-513.049) (-511.354) (-509.126) * (-508.943) (-508.588) (-510.997) [-512.748] -- 0:00:29
509500 -- (-513.440) (-511.228) [-510.546] (-508.414) * [-512.263] (-509.901) (-515.257) (-511.636) -- 0:00:29
510000 -- (-512.820) (-509.677) (-512.023) [-508.631] * (-512.516) (-509.556) [-511.170] (-509.882) -- 0:00:29
Average standard deviation of split frequencies: 0.007327
510500 -- (-508.907) (-508.689) [-509.489] (-510.572) * (-509.691) (-514.186) (-508.646) [-508.464] -- 0:00:29
511000 -- (-509.610) (-515.578) [-510.653] (-513.094) * [-510.594] (-513.542) (-510.197) (-516.935) -- 0:00:29
511500 -- (-510.890) (-509.651) [-510.449] (-510.478) * (-512.195) (-509.574) [-512.061] (-512.571) -- 0:00:29
512000 -- [-512.134] (-512.197) (-508.694) (-510.145) * [-510.657] (-508.627) (-508.455) (-510.129) -- 0:00:29
512500 -- [-513.928] (-511.232) (-510.507) (-509.524) * [-510.743] (-511.955) (-508.843) (-509.106) -- 0:00:30
513000 -- [-508.459] (-508.762) (-511.966) (-515.129) * (-511.377) [-508.921] (-510.245) (-510.091) -- 0:00:30
513500 -- (-509.378) [-508.976] (-510.057) (-509.901) * (-510.568) [-510.264] (-511.535) (-510.240) -- 0:00:30
514000 -- (-509.577) [-509.471] (-508.927) (-512.497) * (-512.630) (-512.294) [-509.398] (-510.482) -- 0:00:30
514500 -- (-508.536) (-513.102) [-511.212] (-508.754) * (-514.280) (-512.942) [-510.724] (-518.365) -- 0:00:30
515000 -- (-508.786) (-508.374) (-509.003) [-508.706] * (-516.088) [-509.577] (-510.035) (-509.972) -- 0:00:30
Average standard deviation of split frequencies: 0.007594
515500 -- [-508.857] (-510.476) (-512.312) (-509.736) * (-517.202) [-509.701] (-513.913) (-509.143) -- 0:00:30
516000 -- [-510.686] (-509.796) (-513.064) (-508.732) * (-513.280) (-509.112) (-511.660) [-510.749] -- 0:00:30
516500 -- (-508.925) [-511.744] (-509.822) (-509.896) * (-512.080) (-508.557) (-511.094) [-513.390] -- 0:00:29
517000 -- [-508.205] (-508.548) (-509.770) (-510.517) * (-510.058) (-510.179) [-509.100] (-510.262) -- 0:00:29
517500 -- (-509.547) (-508.406) (-513.205) [-509.302] * (-512.512) (-509.302) (-509.212) [-510.245] -- 0:00:29
518000 -- (-510.940) [-510.417] (-509.905) (-508.669) * (-509.613) (-511.113) [-510.683] (-511.435) -- 0:00:29
518500 -- [-509.649] (-510.554) (-512.957) (-517.740) * (-509.012) (-509.512) [-509.764] (-517.590) -- 0:00:29
519000 -- (-509.152) (-511.212) (-509.450) [-511.029] * [-509.086] (-511.905) (-510.252) (-508.590) -- 0:00:29
519500 -- (-511.116) (-514.490) (-508.579) [-513.911] * [-508.541] (-508.470) (-516.459) (-511.265) -- 0:00:29
520000 -- (-510.306) (-513.169) (-508.543) [-509.796] * (-508.692) (-508.450) [-509.582] (-508.925) -- 0:00:29
Average standard deviation of split frequencies: 0.007866
520500 -- [-510.270] (-511.832) (-510.147) (-510.713) * (-510.470) (-510.703) (-511.850) [-513.134] -- 0:00:29
521000 -- (-510.899) (-512.895) (-511.342) [-509.694] * [-514.675] (-510.364) (-510.628) (-509.294) -- 0:00:29
521500 -- (-510.420) (-510.943) (-509.662) [-510.545] * (-512.885) [-509.176] (-511.228) (-508.841) -- 0:00:29
522000 -- (-512.164) (-514.950) (-509.306) [-509.618] * [-513.701] (-516.181) (-510.643) (-510.160) -- 0:00:29
522500 -- (-509.444) [-512.770] (-509.369) (-511.732) * (-512.776) (-514.655) [-509.123] (-508.622) -- 0:00:29
523000 -- (-509.375) [-510.082] (-510.230) (-508.248) * (-514.656) (-510.403) (-513.918) [-510.312] -- 0:00:29
523500 -- (-511.834) (-509.802) [-509.301] (-508.539) * [-511.329] (-508.721) (-509.886) (-509.021) -- 0:00:29
524000 -- (-513.202) (-511.615) [-509.880] (-510.343) * (-510.205) (-509.153) [-510.742] (-512.914) -- 0:00:29
524500 -- (-512.812) (-510.475) [-512.780] (-510.240) * (-509.116) (-509.243) [-510.094] (-508.755) -- 0:00:29
525000 -- (-511.147) (-515.327) (-511.184) [-509.178] * (-508.972) (-509.321) [-509.590] (-508.741) -- 0:00:28
Average standard deviation of split frequencies: 0.007562
525500 -- (-511.415) (-510.483) (-510.507) [-509.471] * (-509.745) (-510.148) (-511.904) [-509.772] -- 0:00:28
526000 -- (-512.281) (-511.718) (-512.975) [-509.153] * (-516.050) (-516.137) (-508.899) [-512.715] -- 0:00:28
526500 -- [-510.167] (-509.466) (-508.529) (-509.733) * [-508.938] (-509.824) (-512.388) (-509.692) -- 0:00:28
527000 -- [-512.553] (-510.131) (-508.715) (-510.111) * (-514.381) (-510.730) [-509.772] (-509.652) -- 0:00:28
527500 -- [-509.674] (-509.696) (-511.798) (-510.990) * (-510.967) (-517.046) [-509.433] (-509.896) -- 0:00:28
528000 -- (-508.563) [-509.160] (-509.429) (-509.645) * (-511.281) (-509.065) [-508.965] (-508.842) -- 0:00:28
528500 -- (-512.523) (-514.422) (-510.681) [-509.080] * [-510.772] (-509.587) (-511.611) (-512.070) -- 0:00:28
529000 -- (-510.620) (-509.528) [-511.067] (-509.188) * [-513.011] (-512.757) (-510.669) (-511.049) -- 0:00:28
529500 -- (-509.666) (-514.348) (-510.889) [-509.772] * (-512.993) [-511.742] (-514.147) (-509.856) -- 0:00:29
530000 -- [-515.388] (-508.481) (-508.739) (-512.441) * (-512.872) (-511.359) [-510.486] (-509.750) -- 0:00:29
Average standard deviation of split frequencies: 0.008050
530500 -- (-509.809) [-508.486] (-509.119) (-513.359) * (-509.044) (-509.033) [-508.637] (-511.423) -- 0:00:29
531000 -- [-509.089] (-511.109) (-509.749) (-512.345) * (-512.170) [-511.981] (-511.929) (-511.152) -- 0:00:29
531500 -- (-510.532) [-509.151] (-509.892) (-509.209) * (-511.551) (-510.179) [-514.051] (-511.409) -- 0:00:29
532000 -- [-511.202] (-509.766) (-511.869) (-509.257) * [-512.794] (-516.177) (-515.538) (-508.775) -- 0:00:29
532500 -- (-516.854) (-510.215) (-512.055) [-509.308] * [-511.708] (-511.381) (-510.684) (-513.228) -- 0:00:28
533000 -- (-509.677) (-510.657) [-508.553] (-508.708) * [-508.928] (-511.475) (-509.596) (-509.805) -- 0:00:28
533500 -- (-509.303) (-509.635) (-508.577) [-509.425] * [-510.494] (-513.918) (-512.455) (-509.844) -- 0:00:28
534000 -- (-509.125) (-512.278) [-516.445] (-509.434) * (-508.497) (-514.227) [-510.871] (-511.514) -- 0:00:28
534500 -- [-510.441] (-510.237) (-511.137) (-509.915) * (-510.180) [-510.861] (-510.622) (-508.932) -- 0:00:28
535000 -- [-509.930] (-509.985) (-509.587) (-512.892) * (-515.541) [-512.014] (-509.162) (-509.544) -- 0:00:28
Average standard deviation of split frequencies: 0.008355
535500 -- (-508.280) [-511.785] (-510.620) (-510.069) * (-510.063) (-511.803) (-511.414) [-509.167] -- 0:00:28
536000 -- (-509.554) (-512.486) [-510.309] (-514.449) * (-509.817) (-512.784) [-513.850] (-511.518) -- 0:00:28
536500 -- [-510.600] (-509.336) (-509.750) (-516.363) * (-513.411) (-511.421) [-510.011] (-512.911) -- 0:00:28
537000 -- (-510.699) (-511.719) (-513.063) [-513.757] * (-509.522) [-516.660] (-510.566) (-508.793) -- 0:00:28
537500 -- (-511.610) [-510.511] (-513.064) (-508.763) * (-508.814) (-509.016) [-510.922] (-508.889) -- 0:00:28
538000 -- (-511.986) (-512.106) (-512.778) [-511.420] * (-511.166) (-510.561) (-509.375) [-508.369] -- 0:00:28
538500 -- (-510.948) (-513.241) [-511.231] (-510.085) * (-508.887) (-510.401) [-508.661] (-509.207) -- 0:00:28
539000 -- (-516.697) [-509.646] (-508.800) (-509.074) * (-512.256) (-509.287) (-509.030) [-510.020] -- 0:00:28
539500 -- (-510.770) [-510.562] (-511.893) (-508.774) * (-513.312) (-512.288) (-511.825) [-511.448] -- 0:00:28
540000 -- (-511.090) [-509.350] (-508.253) (-508.243) * (-511.443) (-509.867) (-510.047) [-511.725] -- 0:00:28
Average standard deviation of split frequencies: 0.007738
540500 -- (-513.739) [-511.362] (-508.391) (-508.538) * (-508.626) (-509.300) [-511.095] (-508.622) -- 0:00:28
541000 -- (-511.570) (-510.625) (-510.052) [-509.597] * (-511.567) (-509.933) [-511.338] (-512.277) -- 0:00:27
541500 -- (-512.791) (-509.718) (-508.629) [-509.217] * (-508.886) (-510.139) (-512.709) [-509.436] -- 0:00:27
542000 -- (-510.167) (-515.588) (-508.974) [-509.331] * (-511.273) (-514.019) (-511.006) [-511.356] -- 0:00:27
542500 -- (-510.318) (-509.717) [-509.454] (-511.894) * (-510.206) (-516.203) (-509.762) [-514.327] -- 0:00:27
543000 -- (-508.694) (-512.028) (-509.575) [-509.112] * (-510.932) (-515.784) [-508.880] (-511.019) -- 0:00:27
543500 -- (-510.047) (-509.737) (-508.468) [-509.786] * (-509.714) (-509.357) (-510.258) [-509.105] -- 0:00:27
544000 -- (-511.260) (-511.537) [-511.626] (-510.217) * (-511.264) (-510.620) [-512.630] (-508.951) -- 0:00:27
544500 -- (-509.603) (-509.130) [-508.604] (-510.754) * (-511.924) (-510.429) (-514.386) [-508.678] -- 0:00:27
545000 -- (-510.638) [-509.404] (-511.749) (-510.492) * [-513.114] (-515.527) (-514.022) (-511.126) -- 0:00:27
Average standard deviation of split frequencies: 0.007177
545500 -- (-511.065) [-509.947] (-512.978) (-508.761) * (-510.674) [-513.021] (-512.260) (-510.601) -- 0:00:27
546000 -- (-509.213) (-512.999) [-509.114] (-509.868) * (-514.159) [-511.431] (-510.244) (-509.389) -- 0:00:28
546500 -- (-511.488) (-509.851) [-509.398] (-511.075) * (-512.558) [-509.963] (-509.823) (-509.985) -- 0:00:28
547000 -- (-511.801) (-511.098) [-509.388] (-511.367) * (-510.092) (-508.830) [-510.245] (-511.534) -- 0:00:28
547500 -- (-510.864) [-508.600] (-510.600) (-512.438) * (-511.584) [-513.958] (-517.912) (-511.081) -- 0:00:28
548000 -- (-513.327) (-513.030) (-510.109) [-511.484] * [-510.133] (-513.887) (-510.747) (-509.121) -- 0:00:28
548500 -- (-508.367) [-514.075] (-511.930) (-513.189) * (-512.954) (-513.426) (-510.122) [-510.837] -- 0:00:27
549000 -- (-508.390) (-513.003) [-511.675] (-510.353) * (-510.409) (-516.102) (-512.380) [-509.821] -- 0:00:27
549500 -- (-509.544) (-511.217) (-508.984) [-510.202] * (-511.750) (-508.367) [-512.548] (-509.555) -- 0:00:27
550000 -- (-509.761) (-510.273) (-508.864) [-509.345] * (-515.132) (-509.290) (-508.473) [-513.597] -- 0:00:27
Average standard deviation of split frequencies: 0.008240
550500 -- [-509.651] (-509.113) (-509.734) (-510.845) * (-513.888) [-512.039] (-510.757) (-509.545) -- 0:00:27
551000 -- (-510.816) (-509.676) [-512.190] (-508.331) * (-514.022) (-515.682) [-509.971] (-509.824) -- 0:00:27
551500 -- [-509.049] (-514.102) (-510.942) (-509.562) * (-513.539) (-509.877) (-508.349) [-509.052] -- 0:00:27
552000 -- (-515.662) (-512.524) (-512.879) [-509.224] * (-510.035) (-511.929) [-508.378] (-508.699) -- 0:00:27
552500 -- (-509.334) [-508.485] (-516.486) (-509.952) * (-508.595) (-511.903) (-508.892) [-509.942] -- 0:00:27
553000 -- (-510.767) [-509.529] (-512.028) (-509.261) * (-512.378) (-510.598) (-510.278) [-509.293] -- 0:00:27
553500 -- (-512.687) (-509.538) [-511.574] (-511.331) * (-510.527) (-509.786) [-511.220] (-508.896) -- 0:00:27
554000 -- (-508.408) (-508.999) [-509.127] (-511.352) * [-512.626] (-509.101) (-511.588) (-512.917) -- 0:00:27
554500 -- (-515.440) (-510.275) [-508.307] (-510.279) * [-519.734] (-512.338) (-512.656) (-512.566) -- 0:00:27
555000 -- (-511.169) [-509.928] (-509.663) (-511.322) * (-513.885) [-510.682] (-509.205) (-516.312) -- 0:00:27
Average standard deviation of split frequencies: 0.009725
555500 -- (-509.294) (-509.962) [-508.683] (-511.908) * (-510.224) [-512.908] (-509.093) (-511.865) -- 0:00:27
556000 -- (-509.926) (-509.205) (-509.392) [-511.279] * (-511.180) (-513.442) (-510.285) [-511.089] -- 0:00:27
556500 -- (-508.616) (-511.935) (-509.435) [-511.077] * (-511.139) (-509.964) [-509.103] (-510.978) -- 0:00:27
557000 -- (-508.957) (-511.050) (-509.493) [-509.219] * (-511.052) (-508.903) [-512.508] (-513.067) -- 0:00:27
557500 -- (-509.359) (-510.033) [-509.306] (-511.511) * (-515.633) (-514.229) (-510.412) [-510.046] -- 0:00:26
558000 -- (-509.188) (-513.564) (-511.513) [-510.543] * [-510.757] (-510.021) (-513.345) (-510.854) -- 0:00:26
558500 -- (-519.672) (-510.954) [-508.862] (-510.121) * (-513.567) [-510.447] (-510.748) (-512.784) -- 0:00:26
559000 -- (-511.500) (-509.819) [-511.667] (-508.271) * (-508.759) (-510.121) [-508.643] (-508.637) -- 0:00:26
559500 -- (-510.485) (-514.137) [-512.117] (-508.906) * (-510.380) (-510.834) [-512.360] (-514.483) -- 0:00:26
560000 -- (-509.298) (-510.434) [-511.188] (-513.405) * [-510.321] (-511.063) (-512.261) (-515.145) -- 0:00:26
Average standard deviation of split frequencies: 0.009001
560500 -- [-508.970] (-510.848) (-509.868) (-510.878) * [-511.828] (-509.756) (-510.383) (-517.155) -- 0:00:26
561000 -- (-509.285) (-511.760) (-514.244) [-509.916] * [-509.302] (-511.125) (-510.969) (-509.681) -- 0:00:26
561500 -- (-512.517) (-519.485) (-512.983) [-511.110] * [-511.041] (-508.959) (-508.484) (-509.434) -- 0:00:26
562000 -- (-509.670) (-513.339) (-511.330) [-510.339] * (-509.859) (-512.705) (-508.993) [-508.926] -- 0:00:27
562500 -- (-510.100) (-509.548) (-512.148) [-510.860] * (-510.937) (-511.523) [-510.294] (-511.962) -- 0:00:27
563000 -- (-514.111) (-508.891) (-510.430) [-510.783] * [-509.336] (-511.855) (-509.053) (-510.433) -- 0:00:27
563500 -- (-513.915) (-509.838) [-509.669] (-512.602) * (-510.215) (-510.815) [-509.223] (-509.987) -- 0:00:27
564000 -- (-512.102) [-510.303] (-512.177) (-512.852) * [-509.694] (-510.776) (-509.915) (-510.398) -- 0:00:27
564500 -- (-518.001) [-513.686] (-511.121) (-511.130) * (-510.137) (-510.087) (-510.397) [-513.285] -- 0:00:27
565000 -- (-510.334) [-513.771] (-516.932) (-512.046) * (-510.447) (-509.086) (-512.335) [-513.289] -- 0:00:26
Average standard deviation of split frequencies: 0.009266
565500 -- (-511.127) (-513.025) (-510.728) [-514.058] * (-509.988) (-509.811) [-509.595] (-511.355) -- 0:00:26
566000 -- (-511.700) [-509.981] (-509.609) (-513.447) * (-509.176) (-510.632) [-511.707] (-513.104) -- 0:00:26
566500 -- (-511.996) [-510.819] (-508.804) (-511.194) * (-509.082) [-510.591] (-508.570) (-511.273) -- 0:00:26
567000 -- (-513.570) (-509.871) (-509.227) [-509.631] * [-508.441] (-508.848) (-508.533) (-510.767) -- 0:00:26
567500 -- (-511.112) [-508.421] (-520.137) (-510.133) * (-510.243) [-509.456] (-510.174) (-509.954) -- 0:00:26
568000 -- (-513.630) (-508.909) (-518.538) [-511.031] * (-510.447) (-510.594) (-512.503) [-509.678] -- 0:00:26
568500 -- (-510.913) [-514.332] (-513.610) (-509.254) * (-511.226) (-511.914) (-509.990) [-510.409] -- 0:00:26
569000 -- [-511.621] (-508.924) (-511.848) (-512.226) * [-510.627] (-512.446) (-509.775) (-511.177) -- 0:00:26
569500 -- [-509.645] (-509.076) (-510.447) (-510.639) * (-511.856) [-509.783] (-513.858) (-510.712) -- 0:00:26
570000 -- (-512.160) [-510.843] (-508.811) (-510.665) * (-510.674) [-510.052] (-513.314) (-510.550) -- 0:00:26
Average standard deviation of split frequencies: 0.009087
570500 -- (-510.698) [-510.343] (-511.063) (-513.544) * (-509.653) (-509.909) (-513.154) [-513.416] -- 0:00:26
571000 -- [-511.399] (-512.595) (-513.891) (-512.785) * [-511.639] (-509.466) (-509.169) (-512.596) -- 0:00:26
571500 -- (-513.409) [-508.751] (-511.531) (-513.187) * (-514.438) (-510.042) [-512.798] (-513.624) -- 0:00:26
572000 -- (-508.912) [-508.308] (-510.802) (-513.354) * (-509.864) [-509.276] (-510.833) (-509.931) -- 0:00:26
572500 -- (-511.769) (-510.814) [-510.390] (-509.622) * (-520.887) (-509.325) [-512.592] (-515.405) -- 0:00:26
573000 -- [-509.094] (-514.538) (-511.961) (-512.975) * [-512.802] (-510.747) (-513.375) (-511.377) -- 0:00:26
573500 -- (-511.441) (-511.193) (-512.693) [-513.188] * (-512.453) [-511.909] (-509.834) (-509.247) -- 0:00:26
574000 -- (-509.470) [-510.195] (-510.085) (-511.481) * (-508.817) (-508.742) (-510.611) [-509.503] -- 0:00:25
574500 -- [-511.865] (-509.738) (-511.658) (-511.163) * (-511.673) (-510.738) (-510.939) [-511.515] -- 0:00:25
575000 -- (-510.366) [-513.418] (-509.768) (-511.990) * (-511.021) [-509.124] (-510.093) (-508.924) -- 0:00:25
Average standard deviation of split frequencies: 0.008906
575500 -- [-511.632] (-509.339) (-508.902) (-512.681) * (-509.036) (-511.831) (-509.971) [-509.164] -- 0:00:25
576000 -- (-511.643) (-512.455) (-509.962) [-509.550] * [-508.037] (-509.386) (-509.481) (-511.323) -- 0:00:25
576500 -- [-509.762] (-516.100) (-510.559) (-512.330) * [-508.358] (-509.882) (-512.120) (-510.160) -- 0:00:25
577000 -- (-509.151) (-513.437) [-509.758] (-513.795) * (-509.074) (-512.648) [-511.581] (-510.431) -- 0:00:25
577500 -- (-512.908) [-511.887] (-510.774) (-511.947) * [-510.908] (-509.568) (-513.055) (-510.850) -- 0:00:25
578000 -- (-511.091) [-509.756] (-510.196) (-513.166) * (-508.557) (-509.625) [-510.133] (-513.700) -- 0:00:26
578500 -- [-509.162] (-513.240) (-512.856) (-513.299) * (-510.875) (-509.066) (-510.196) [-512.620] -- 0:00:26
579000 -- [-509.322] (-514.663) (-514.959) (-513.796) * (-511.457) (-509.032) [-509.855] (-514.559) -- 0:00:26
579500 -- (-511.695) [-511.265] (-510.701) (-515.451) * [-509.220] (-508.847) (-511.129) (-508.823) -- 0:00:26
580000 -- (-512.061) (-511.291) [-508.491] (-511.535) * [-511.115] (-513.338) (-510.573) (-512.146) -- 0:00:26
Average standard deviation of split frequencies: 0.008548
580500 -- (-509.976) (-510.726) [-511.355] (-512.590) * (-510.728) (-511.247) [-510.038] (-511.769) -- 0:00:26
581000 -- (-509.580) (-516.652) (-512.961) [-510.517] * (-513.437) (-509.460) [-508.163] (-511.483) -- 0:00:25
581500 -- [-509.486] (-510.387) (-511.542) (-510.375) * (-508.327) (-509.354) (-514.010) [-509.968] -- 0:00:25
582000 -- (-508.314) (-512.200) (-511.375) [-508.802] * (-508.571) (-510.248) [-510.176] (-510.223) -- 0:00:25
582500 -- (-510.409) (-511.565) (-512.372) [-509.773] * [-508.813] (-510.495) (-508.523) (-509.261) -- 0:00:25
583000 -- [-513.419] (-511.873) (-509.243) (-509.239) * (-508.958) (-521.816) [-511.495] (-509.159) -- 0:00:25
583500 -- (-515.568) [-512.763] (-508.873) (-508.214) * (-508.983) (-514.604) (-509.972) [-508.551] -- 0:00:25
584000 -- (-513.474) (-510.783) [-508.730] (-508.906) * [-510.927] (-512.643) (-509.444) (-510.576) -- 0:00:25
584500 -- (-510.745) (-511.736) [-512.542] (-510.855) * (-511.193) (-510.894) [-509.467] (-513.079) -- 0:00:25
585000 -- (-511.879) (-511.925) [-509.726] (-509.286) * (-511.450) (-508.180) (-512.034) [-510.060] -- 0:00:25
Average standard deviation of split frequencies: 0.008707
585500 -- [-510.101] (-509.952) (-509.638) (-509.099) * (-509.463) [-512.790] (-513.539) (-511.586) -- 0:00:25
586000 -- [-510.830] (-510.820) (-513.392) (-510.438) * [-510.205] (-513.031) (-509.331) (-510.943) -- 0:00:25
586500 -- (-508.821) (-511.111) (-514.186) [-514.420] * [-509.094] (-512.230) (-513.915) (-511.516) -- 0:00:25
587000 -- (-509.660) (-514.055) [-512.916] (-512.654) * (-512.153) (-514.963) [-509.434] (-512.325) -- 0:00:25
587500 -- (-510.137) (-509.881) [-509.486] (-509.802) * (-508.793) (-515.334) (-511.802) [-508.858] -- 0:00:25
588000 -- (-509.847) (-513.318) (-510.517) [-508.726] * [-508.569] (-515.711) (-510.753) (-509.987) -- 0:00:25
588500 -- (-513.297) (-509.986) (-511.554) [-511.250] * (-508.617) (-513.143) [-509.008] (-513.462) -- 0:00:25
589000 -- (-510.809) [-513.612] (-509.664) (-513.497) * (-513.432) (-510.727) [-508.898] (-512.273) -- 0:00:25
589500 -- [-510.111] (-513.751) (-508.391) (-511.198) * (-509.095) [-509.983] (-509.152) (-513.258) -- 0:00:25
590000 -- [-511.625] (-510.598) (-510.459) (-509.246) * (-518.267) (-510.414) (-512.368) [-516.850] -- 0:00:25
Average standard deviation of split frequencies: 0.008497
590500 -- (-509.535) (-512.528) (-508.878) [-510.465] * (-511.730) [-512.323] (-511.529) (-509.881) -- 0:00:24
591000 -- [-509.651] (-513.309) (-511.964) (-508.544) * (-515.289) (-515.155) [-510.259] (-510.572) -- 0:00:24
591500 -- [-509.748] (-512.181) (-512.425) (-508.689) * [-513.063] (-510.192) (-509.639) (-510.277) -- 0:00:24
592000 -- (-509.702) (-513.465) [-508.393] (-509.524) * [-511.641] (-511.147) (-510.559) (-513.210) -- 0:00:24
592500 -- (-509.713) (-513.460) (-510.378) [-508.777] * [-509.796] (-510.735) (-509.813) (-514.763) -- 0:00:24
593000 -- [-508.864] (-510.919) (-509.211) (-508.775) * (-512.331) [-510.403] (-509.419) (-509.789) -- 0:00:24
593500 -- (-512.321) (-509.858) (-511.544) [-509.016] * (-511.300) (-514.354) (-513.295) [-512.174] -- 0:00:24
594000 -- [-510.453] (-511.317) (-510.976) (-511.865) * (-509.898) (-509.963) (-513.895) [-511.525] -- 0:00:25
594500 -- (-510.477) (-510.850) (-511.049) [-512.011] * (-511.913) (-509.495) (-509.477) [-511.607] -- 0:00:25
595000 -- (-514.231) (-509.170) [-512.977] (-512.979) * [-510.085] (-509.436) (-510.171) (-512.395) -- 0:00:25
Average standard deviation of split frequencies: 0.008282
595500 -- (-510.098) [-510.110] (-514.581) (-509.694) * [-509.947] (-509.189) (-510.344) (-508.138) -- 0:00:25
596000 -- (-513.528) [-509.895] (-509.870) (-508.419) * (-508.775) [-508.948] (-509.249) (-508.931) -- 0:00:25
596500 -- (-510.632) (-509.579) [-509.726] (-511.884) * (-509.203) (-512.194) [-511.318] (-511.887) -- 0:00:25
597000 -- (-510.334) (-514.009) [-508.974] (-510.755) * (-508.663) (-509.634) [-509.063] (-515.232) -- 0:00:24
597500 -- (-508.774) (-511.437) [-510.963] (-511.391) * [-511.650] (-509.188) (-509.364) (-509.887) -- 0:00:24
598000 -- (-512.707) (-510.085) (-512.018) [-508.094] * [-512.913] (-510.055) (-512.696) (-512.003) -- 0:00:24
598500 -- (-510.852) [-512.022] (-515.088) (-508.411) * [-512.360] (-511.266) (-511.664) (-509.943) -- 0:00:24
599000 -- (-509.667) [-508.471] (-515.677) (-509.986) * (-510.081) (-510.057) (-511.394) [-511.542] -- 0:00:24
599500 -- (-509.585) [-512.280] (-510.047) (-510.541) * [-509.812] (-509.867) (-514.429) (-510.938) -- 0:00:24
600000 -- [-510.536] (-510.354) (-508.541) (-513.663) * (-509.523) [-510.180] (-511.667) (-510.823) -- 0:00:24
Average standard deviation of split frequencies: 0.007750
600500 -- (-514.364) (-515.051) [-509.741] (-512.630) * (-509.088) (-511.436) (-509.640) [-515.255] -- 0:00:24
601000 -- (-514.572) [-513.215] (-511.344) (-510.504) * (-510.803) [-509.343] (-510.421) (-510.096) -- 0:00:24
601500 -- (-511.777) (-509.612) [-509.713] (-509.638) * (-510.153) (-510.557) [-510.603] (-510.545) -- 0:00:24
602000 -- (-513.668) (-513.062) (-510.071) [-508.349] * [-512.849] (-510.633) (-510.642) (-510.659) -- 0:00:24
602500 -- [-514.503] (-510.716) (-511.277) (-510.790) * (-512.451) (-508.688) (-509.725) [-510.224] -- 0:00:24
603000 -- (-510.771) (-509.226) [-508.848] (-509.810) * (-510.036) (-508.953) (-510.420) [-511.917] -- 0:00:24
603500 -- (-510.628) [-509.212] (-510.418) (-509.973) * (-511.497) (-508.510) (-509.322) [-509.514] -- 0:00:24
604000 -- (-509.573) (-508.927) [-509.063] (-510.325) * (-511.740) (-509.479) [-514.183] (-509.437) -- 0:00:24
604500 -- (-513.114) (-509.716) [-510.545] (-510.622) * (-514.866) (-510.472) (-510.120) [-509.277] -- 0:00:24
605000 -- [-510.650] (-509.758) (-510.159) (-510.351) * (-508.966) (-508.389) [-509.452] (-514.136) -- 0:00:24
Average standard deviation of split frequencies: 0.007584
605500 -- (-525.819) (-512.599) (-509.433) [-509.311] * (-509.056) [-510.276] (-509.083) (-510.178) -- 0:00:24
606000 -- (-513.514) (-509.848) [-508.854] (-509.637) * [-510.211] (-510.628) (-510.657) (-513.484) -- 0:00:24
606500 -- [-512.255] (-511.694) (-510.460) (-509.127) * (-512.548) [-509.150] (-509.953) (-514.993) -- 0:00:24
607000 -- (-513.248) (-512.029) (-512.229) [-509.485] * (-512.261) [-510.011] (-510.702) (-513.972) -- 0:00:23
607500 -- [-508.018] (-509.226) (-516.986) (-511.959) * (-508.498) [-509.841] (-514.377) (-514.368) -- 0:00:23
608000 -- (-510.486) [-509.776] (-512.229) (-511.241) * (-511.233) (-511.346) [-512.033] (-511.659) -- 0:00:23
608500 -- (-510.775) (-509.523) [-510.464] (-513.765) * (-519.522) (-510.232) [-508.941] (-511.700) -- 0:00:23
609000 -- (-512.042) (-509.724) (-509.326) [-508.232] * (-520.691) [-510.456] (-510.952) (-509.352) -- 0:00:23
609500 -- [-510.812] (-510.183) (-509.972) (-508.280) * (-509.037) [-510.634] (-513.789) (-509.507) -- 0:00:23
610000 -- (-511.994) [-509.794] (-509.771) (-509.373) * (-508.761) (-509.537) [-510.807] (-509.209) -- 0:00:23
Average standard deviation of split frequencies: 0.007044
610500 -- [-514.894] (-509.773) (-514.892) (-512.494) * (-511.440) (-514.745) [-508.505] (-511.271) -- 0:00:24
611000 -- (-510.918) (-508.800) (-513.086) [-510.260] * [-508.326] (-509.005) (-509.914) (-516.853) -- 0:00:24
611500 -- [-509.910] (-516.635) (-512.567) (-510.352) * (-510.651) (-509.720) [-510.343] (-519.072) -- 0:00:24
612000 -- (-508.662) (-511.648) (-512.697) [-509.101] * (-513.312) (-510.836) [-509.349] (-515.686) -- 0:00:24
612500 -- (-511.111) (-509.722) (-511.979) [-510.006] * (-511.400) [-511.112] (-509.653) (-511.703) -- 0:00:24
613000 -- [-509.637] (-512.451) (-510.467) (-512.621) * (-508.396) [-509.770] (-511.733) (-509.865) -- 0:00:23
613500 -- [-509.999] (-508.861) (-509.999) (-513.273) * (-508.528) (-512.107) (-511.010) [-510.316] -- 0:00:23
614000 -- (-513.569) (-508.864) [-514.310] (-512.989) * [-509.963] (-511.741) (-517.313) (-509.867) -- 0:00:23
614500 -- [-511.518] (-509.033) (-512.678) (-509.923) * [-509.452] (-510.643) (-511.166) (-511.678) -- 0:00:23
615000 -- (-513.329) (-511.444) [-511.925] (-508.626) * (-512.061) (-510.580) (-510.600) [-510.500] -- 0:00:23
Average standard deviation of split frequencies: 0.006792
615500 -- (-511.272) [-510.408] (-510.031) (-512.226) * (-516.834) (-511.464) [-510.025] (-510.453) -- 0:00:23
616000 -- (-509.608) (-508.487) (-508.473) [-511.034] * (-508.216) [-511.061] (-508.621) (-508.780) -- 0:00:23
616500 -- (-508.958) [-511.981] (-509.486) (-512.309) * (-508.290) [-508.948] (-510.161) (-509.833) -- 0:00:23
617000 -- (-510.315) (-512.976) [-509.747] (-510.675) * [-508.435] (-508.859) (-512.297) (-514.222) -- 0:00:23
617500 -- (-509.333) [-511.503] (-510.151) (-517.039) * (-509.124) [-508.857] (-509.741) (-509.046) -- 0:00:23
618000 -- (-509.472) [-510.830] (-509.793) (-510.452) * (-512.030) (-512.772) [-508.249] (-509.909) -- 0:00:23
618500 -- (-509.548) [-510.655] (-511.178) (-510.217) * (-515.240) [-514.602] (-510.605) (-510.914) -- 0:00:23
619000 -- (-508.714) (-510.493) (-510.118) [-512.308] * (-513.549) (-511.887) [-510.289] (-510.293) -- 0:00:23
619500 -- (-510.129) (-509.374) [-511.394] (-513.735) * (-512.011) (-510.395) (-509.986) [-510.234] -- 0:00:23
620000 -- (-509.150) (-512.115) (-512.470) [-510.825] * (-510.722) (-509.995) (-511.727) [-511.759] -- 0:00:23
Average standard deviation of split frequencies: 0.006503
620500 -- (-513.406) [-511.986] (-513.649) (-511.594) * [-508.969] (-511.366) (-513.007) (-509.231) -- 0:00:23
621000 -- (-512.645) [-508.984] (-509.529) (-508.040) * [-511.536] (-509.642) (-511.918) (-510.290) -- 0:00:23
621500 -- (-509.737) (-510.535) (-510.079) [-508.386] * (-511.111) (-513.918) [-510.089] (-510.684) -- 0:00:23
622000 -- (-512.765) (-513.881) [-509.327] (-509.663) * [-510.685] (-512.150) (-510.590) (-513.406) -- 0:00:23
622500 -- [-511.610] (-512.534) (-510.358) (-510.071) * (-512.882) (-512.788) (-510.498) [-510.148] -- 0:00:23
623000 -- (-513.486) [-510.602] (-509.440) (-509.305) * (-510.587) (-513.667) (-511.761) [-509.962] -- 0:00:22
623500 -- (-510.641) (-509.842) [-510.815] (-509.763) * (-509.102) (-510.247) (-511.114) [-511.385] -- 0:00:22
624000 -- (-508.701) (-511.107) (-508.610) [-508.634] * (-510.092) (-511.913) [-510.518] (-511.083) -- 0:00:22
624500 -- (-509.961) (-511.509) [-511.010] (-513.068) * (-511.534) (-513.281) [-510.715] (-509.966) -- 0:00:22
625000 -- [-511.412] (-511.870) (-509.881) (-512.278) * (-510.142) (-508.462) [-508.446] (-509.604) -- 0:00:22
Average standard deviation of split frequencies: 0.006730
625500 -- (-509.386) [-511.124] (-509.733) (-511.117) * (-510.252) [-509.830] (-510.895) (-513.037) -- 0:00:22
626000 -- (-510.001) [-509.116] (-509.226) (-512.768) * (-512.163) (-510.668) [-510.957] (-512.795) -- 0:00:22
626500 -- [-511.298] (-509.721) (-510.918) (-508.759) * (-509.839) [-511.168] (-509.944) (-509.563) -- 0:00:22
627000 -- (-510.597) [-509.014] (-510.216) (-513.353) * (-509.047) (-513.624) [-510.429] (-509.905) -- 0:00:23
627500 -- (-509.618) [-511.838] (-509.587) (-513.166) * [-509.698] (-517.133) (-510.855) (-509.095) -- 0:00:23
628000 -- (-509.426) (-511.601) [-510.395] (-509.152) * (-508.875) [-510.856] (-513.798) (-509.368) -- 0:00:23
628500 -- (-510.851) [-510.383] (-509.695) (-512.933) * (-510.673) [-511.184] (-513.904) (-509.309) -- 0:00:23
629000 -- [-510.016] (-509.302) (-510.385) (-509.318) * (-508.596) (-511.083) [-508.930] (-515.543) -- 0:00:23
629500 -- (-508.371) [-509.528] (-512.997) (-511.284) * (-509.259) [-511.350] (-510.229) (-510.958) -- 0:00:22
630000 -- (-515.419) (-509.411) [-511.772] (-515.837) * (-509.108) (-512.855) (-513.407) [-509.336] -- 0:00:22
Average standard deviation of split frequencies: 0.007241
630500 -- (-512.451) [-509.540] (-513.370) (-508.990) * (-511.997) (-510.162) [-512.807] (-509.918) -- 0:00:22
631000 -- [-509.745] (-510.155) (-517.156) (-509.453) * [-510.730] (-513.725) (-510.996) (-512.406) -- 0:00:22
631500 -- (-515.219) (-515.012) [-515.614] (-508.442) * (-510.100) (-509.419) (-510.618) [-510.891] -- 0:00:22
632000 -- (-509.658) (-510.658) (-511.575) [-509.236] * (-513.110) [-509.623] (-512.620) (-512.127) -- 0:00:22
632500 -- (-508.821) [-508.721] (-509.234) (-511.592) * (-511.582) (-511.917) (-517.658) [-508.761] -- 0:00:22
633000 -- (-514.316) (-510.787) (-511.487) [-511.179] * (-508.251) (-512.380) (-513.646) [-509.544] -- 0:00:22
633500 -- (-515.335) [-508.721] (-511.009) (-511.924) * (-509.435) (-509.773) [-509.787] (-510.972) -- 0:00:22
634000 -- (-510.787) [-509.172] (-513.892) (-512.768) * [-509.041] (-509.756) (-509.937) (-512.271) -- 0:00:22
634500 -- (-512.168) (-509.983) [-509.638] (-511.042) * [-509.489] (-512.353) (-512.383) (-517.824) -- 0:00:22
635000 -- [-511.642] (-509.300) (-510.805) (-510.085) * (-509.623) (-511.297) [-509.186] (-514.643) -- 0:00:22
Average standard deviation of split frequencies: 0.007273
635500 -- [-512.226] (-511.548) (-513.065) (-510.643) * (-509.669) (-509.895) (-508.904) [-508.935] -- 0:00:22
636000 -- [-509.467] (-509.836) (-512.336) (-509.569) * (-509.934) [-509.418] (-511.002) (-509.206) -- 0:00:22
636500 -- [-510.034] (-510.021) (-510.073) (-511.486) * (-514.359) (-509.547) [-508.892] (-510.025) -- 0:00:22
637000 -- [-515.379] (-512.850) (-516.378) (-510.565) * (-510.952) [-510.162] (-508.829) (-516.131) -- 0:00:22
637500 -- [-509.766] (-509.548) (-512.807) (-514.534) * (-510.243) (-509.943) (-509.751) [-508.741] -- 0:00:22
638000 -- [-509.786] (-509.452) (-511.114) (-512.061) * [-512.780] (-510.633) (-508.921) (-512.965) -- 0:00:22
638500 -- [-509.862] (-509.810) (-511.331) (-510.939) * (-509.870) (-510.490) [-510.128] (-509.536) -- 0:00:22
639000 -- [-511.269] (-511.032) (-512.881) (-513.717) * (-513.084) [-509.775] (-510.411) (-508.603) -- 0:00:22
639500 -- (-510.397) (-511.601) [-510.162] (-512.050) * [-516.417] (-509.594) (-510.562) (-509.217) -- 0:00:21
640000 -- (-509.653) [-508.528] (-508.326) (-509.326) * (-510.598) [-509.017] (-514.320) (-511.027) -- 0:00:21
Average standard deviation of split frequencies: 0.007450
640500 -- (-508.813) (-510.216) [-513.535] (-510.827) * (-511.492) (-508.805) (-516.310) [-510.612] -- 0:00:21
641000 -- (-515.227) [-510.025] (-510.288) (-512.618) * (-511.168) [-509.547] (-511.390) (-509.889) -- 0:00:21
641500 -- (-510.454) (-508.141) (-512.182) [-512.725] * [-510.472] (-511.210) (-511.776) (-512.461) -- 0:00:21
642000 -- (-509.269) [-510.012] (-512.736) (-510.873) * (-509.158) (-511.281) (-513.822) [-511.013] -- 0:00:21
642500 -- [-509.513] (-509.764) (-511.895) (-509.975) * (-509.193) (-508.751) [-513.402] (-512.379) -- 0:00:21
643000 -- [-509.448] (-509.454) (-509.092) (-509.522) * [-508.969] (-508.515) (-509.113) (-509.021) -- 0:00:21
643500 -- (-510.299) (-511.252) (-510.867) [-508.592] * [-509.811] (-509.052) (-510.297) (-511.059) -- 0:00:21
644000 -- (-511.922) (-511.036) (-508.605) [-509.241] * (-509.727) (-515.014) (-510.825) [-509.236] -- 0:00:22
644500 -- (-511.579) (-510.621) (-513.351) [-509.274] * (-510.364) (-512.158) (-509.966) [-511.679] -- 0:00:22
645000 -- (-515.177) (-511.302) [-509.044] (-509.345) * (-512.695) [-509.260] (-515.435) (-519.932) -- 0:00:22
Average standard deviation of split frequencies: 0.007069
645500 -- (-510.893) [-510.051] (-510.094) (-508.786) * (-513.726) (-509.371) (-511.227) [-511.847] -- 0:00:21
646000 -- (-509.053) (-514.309) (-516.498) [-509.349] * (-514.052) (-508.562) [-511.841] (-509.091) -- 0:00:21
646500 -- (-509.370) [-511.341] (-511.146) (-510.292) * (-510.093) (-511.442) [-512.334] (-509.514) -- 0:00:21
647000 -- (-513.601) (-509.351) [-509.374] (-510.124) * (-509.096) (-512.110) [-511.106] (-513.101) -- 0:00:21
647500 -- (-510.426) (-509.090) (-509.380) [-509.052] * (-511.833) [-510.228] (-510.447) (-512.094) -- 0:00:21
648000 -- (-511.171) (-509.897) (-509.071) [-508.479] * (-510.229) [-511.669] (-510.668) (-510.006) -- 0:00:21
648500 -- (-509.266) [-511.008] (-511.779) (-509.607) * (-509.236) (-513.033) (-510.225) [-512.558] -- 0:00:21
649000 -- [-509.177] (-512.045) (-515.980) (-509.423) * (-509.977) (-509.529) (-508.229) [-510.189] -- 0:00:21
649500 -- [-510.272] (-510.637) (-511.680) (-508.883) * (-508.964) (-510.484) [-510.093] (-510.374) -- 0:00:21
650000 -- (-509.582) [-512.595] (-512.727) (-511.390) * [-509.862] (-513.611) (-509.489) (-511.522) -- 0:00:21
Average standard deviation of split frequencies: 0.007200
650500 -- (-510.767) (-510.575) [-510.742] (-510.051) * (-510.740) [-511.040] (-512.467) (-509.067) -- 0:00:21
651000 -- (-516.151) (-510.982) (-508.716) [-511.210] * (-511.940) (-509.124) [-511.815] (-508.825) -- 0:00:21
651500 -- [-511.116] (-509.063) (-510.458) (-508.741) * (-512.225) (-512.728) (-510.578) [-508.782] -- 0:00:21
652000 -- (-511.109) (-508.299) [-513.162] (-509.922) * (-509.960) [-511.694] (-509.794) (-508.463) -- 0:00:21
652500 -- [-509.873] (-508.517) (-510.942) (-512.355) * (-509.833) (-511.886) [-509.103] (-510.832) -- 0:00:21
653000 -- [-516.100] (-513.082) (-509.586) (-511.745) * (-509.371) (-511.335) [-508.906] (-509.714) -- 0:00:21
653500 -- [-510.886] (-510.962) (-511.389) (-512.437) * (-511.713) (-511.518) [-512.138] (-511.619) -- 0:00:21
654000 -- (-514.891) (-511.580) [-515.255] (-511.731) * (-510.436) [-511.022] (-517.178) (-511.055) -- 0:00:21
654500 -- [-513.931] (-510.017) (-510.320) (-509.885) * (-509.960) (-509.980) (-515.364) [-510.597] -- 0:00:21
655000 -- (-515.542) (-516.488) [-509.018] (-512.192) * [-511.270] (-510.085) (-512.658) (-514.578) -- 0:00:21
Average standard deviation of split frequencies: 0.006333
655500 -- (-511.424) (-512.187) [-508.363] (-511.083) * (-511.199) (-510.419) [-508.918] (-509.273) -- 0:00:21
656000 -- [-511.318] (-510.866) (-510.111) (-508.970) * [-510.468] (-512.246) (-509.403) (-511.062) -- 0:00:20
656500 -- [-510.133] (-510.379) (-511.132) (-511.138) * (-509.462) [-510.725] (-508.801) (-512.088) -- 0:00:20
657000 -- (-511.567) [-510.130] (-513.916) (-509.020) * (-509.370) (-509.099) (-508.971) [-512.126] -- 0:00:20
657500 -- (-511.383) (-513.363) (-508.668) [-515.834] * (-511.236) [-512.541] (-510.486) (-511.047) -- 0:00:20
658000 -- (-512.578) [-516.764] (-510.837) (-509.277) * (-509.392) [-509.022] (-509.688) (-510.040) -- 0:00:20
658500 -- (-512.002) (-512.950) (-519.008) [-509.298] * (-509.225) (-510.223) (-510.469) [-509.729] -- 0:00:20
659000 -- (-510.673) [-509.437] (-511.575) (-508.229) * (-513.992) (-510.962) (-513.342) [-510.267] -- 0:00:20
659500 -- (-511.778) (-511.383) (-514.426) [-512.469] * [-510.774] (-509.410) (-511.755) (-509.600) -- 0:00:20
660000 -- (-511.063) (-512.849) [-512.232] (-509.411) * (-512.658) (-513.425) [-511.625] (-510.979) -- 0:00:20
Average standard deviation of split frequencies: 0.006154
660500 -- (-515.127) (-508.845) (-515.410) [-510.860] * (-509.526) (-511.736) [-512.248] (-509.429) -- 0:00:21
661000 -- [-510.014] (-510.375) (-513.819) (-511.278) * (-509.932) (-512.034) (-514.636) [-513.088] -- 0:00:21
661500 -- (-510.729) [-511.874] (-509.372) (-509.645) * (-512.096) [-512.018] (-513.037) (-510.960) -- 0:00:20
662000 -- [-509.692] (-509.217) (-509.166) (-509.719) * [-510.536] (-510.451) (-512.338) (-508.994) -- 0:00:20
662500 -- [-508.883] (-511.377) (-511.185) (-510.094) * [-510.507] (-511.076) (-512.073) (-509.369) -- 0:00:20
663000 -- (-508.688) (-511.577) [-513.830] (-512.088) * (-512.302) (-508.762) [-512.080] (-509.162) -- 0:00:20
663500 -- (-509.582) (-511.063) (-513.245) [-512.030] * (-509.771) (-512.407) [-508.946] (-514.797) -- 0:00:20
664000 -- (-515.434) (-511.878) (-508.795) [-509.532] * (-511.757) [-508.557] (-513.503) (-514.854) -- 0:00:20
664500 -- [-509.734] (-508.662) (-511.530) (-511.296) * (-509.630) (-511.229) [-510.649] (-509.991) -- 0:00:20
665000 -- [-510.146] (-509.835) (-509.007) (-509.341) * [-508.801] (-509.123) (-515.494) (-515.018) -- 0:00:20
Average standard deviation of split frequencies: 0.005486
665500 -- (-508.646) (-510.033) [-508.670] (-511.869) * (-509.230) (-510.179) [-509.955] (-510.295) -- 0:00:20
666000 -- (-510.359) (-510.108) (-512.410) [-510.015] * (-510.069) (-510.756) [-508.610] (-508.254) -- 0:00:20
666500 -- (-511.022) (-515.237) (-510.545) [-509.683] * (-509.916) [-511.382] (-508.683) (-509.132) -- 0:00:20
667000 -- (-513.838) [-509.569] (-510.486) (-513.329) * [-509.397] (-511.777) (-510.622) (-509.434) -- 0:00:20
667500 -- [-514.587] (-512.584) (-511.976) (-513.928) * [-512.648] (-508.910) (-511.616) (-510.699) -- 0:00:20
668000 -- (-512.299) (-510.606) (-512.200) [-512.255] * (-509.577) (-509.632) [-509.572] (-510.464) -- 0:00:20
668500 -- (-508.819) (-509.235) (-509.707) [-511.913] * (-509.107) (-510.040) [-511.916] (-513.511) -- 0:00:20
669000 -- (-510.915) (-510.678) (-509.217) [-510.561] * [-509.538] (-508.709) (-511.119) (-516.915) -- 0:00:20
669500 -- (-509.119) (-509.134) (-509.083) [-509.157] * (-511.182) (-510.147) [-510.570] (-508.354) -- 0:00:20
670000 -- [-510.071] (-511.801) (-508.555) (-518.042) * (-508.173) [-509.016] (-510.110) (-510.517) -- 0:00:20
Average standard deviation of split frequencies: 0.005535
670500 -- (-510.878) [-513.069] (-512.100) (-510.462) * [-509.607] (-517.396) (-515.858) (-512.514) -- 0:00:20
671000 -- [-510.294] (-511.080) (-509.360) (-511.032) * (-509.029) (-513.112) [-509.167] (-513.586) -- 0:00:20
671500 -- (-510.368) (-510.872) [-508.279] (-509.047) * (-511.465) [-510.703] (-511.725) (-511.440) -- 0:00:20
672000 -- (-509.632) (-509.100) (-509.448) [-509.965] * [-509.175] (-514.081) (-510.841) (-509.638) -- 0:00:20
672500 -- (-510.445) (-509.525) (-509.356) [-509.393] * [-511.460] (-510.237) (-512.008) (-510.348) -- 0:00:19
673000 -- (-508.937) (-510.464) [-509.221] (-512.077) * (-508.151) (-510.415) [-509.536] (-510.665) -- 0:00:19
673500 -- (-508.302) (-514.902) [-509.426] (-510.076) * [-509.393] (-511.462) (-509.609) (-513.152) -- 0:00:19
674000 -- (-512.690) [-510.618] (-509.431) (-509.014) * (-513.111) (-513.107) [-509.405] (-510.674) -- 0:00:19
674500 -- (-510.968) (-514.632) (-508.716) [-510.408] * (-509.175) [-513.252] (-512.334) (-510.394) -- 0:00:19
675000 -- [-511.484] (-512.824) (-509.784) (-511.539) * (-516.518) (-511.602) (-509.056) [-508.737] -- 0:00:19
Average standard deviation of split frequencies: 0.005710
675500 -- (-510.623) (-512.406) [-511.236] (-513.675) * [-513.957] (-509.585) (-510.233) (-509.092) -- 0:00:19
676000 -- (-509.695) (-512.960) (-508.632) [-511.455] * (-511.799) (-512.055) [-511.336] (-515.172) -- 0:00:19
676500 -- (-511.050) (-508.576) [-511.831] (-510.906) * (-512.240) (-512.002) (-512.145) [-509.966] -- 0:00:19
677000 -- (-510.469) [-508.583] (-512.080) (-515.299) * (-512.781) [-510.761] (-519.327) (-511.412) -- 0:00:19
677500 -- (-509.264) (-509.900) [-513.317] (-509.119) * (-510.666) (-510.564) (-512.729) [-511.508] -- 0:00:19
678000 -- (-511.649) (-511.622) [-510.411] (-509.487) * (-510.538) [-509.644] (-508.980) (-511.541) -- 0:00:19
678500 -- [-514.166] (-511.753) (-511.075) (-511.129) * (-511.213) (-510.832) [-511.862] (-509.647) -- 0:00:19
679000 -- (-510.085) (-512.968) [-516.063] (-510.156) * (-511.161) (-511.936) (-512.399) [-510.815] -- 0:00:19
679500 -- (-511.165) (-509.483) [-510.527] (-508.712) * (-510.469) (-508.616) [-512.009] (-508.344) -- 0:00:19
680000 -- (-509.476) [-510.762] (-510.908) (-508.981) * (-509.871) (-514.977) [-510.969] (-509.128) -- 0:00:19
Average standard deviation of split frequencies: 0.005973
680500 -- (-510.302) (-512.133) (-511.434) [-509.521] * (-510.179) [-509.169] (-512.329) (-512.855) -- 0:00:19
681000 -- (-510.204) [-508.681] (-509.425) (-513.203) * (-508.765) (-510.985) [-511.508] (-512.313) -- 0:00:19
681500 -- (-512.495) [-518.830] (-508.210) (-517.185) * (-510.056) (-509.447) (-509.800) [-512.829] -- 0:00:19
682000 -- [-513.231] (-521.698) (-510.009) (-515.236) * (-509.768) [-510.029] (-510.126) (-515.488) -- 0:00:19
682500 -- (-510.861) (-520.670) [-510.132] (-511.289) * (-511.679) (-510.651) (-510.846) [-515.989] -- 0:00:19
683000 -- (-509.736) (-509.602) (-511.516) [-511.928] * (-515.278) [-514.122] (-509.999) (-510.274) -- 0:00:19
683500 -- [-510.318] (-508.428) (-510.318) (-512.821) * (-512.553) [-512.919] (-511.293) (-511.025) -- 0:00:19
684000 -- (-508.968) (-510.548) [-510.616] (-509.600) * [-510.780] (-508.833) (-513.047) (-512.857) -- 0:00:19
684500 -- (-510.730) [-509.709] (-510.199) (-509.611) * (-512.575) (-509.614) (-509.642) [-514.795] -- 0:00:19
685000 -- [-512.238] (-509.359) (-511.566) (-511.587) * (-513.025) (-511.111) [-511.169] (-509.561) -- 0:00:19
Average standard deviation of split frequencies: 0.005712
685500 -- (-512.265) (-515.367) (-509.696) [-509.435] * (-514.118) (-512.225) (-509.998) [-511.136] -- 0:00:19
686000 -- (-510.657) (-513.923) (-509.815) [-510.984] * (-510.704) [-512.279] (-514.210) (-511.561) -- 0:00:19
686500 -- [-510.917] (-514.953) (-512.517) (-509.941) * (-510.787) [-511.205] (-510.485) (-508.605) -- 0:00:19
687000 -- (-510.866) (-508.272) (-509.858) [-510.469] * [-510.264] (-512.933) (-512.138) (-518.606) -- 0:00:19
687500 -- (-511.142) (-509.392) [-509.178] (-508.429) * [-509.622] (-510.909) (-514.730) (-510.650) -- 0:00:19
688000 -- [-508.762] (-510.095) (-509.700) (-508.877) * (-510.413) (-512.999) (-508.810) [-509.483] -- 0:00:19
688500 -- (-509.048) [-510.828] (-510.905) (-510.464) * (-512.177) (-518.530) (-511.669) [-509.378] -- 0:00:19
689000 -- (-510.054) (-513.289) [-509.668] (-515.899) * (-512.931) (-513.733) [-511.019] (-510.229) -- 0:00:18
689500 -- [-510.646] (-515.771) (-508.386) (-509.600) * (-509.883) [-512.333] (-509.718) (-511.856) -- 0:00:18
690000 -- (-509.084) [-509.296] (-509.078) (-512.053) * (-510.253) (-509.362) [-511.496] (-516.152) -- 0:00:18
Average standard deviation of split frequencies: 0.005162
690500 -- [-509.558] (-511.246) (-511.888) (-511.694) * (-510.445) [-508.429] (-511.397) (-509.971) -- 0:00:18
691000 -- (-515.761) (-512.332) [-510.499] (-512.431) * (-515.900) (-508.196) [-510.694] (-509.581) -- 0:00:18
691500 -- (-509.833) [-510.559] (-508.904) (-514.273) * (-510.256) (-509.262) [-512.118] (-508.098) -- 0:00:18
692000 -- [-509.028] (-511.059) (-511.575) (-512.690) * [-508.164] (-509.838) (-510.350) (-508.593) -- 0:00:18
692500 -- (-513.717) [-510.552] (-513.519) (-509.575) * (-509.864) (-509.854) (-512.887) [-512.808] -- 0:00:18
693000 -- (-509.506) (-509.481) (-513.031) [-510.750] * [-508.749] (-509.485) (-509.697) (-515.535) -- 0:00:18
693500 -- (-511.275) (-509.623) [-508.550] (-508.927) * (-512.343) [-510.855] (-513.199) (-510.422) -- 0:00:18
694000 -- [-511.158] (-510.992) (-510.080) (-509.874) * [-509.547] (-512.545) (-511.350) (-511.647) -- 0:00:18
694500 -- (-512.073) (-512.671) [-509.263] (-511.444) * [-508.385] (-511.174) (-511.168) (-513.057) -- 0:00:18
695000 -- (-511.606) [-511.444] (-512.489) (-509.032) * (-511.475) [-508.805] (-510.195) (-509.183) -- 0:00:18
Average standard deviation of split frequencies: 0.005164
695500 -- (-511.546) (-511.284) (-509.113) [-508.969] * [-509.638] (-515.627) (-508.993) (-510.410) -- 0:00:18
696000 -- (-508.741) [-512.634] (-512.012) (-508.269) * (-509.212) (-509.043) [-509.091] (-510.649) -- 0:00:18
696500 -- (-510.427) (-512.339) (-510.792) [-508.478] * (-510.064) (-509.677) [-510.307] (-510.622) -- 0:00:18
697000 -- [-510.190] (-512.161) (-510.173) (-511.861) * (-508.333) (-513.345) (-513.494) [-508.780] -- 0:00:18
697500 -- (-509.678) (-513.975) (-509.929) [-508.616] * (-512.309) (-509.262) (-509.604) [-513.453] -- 0:00:18
698000 -- (-509.568) (-509.736) (-510.690) [-509.056] * (-509.538) [-511.151] (-511.215) (-508.383) -- 0:00:18
698500 -- (-511.859) [-509.298] (-513.576) (-511.152) * (-509.208) (-513.080) (-508.973) [-509.490] -- 0:00:18
699000 -- (-510.193) [-509.207] (-512.391) (-513.543) * [-510.510] (-510.680) (-510.121) (-512.985) -- 0:00:18
699500 -- (-511.437) [-509.519] (-509.876) (-510.595) * (-511.349) [-509.149] (-511.712) (-512.871) -- 0:00:18
700000 -- (-513.959) (-509.807) [-510.495] (-511.674) * (-510.309) (-511.542) [-511.185] (-510.045) -- 0:00:18
Average standard deviation of split frequencies: 0.005298
700500 -- (-512.939) (-510.675) [-509.046] (-508.326) * [-509.327] (-509.937) (-515.557) (-511.064) -- 0:00:18
701000 -- [-511.746] (-508.116) (-510.122) (-512.383) * (-510.617) (-509.899) [-510.552] (-510.738) -- 0:00:18
701500 -- (-508.623) [-509.705] (-511.122) (-512.076) * [-510.982] (-508.754) (-510.219) (-510.976) -- 0:00:18
702000 -- [-511.482] (-510.088) (-510.553) (-510.286) * (-509.565) [-509.309] (-510.989) (-509.261) -- 0:00:18
702500 -- (-511.840) [-511.687] (-508.919) (-509.513) * (-509.442) [-511.173] (-511.022) (-510.380) -- 0:00:18
703000 -- (-510.700) [-514.527] (-508.569) (-509.519) * (-511.324) [-508.946] (-510.403) (-510.507) -- 0:00:18
703500 -- (-510.735) (-515.763) [-511.807] (-509.118) * (-509.134) (-510.316) (-512.242) [-508.316] -- 0:00:18
704000 -- (-509.236) (-512.118) [-508.915] (-511.478) * (-510.016) (-511.834) (-513.528) [-509.253] -- 0:00:18
704500 -- (-511.929) [-511.208] (-509.107) (-512.370) * (-511.720) (-510.052) (-512.809) [-508.725] -- 0:00:18
705000 -- (-508.843) [-509.942] (-509.091) (-510.196) * (-516.215) (-513.693) [-509.518] (-509.359) -- 0:00:17
Average standard deviation of split frequencies: 0.005509
705500 -- (-510.994) (-509.551) [-509.810] (-510.116) * [-509.661] (-509.243) (-509.939) (-510.665) -- 0:00:17
706000 -- [-511.833] (-513.108) (-509.517) (-510.088) * (-513.192) [-511.982] (-511.066) (-510.405) -- 0:00:17
706500 -- (-510.278) (-508.456) [-508.812] (-509.875) * (-510.105) (-509.045) (-511.969) [-511.905] -- 0:00:17
707000 -- (-509.762) (-511.563) (-519.684) [-510.400] * (-510.343) [-508.816] (-511.257) (-508.642) -- 0:00:17
707500 -- (-511.449) [-510.004] (-510.284) (-508.594) * (-510.151) [-510.911] (-513.049) (-512.256) -- 0:00:17
708000 -- (-510.451) (-510.191) [-509.509] (-513.663) * (-512.930) [-510.680] (-509.781) (-510.461) -- 0:00:17
708500 -- [-508.957] (-511.363) (-510.969) (-509.981) * (-509.813) (-512.293) (-511.576) [-509.919] -- 0:00:17
709000 -- [-510.003] (-509.348) (-510.674) (-512.085) * [-508.965] (-511.048) (-511.918) (-509.986) -- 0:00:17
709500 -- [-515.005] (-509.944) (-509.802) (-509.986) * (-509.627) (-511.453) (-510.220) [-510.460] -- 0:00:17
710000 -- (-511.440) [-509.541] (-508.631) (-508.480) * (-509.834) (-511.357) [-513.918] (-513.713) -- 0:00:17
Average standard deviation of split frequencies: 0.005390
710500 -- (-508.748) [-509.581] (-508.679) (-508.661) * [-509.271] (-513.208) (-509.483) (-511.627) -- 0:00:17
711000 -- (-508.920) (-511.492) (-509.924) [-510.181] * (-509.314) (-512.027) [-509.466] (-512.594) -- 0:00:17
711500 -- (-510.833) (-510.914) (-511.389) [-510.010] * [-508.721] (-510.251) (-512.631) (-513.392) -- 0:00:17
712000 -- (-511.351) (-508.593) [-511.563] (-508.808) * [-508.776] (-510.518) (-513.247) (-510.928) -- 0:00:17
712500 -- (-508.899) [-513.356] (-509.869) (-514.391) * [-508.557] (-512.063) (-512.547) (-510.233) -- 0:00:17
713000 -- (-510.302) (-512.656) [-509.797] (-508.611) * [-508.626] (-511.702) (-510.447) (-514.246) -- 0:00:17
713500 -- (-510.583) (-512.503) [-511.581] (-511.170) * [-509.820] (-510.250) (-509.719) (-511.371) -- 0:00:17
714000 -- (-509.043) (-514.639) (-513.335) [-511.514] * [-512.446] (-509.368) (-509.211) (-509.026) -- 0:00:17
714500 -- (-510.108) [-510.432] (-510.285) (-512.134) * (-509.912) (-509.098) (-510.501) [-510.648] -- 0:00:17
715000 -- (-508.576) (-509.404) (-509.588) [-509.281] * (-509.864) (-508.741) (-512.705) [-510.721] -- 0:00:17
Average standard deviation of split frequencies: 0.005802
715500 -- (-511.268) [-511.177] (-511.220) (-509.787) * (-509.712) [-511.997] (-512.722) (-510.389) -- 0:00:17
716000 -- [-514.751] (-510.470) (-511.007) (-509.597) * (-509.324) (-509.053) [-510.658] (-510.003) -- 0:00:17
716500 -- [-510.544] (-510.593) (-512.824) (-509.843) * [-509.397] (-510.518) (-513.272) (-510.023) -- 0:00:17
717000 -- (-511.249) (-512.941) [-511.097] (-511.156) * (-509.075) (-509.356) [-514.069] (-509.606) -- 0:00:17
717500 -- (-515.232) (-509.513) (-509.586) [-511.963] * (-509.965) (-508.648) [-512.080] (-510.207) -- 0:00:17
718000 -- [-510.367] (-512.775) (-511.006) (-512.196) * (-510.326) (-508.607) (-511.218) [-516.239] -- 0:00:17
718500 -- (-508.709) (-514.934) [-509.655] (-510.388) * [-509.529] (-512.110) (-511.423) (-515.878) -- 0:00:17
719000 -- (-511.384) (-510.194) (-510.008) [-510.705] * (-509.598) (-509.951) [-512.068] (-512.836) -- 0:00:17
719500 -- (-510.739) (-511.856) (-513.824) [-512.572] * (-509.444) (-510.328) [-509.899] (-510.592) -- 0:00:17
720000 -- (-509.853) [-509.916] (-508.916) (-510.981) * (-509.931) [-509.047] (-511.544) (-508.908) -- 0:00:17
Average standard deviation of split frequencies: 0.005764
720500 -- (-508.766) [-510.167] (-510.811) (-511.779) * (-508.739) (-508.875) [-508.383] (-514.136) -- 0:00:17
721000 -- [-510.898] (-510.890) (-508.768) (-511.724) * (-510.056) (-510.662) [-510.868] (-509.990) -- 0:00:17
721500 -- (-514.936) (-508.777) (-509.311) [-510.623] * (-511.211) (-509.104) (-509.982) [-509.634] -- 0:00:16
722000 -- [-511.657] (-510.609) (-509.258) (-509.293) * [-508.962] (-509.677) (-513.187) (-512.178) -- 0:00:16
722500 -- (-509.878) (-509.046) (-508.204) [-508.444] * (-510.859) (-509.272) (-512.447) [-512.306] -- 0:00:16
723000 -- (-510.057) (-512.232) [-510.826] (-508.966) * (-510.086) (-511.680) (-512.116) [-513.572] -- 0:00:16
723500 -- (-511.381) (-515.635) (-509.737) [-508.496] * (-509.741) [-509.831] (-513.523) (-511.197) -- 0:00:16
724000 -- (-510.465) [-510.768] (-509.487) (-511.874) * (-511.980) (-511.841) [-512.277] (-511.826) -- 0:00:16
724500 -- (-510.408) [-509.606] (-513.612) (-510.398) * (-509.932) [-510.480] (-509.680) (-508.968) -- 0:00:16
725000 -- (-512.761) [-511.476] (-513.251) (-513.139) * (-510.830) [-508.952] (-508.671) (-509.185) -- 0:00:16
Average standard deviation of split frequencies: 0.005966
725500 -- [-511.534] (-517.068) (-513.086) (-511.447) * [-510.858] (-509.094) (-509.435) (-509.122) -- 0:00:16
726000 -- [-512.379] (-511.053) (-512.334) (-511.578) * (-509.478) [-511.645] (-511.319) (-514.199) -- 0:00:16
726500 -- (-508.811) [-509.072] (-508.699) (-512.025) * [-509.606] (-509.658) (-512.544) (-516.314) -- 0:00:16
727000 -- (-511.079) (-508.944) [-510.667] (-508.983) * (-508.597) [-510.939] (-509.971) (-510.674) -- 0:00:16
727500 -- (-511.709) (-508.955) [-511.023] (-510.942) * (-512.720) [-508.587] (-510.707) (-510.690) -- 0:00:16
728000 -- (-509.311) (-508.189) (-512.873) [-508.948] * [-511.746] (-508.855) (-511.302) (-511.290) -- 0:00:16
728500 -- (-509.020) (-508.559) (-511.475) [-509.396] * (-514.253) [-513.547] (-511.750) (-511.026) -- 0:00:16
729000 -- [-509.441] (-511.012) (-513.860) (-513.278) * (-511.487) [-510.909] (-508.171) (-512.982) -- 0:00:16
729500 -- (-508.635) (-511.140) (-512.954) [-510.387] * (-508.414) (-514.972) (-511.692) [-511.039] -- 0:00:16
730000 -- (-509.574) (-510.938) (-510.030) [-509.904] * (-512.453) (-510.721) [-508.766] (-512.299) -- 0:00:16
Average standard deviation of split frequencies: 0.006250
730500 -- (-508.947) (-509.058) (-510.989) [-509.765] * (-513.448) (-509.519) (-510.889) [-509.568] -- 0:00:16
731000 -- (-509.009) (-509.631) [-510.382] (-510.399) * [-511.415] (-509.674) (-512.111) (-512.602) -- 0:00:16
731500 -- (-511.138) (-511.413) [-508.844] (-509.409) * (-511.580) (-510.032) (-513.781) [-508.896] -- 0:00:16
732000 -- [-513.607] (-512.513) (-510.090) (-509.915) * (-508.476) (-510.849) [-510.661] (-511.081) -- 0:00:16
732500 -- (-510.506) (-512.939) [-511.790] (-509.267) * (-510.299) [-511.010] (-509.598) (-508.718) -- 0:00:16
733000 -- (-510.254) (-508.813) [-509.944] (-512.324) * (-508.710) (-510.000) [-510.967] (-510.800) -- 0:00:16
733500 -- (-512.825) (-510.433) [-510.337] (-509.710) * (-509.328) (-509.154) (-508.319) [-508.253] -- 0:00:16
734000 -- (-510.652) (-508.972) (-510.709) [-509.119] * [-508.954] (-508.652) (-513.447) (-509.202) -- 0:00:16
734500 -- [-511.401] (-512.720) (-510.518) (-511.310) * (-509.304) (-509.142) [-510.624] (-509.995) -- 0:00:16
735000 -- (-508.766) (-514.902) [-509.297] (-509.642) * [-510.053] (-509.505) (-513.070) (-512.442) -- 0:00:16
Average standard deviation of split frequencies: 0.005925
735500 -- (-510.638) (-513.549) [-509.514] (-511.390) * (-510.674) [-508.576] (-513.513) (-512.580) -- 0:00:16
736000 -- [-510.442] (-513.607) (-508.977) (-511.773) * [-513.254] (-513.917) (-511.509) (-510.895) -- 0:00:16
736500 -- (-509.883) (-510.840) (-509.382) [-511.134] * [-510.164] (-511.618) (-511.410) (-510.664) -- 0:00:16
737000 -- (-509.751) [-509.226] (-512.172) (-508.392) * (-512.027) [-509.029] (-509.471) (-512.347) -- 0:00:16
737500 -- (-511.027) [-510.322] (-511.492) (-508.467) * (-511.470) (-508.831) [-511.730] (-514.743) -- 0:00:16
738000 -- (-511.110) [-513.100] (-508.807) (-512.648) * [-509.768] (-509.809) (-510.168) (-510.503) -- 0:00:15
738500 -- (-512.161) (-509.158) (-510.935) [-514.085] * [-511.100] (-509.003) (-509.836) (-514.011) -- 0:00:15
739000 -- (-509.090) [-509.724] (-511.946) (-510.541) * [-513.603] (-509.490) (-510.251) (-511.079) -- 0:00:15
739500 -- (-510.897) (-509.233) (-509.716) [-511.510] * (-512.155) [-509.524] (-509.340) (-511.478) -- 0:00:15
740000 -- [-511.659] (-510.339) (-510.826) (-512.865) * (-510.661) [-513.117] (-511.927) (-512.638) -- 0:00:15
Average standard deviation of split frequencies: 0.006086
740500 -- (-514.307) [-510.160] (-515.158) (-512.437) * (-509.272) [-511.071] (-510.812) (-513.448) -- 0:00:15
741000 -- (-509.867) (-511.938) (-510.561) [-511.012] * (-511.300) (-511.534) [-509.492] (-509.549) -- 0:00:15
741500 -- (-509.971) (-511.846) [-508.657] (-509.344) * (-510.220) [-509.405] (-509.724) (-511.327) -- 0:00:15
742000 -- [-509.067] (-509.473) (-514.189) (-509.085) * [-510.056] (-509.708) (-510.527) (-510.675) -- 0:00:15
742500 -- (-510.817) [-510.152] (-515.425) (-509.152) * (-509.767) (-509.452) (-509.388) [-509.609] -- 0:00:15
743000 -- (-512.492) [-508.409] (-510.566) (-508.981) * (-510.879) [-509.887] (-508.503) (-511.606) -- 0:00:15
743500 -- (-512.767) (-510.452) (-510.070) [-513.459] * (-510.107) (-510.174) (-509.918) [-511.618] -- 0:00:15
744000 -- (-512.720) [-511.294] (-509.035) (-509.625) * (-512.177) [-512.361] (-513.610) (-510.590) -- 0:00:15
744500 -- [-508.312] (-509.126) (-511.660) (-509.189) * (-510.803) (-511.537) (-510.848) [-511.355] -- 0:00:15
745000 -- [-509.983] (-509.284) (-509.515) (-510.211) * (-510.443) (-510.749) [-508.729] (-508.783) -- 0:00:15
Average standard deviation of split frequencies: 0.006043
745500 -- (-512.412) [-516.151] (-509.967) (-510.614) * (-510.290) (-513.244) [-511.440] (-511.352) -- 0:00:15
746000 -- (-512.835) [-510.875] (-510.175) (-510.538) * (-511.174) (-512.056) (-510.167) [-509.850] -- 0:00:15
746500 -- (-509.841) (-509.846) [-510.541] (-513.267) * (-510.257) [-509.272] (-509.418) (-512.234) -- 0:00:15
747000 -- (-509.370) [-512.352] (-509.603) (-509.339) * [-511.829] (-509.267) (-511.695) (-510.779) -- 0:00:15
747500 -- [-511.887] (-512.444) (-513.569) (-509.035) * (-512.270) (-511.888) [-511.018] (-514.378) -- 0:00:15
748000 -- (-511.215) (-511.398) [-508.857] (-509.137) * [-512.391] (-510.652) (-511.842) (-514.022) -- 0:00:15
748500 -- (-509.376) [-509.843] (-510.191) (-510.045) * (-514.624) (-508.558) [-511.047] (-509.883) -- 0:00:15
749000 -- (-512.794) [-509.358] (-510.184) (-513.628) * (-514.451) (-509.363) (-515.771) [-510.032] -- 0:00:15
749500 -- (-511.087) (-512.006) [-509.679] (-512.344) * [-510.112] (-508.616) (-510.437) (-509.258) -- 0:00:15
750000 -- (-508.439) [-509.987] (-512.142) (-515.302) * (-509.216) [-509.767] (-510.592) (-514.912) -- 0:00:15
Average standard deviation of split frequencies: 0.006162
750500 -- (-508.814) (-510.317) [-512.610] (-512.410) * [-509.095] (-510.143) (-510.571) (-511.775) -- 0:00:15
751000 -- (-509.431) (-510.624) (-510.497) [-508.313] * (-508.909) (-515.583) [-509.246] (-514.202) -- 0:00:15
751500 -- (-509.612) (-512.630) [-509.727] (-510.736) * (-509.842) (-509.085) [-510.363] (-511.666) -- 0:00:15
752000 -- (-513.018) (-510.015) [-510.861] (-511.580) * (-508.929) (-509.676) (-509.186) [-511.812] -- 0:00:15
752500 -- [-509.279] (-510.357) (-510.497) (-508.617) * (-511.178) [-511.143] (-511.613) (-510.474) -- 0:00:15
753000 -- (-511.371) [-510.113] (-512.133) (-508.783) * (-511.876) (-509.098) (-510.884) [-509.344] -- 0:00:15
753500 -- (-509.508) (-510.746) (-510.961) [-512.092] * (-509.356) (-511.632) (-510.306) [-508.556] -- 0:00:15
754000 -- [-509.693] (-508.466) (-512.992) (-513.990) * (-509.676) (-510.000) [-510.386] (-510.052) -- 0:00:15
754500 -- (-508.520) [-511.094] (-511.193) (-509.863) * [-510.004] (-511.696) (-510.670) (-510.790) -- 0:00:14
755000 -- (-510.509) (-511.303) [-509.853] (-509.242) * (-509.210) [-510.471] (-509.004) (-508.940) -- 0:00:14
Average standard deviation of split frequencies: 0.005487
755500 -- (-514.145) (-510.142) (-512.481) [-508.842] * (-509.629) (-508.796) [-510.672] (-511.457) -- 0:00:14
756000 -- (-511.376) [-513.466] (-510.855) (-508.919) * (-510.044) (-514.161) (-511.119) [-513.295] -- 0:00:14
756500 -- (-510.079) (-512.249) [-509.516] (-510.891) * (-512.142) [-510.342] (-509.570) (-511.572) -- 0:00:14
757000 -- [-509.396] (-513.312) (-512.151) (-510.727) * [-514.306] (-508.884) (-510.070) (-509.100) -- 0:00:14
757500 -- (-511.689) (-509.722) (-510.403) [-513.073] * (-513.549) (-511.136) [-509.718] (-509.943) -- 0:00:14
758000 -- (-509.833) [-509.791] (-510.293) (-509.058) * [-511.617] (-509.957) (-512.368) (-513.990) -- 0:00:14
758500 -- (-513.749) (-510.274) [-508.662] (-508.671) * (-512.430) (-508.375) [-509.644] (-516.076) -- 0:00:14
759000 -- (-509.356) (-512.351) [-508.617] (-508.751) * (-509.182) (-511.319) (-510.861) [-509.291] -- 0:00:14
759500 -- (-509.516) (-510.203) [-509.545] (-511.054) * (-509.773) (-511.163) (-512.433) [-511.252] -- 0:00:14
760000 -- (-511.379) (-509.048) [-511.080] (-509.738) * [-508.731] (-509.690) (-509.132) (-510.842) -- 0:00:14
Average standard deviation of split frequencies: 0.005371
760500 -- (-508.801) (-512.141) (-511.867) [-508.920] * (-510.110) [-509.085] (-514.040) (-509.399) -- 0:00:14
761000 -- (-508.109) [-510.605] (-508.808) (-510.805) * (-510.859) (-508.727) [-512.159] (-510.562) -- 0:00:14
761500 -- (-510.811) [-510.844] (-513.931) (-509.369) * (-512.240) (-508.626) (-512.594) [-508.790] -- 0:00:14
762000 -- (-510.535) [-510.022] (-511.686) (-509.658) * (-511.821) (-511.446) [-510.019] (-511.297) -- 0:00:14
762500 -- (-508.723) (-510.115) (-511.251) [-510.485] * (-514.207) (-510.027) [-509.189] (-508.813) -- 0:00:14
763000 -- (-516.176) (-511.260) (-510.585) [-512.035] * (-510.106) [-510.109] (-511.770) (-512.124) -- 0:00:14
763500 -- (-509.718) [-508.375] (-510.183) (-510.615) * (-511.339) (-509.077) [-512.766] (-511.165) -- 0:00:14
764000 -- [-510.001] (-508.288) (-511.620) (-511.373) * (-509.809) [-509.628] (-516.985) (-511.864) -- 0:00:14
764500 -- [-513.550] (-511.731) (-513.966) (-510.744) * (-509.639) [-510.527] (-508.770) (-509.528) -- 0:00:14
765000 -- [-511.198] (-510.484) (-512.259) (-509.907) * (-509.600) [-509.632] (-509.134) (-509.774) -- 0:00:14
Average standard deviation of split frequencies: 0.005046
765500 -- (-509.121) [-509.319] (-511.270) (-511.214) * [-509.722] (-508.740) (-509.825) (-508.476) -- 0:00:14
766000 -- [-508.922] (-510.269) (-512.401) (-513.332) * [-510.216] (-509.478) (-511.567) (-510.515) -- 0:00:14
766500 -- (-510.487) (-508.762) (-510.744) [-513.762] * [-510.745] (-508.543) (-513.078) (-508.713) -- 0:00:14
767000 -- (-509.495) [-509.410] (-511.584) (-516.237) * (-510.288) (-508.311) (-510.197) [-508.946] -- 0:00:14
767500 -- (-511.459) (-509.693) (-511.883) [-510.188] * (-510.684) [-511.689] (-515.352) (-509.157) -- 0:00:14
768000 -- (-512.491) (-508.756) (-509.067) [-510.209] * [-508.148] (-515.103) (-513.739) (-509.771) -- 0:00:14
768500 -- (-511.073) (-512.815) [-509.858] (-508.989) * (-511.559) [-512.513] (-516.076) (-509.162) -- 0:00:14
769000 -- [-510.157] (-512.240) (-511.045) (-511.252) * (-510.187) (-510.216) (-511.840) [-508.893] -- 0:00:14
769500 -- (-508.645) (-511.149) (-511.987) [-510.409] * (-509.809) (-510.367) [-515.731] (-509.888) -- 0:00:14
770000 -- (-509.600) (-508.920) [-510.874] (-510.741) * (-509.813) [-509.385] (-511.818) (-509.915) -- 0:00:14
Average standard deviation of split frequencies: 0.005220
770500 -- (-509.931) (-511.131) [-513.785] (-509.296) * [-509.992] (-509.046) (-509.743) (-508.884) -- 0:00:13
771000 -- (-510.468) (-511.450) (-511.315) [-512.904] * [-510.253] (-511.877) (-509.916) (-510.026) -- 0:00:13
771500 -- (-510.187) (-512.842) [-510.479] (-513.193) * (-508.779) (-512.690) (-509.104) [-508.185] -- 0:00:13
772000 -- (-509.880) [-509.524] (-509.013) (-509.158) * (-509.869) (-510.745) [-510.727] (-509.107) -- 0:00:13
772500 -- (-509.588) (-510.685) [-513.147] (-510.157) * (-509.982) (-509.390) (-508.117) [-510.311] -- 0:00:13
773000 -- [-511.572] (-510.777) (-514.229) (-510.413) * [-509.674] (-511.114) (-509.058) (-510.046) -- 0:00:13
773500 -- (-510.809) (-515.745) [-509.772] (-511.287) * (-510.147) [-508.814] (-509.756) (-509.178) -- 0:00:13
774000 -- [-512.209] (-511.876) (-511.117) (-510.042) * (-510.610) (-512.799) (-511.345) [-509.256] -- 0:00:13
774500 -- (-511.752) (-509.636) (-512.857) [-509.033] * (-511.214) [-508.639] (-508.347) (-508.701) -- 0:00:13
775000 -- (-510.163) (-510.559) (-512.051) [-510.896] * (-510.765) [-508.949] (-509.395) (-515.180) -- 0:00:13
Average standard deviation of split frequencies: 0.005589
775500 -- (-509.035) [-511.689] (-514.029) (-512.778) * (-511.548) (-510.039) (-510.272) [-509.990] -- 0:00:13
776000 -- [-510.077] (-511.147) (-513.338) (-510.006) * (-513.758) [-510.233] (-510.584) (-509.192) -- 0:00:13
776500 -- (-510.723) (-511.304) [-508.556] (-509.952) * [-510.850] (-512.082) (-511.579) (-510.695) -- 0:00:13
777000 -- (-514.309) [-511.179] (-508.190) (-514.825) * (-511.550) [-509.153] (-509.943) (-508.605) -- 0:00:13
777500 -- (-508.903) (-509.638) [-508.199] (-508.987) * (-511.747) [-511.208] (-508.027) (-508.300) -- 0:00:13
778000 -- (-510.356) (-512.703) (-512.668) [-509.913] * (-510.478) [-514.195] (-509.393) (-509.293) -- 0:00:13
778500 -- [-509.655] (-518.226) (-511.187) (-514.008) * (-509.977) (-512.563) (-518.498) [-511.679] -- 0:00:13
779000 -- (-510.182) (-512.672) (-515.098) [-511.616] * [-508.613] (-510.642) (-511.496) (-511.478) -- 0:00:13
779500 -- (-510.348) (-513.638) (-512.322) [-508.453] * (-510.726) [-510.558] (-514.921) (-511.249) -- 0:00:13
780000 -- (-510.218) (-510.973) (-509.349) [-511.070] * [-514.583] (-510.558) (-513.490) (-510.908) -- 0:00:13
Average standard deviation of split frequencies: 0.006038
780500 -- (-509.871) (-510.052) (-508.797) [-510.161] * [-509.724] (-508.926) (-513.213) (-509.383) -- 0:00:13
781000 -- (-508.335) [-512.158] (-510.833) (-511.566) * [-514.559] (-510.903) (-511.187) (-509.146) -- 0:00:13
781500 -- [-508.246] (-512.145) (-512.411) (-513.113) * (-511.011) (-511.163) (-511.532) [-511.366] -- 0:00:13
782000 -- (-509.113) (-508.800) [-509.048] (-508.934) * (-511.107) [-510.162] (-510.264) (-510.835) -- 0:00:13
782500 -- (-511.853) (-512.457) (-511.181) [-509.604] * (-509.145) [-509.417] (-510.721) (-514.009) -- 0:00:13
783000 -- (-509.648) (-508.741) (-512.705) [-510.991] * (-508.671) (-508.398) [-512.476] (-509.861) -- 0:00:13
783500 -- [-512.548] (-508.289) (-512.126) (-508.997) * [-509.517] (-509.289) (-511.851) (-512.242) -- 0:00:13
784000 -- (-510.792) (-508.295) (-513.985) [-510.179] * (-512.492) [-510.457] (-510.718) (-512.051) -- 0:00:13
784500 -- (-510.860) (-511.853) (-511.424) [-510.245] * (-509.627) (-509.439) [-512.844] (-510.780) -- 0:00:13
785000 -- (-509.795) (-510.610) (-508.527) [-511.302] * (-509.532) (-509.037) [-509.509] (-509.722) -- 0:00:13
Average standard deviation of split frequencies: 0.006077
785500 -- (-509.084) (-510.262) [-510.708] (-510.665) * (-510.154) (-511.506) [-509.181] (-510.145) -- 0:00:13
786000 -- (-509.619) (-510.946) (-511.686) [-511.513] * (-510.559) (-511.173) [-510.930] (-511.364) -- 0:00:13
786500 -- [-508.579] (-512.004) (-512.556) (-511.180) * [-509.989] (-513.058) (-508.977) (-514.567) -- 0:00:13
787000 -- (-509.561) (-511.981) (-512.206) [-511.565] * (-509.922) (-509.867) (-509.336) [-517.108] -- 0:00:12
787500 -- (-509.096) (-508.948) (-518.319) [-511.715] * (-508.664) [-511.128] (-509.052) (-510.331) -- 0:00:12
788000 -- (-509.318) (-511.780) [-508.256] (-509.467) * (-509.460) (-509.256) (-508.690) [-509.531] -- 0:00:12
788500 -- (-508.608) (-510.238) (-511.194) [-509.817] * (-509.316) (-514.421) (-509.323) [-513.195] -- 0:00:12
789000 -- (-511.423) [-511.212] (-513.902) (-510.326) * (-513.637) [-510.190] (-509.246) (-513.407) -- 0:00:12
789500 -- (-510.404) (-512.463) (-511.452) [-508.556] * (-512.074) [-509.430] (-509.085) (-511.006) -- 0:00:12
790000 -- (-509.598) (-510.890) (-510.896) [-509.783] * [-508.737] (-509.459) (-511.426) (-510.885) -- 0:00:12
Average standard deviation of split frequencies: 0.005763
790500 -- (-513.638) (-510.134) (-516.051) [-515.716] * (-511.347) (-509.781) [-510.858] (-509.583) -- 0:00:12
791000 -- (-509.769) [-512.125] (-509.719) (-509.107) * (-509.662) [-510.693] (-510.365) (-514.765) -- 0:00:12
791500 -- [-512.805] (-511.576) (-508.794) (-510.569) * [-509.245] (-509.613) (-510.903) (-509.920) -- 0:00:12
792000 -- (-510.870) [-508.991] (-509.220) (-509.656) * [-509.347] (-510.967) (-510.835) (-513.143) -- 0:00:12
792500 -- (-510.467) (-510.622) [-510.195] (-512.117) * [-509.215] (-509.509) (-509.164) (-509.455) -- 0:00:12
793000 -- (-515.133) (-508.539) [-510.115] (-509.823) * (-508.879) [-509.587] (-509.724) (-511.850) -- 0:00:12
793500 -- (-510.181) [-511.785] (-509.741) (-510.980) * (-510.944) (-508.529) [-510.296] (-508.855) -- 0:00:12
794000 -- (-510.518) [-509.008] (-512.563) (-513.151) * (-510.204) (-508.526) (-510.214) [-508.296] -- 0:00:12
794500 -- [-511.390] (-510.960) (-513.778) (-510.256) * [-511.214] (-509.925) (-512.165) (-508.993) -- 0:00:12
795000 -- [-514.313] (-512.460) (-511.751) (-510.673) * (-510.681) (-513.258) [-508.282] (-509.015) -- 0:00:12
Average standard deviation of split frequencies: 0.005764
795500 -- (-508.500) (-513.338) (-509.552) [-508.138] * (-513.526) [-509.733] (-509.995) (-509.243) -- 0:00:12
796000 -- (-509.129) [-509.001] (-510.160) (-513.865) * (-513.875) [-512.877] (-512.189) (-509.253) -- 0:00:12
796500 -- [-512.715] (-510.259) (-511.277) (-513.008) * (-510.783) (-508.517) [-511.510] (-509.251) -- 0:00:12
797000 -- (-511.374) (-513.155) [-510.978] (-510.869) * [-509.311] (-510.509) (-512.755) (-509.816) -- 0:00:12
797500 -- (-514.529) (-509.083) (-511.963) [-509.446] * (-509.499) (-509.418) (-514.785) [-509.268] -- 0:00:12
798000 -- (-511.548) (-512.566) [-512.564] (-510.744) * [-510.953] (-510.106) (-514.999) (-510.046) -- 0:00:12
798500 -- (-513.484) (-509.157) [-512.796] (-509.262) * (-511.517) (-512.069) (-516.128) [-509.687] -- 0:00:12
799000 -- (-518.041) [-509.786] (-512.851) (-510.596) * (-512.933) (-513.309) (-512.103) [-508.248] -- 0:00:12
799500 -- (-512.331) [-509.849] (-509.426) (-514.277) * (-513.438) (-510.134) [-510.361] (-513.547) -- 0:00:12
800000 -- (-515.381) (-508.597) (-511.332) [-514.979] * [-513.081] (-510.145) (-511.114) (-509.747) -- 0:00:12
Average standard deviation of split frequencies: 0.005809
800500 -- (-513.133) [-510.180] (-512.362) (-511.492) * (-514.720) (-509.615) [-511.823] (-511.656) -- 0:00:12
801000 -- (-510.499) (-510.772) [-511.154] (-509.911) * (-510.353) (-509.396) [-511.592] (-509.832) -- 0:00:12
801500 -- (-513.478) [-510.660] (-510.429) (-517.357) * [-509.375] (-510.686) (-512.236) (-512.685) -- 0:00:12
802000 -- (-509.146) [-514.204] (-509.293) (-511.000) * (-512.742) (-510.848) [-509.849] (-509.573) -- 0:00:12
802500 -- (-508.477) (-509.223) (-510.117) [-512.046] * (-510.570) (-510.557) [-510.336] (-509.745) -- 0:00:12
803000 -- (-510.937) (-514.067) [-508.392] (-511.838) * (-510.475) [-510.994] (-510.278) (-514.138) -- 0:00:12
803500 -- [-511.671] (-509.491) (-508.337) (-512.215) * (-513.202) (-510.285) (-512.066) [-512.408] -- 0:00:11
804000 -- (-509.457) (-512.370) [-509.049] (-509.889) * [-509.744] (-512.924) (-513.176) (-510.102) -- 0:00:11
804500 -- [-510.622] (-509.893) (-508.359) (-511.275) * (-508.791) (-513.818) (-510.851) [-510.219] -- 0:00:11
805000 -- (-509.942) [-510.882] (-508.325) (-510.566) * (-512.065) (-513.805) [-509.432] (-509.769) -- 0:00:11
Average standard deviation of split frequencies: 0.005966
805500 -- [-509.150] (-509.894) (-510.174) (-511.819) * (-508.827) [-509.393] (-510.530) (-509.530) -- 0:00:11
806000 -- [-509.147] (-511.398) (-510.656) (-511.493) * (-510.320) (-509.244) (-516.031) [-514.029] -- 0:00:11
806500 -- (-511.181) (-511.261) (-509.961) [-510.994] * [-508.941] (-512.531) (-512.032) (-512.507) -- 0:00:11
807000 -- (-511.702) (-509.154) (-509.313) [-508.903] * (-510.493) (-515.239) (-514.329) [-510.344] -- 0:00:11
807500 -- [-512.946] (-511.021) (-511.286) (-510.673) * (-509.962) (-508.561) [-512.725] (-511.385) -- 0:00:11
808000 -- (-513.795) [-508.734] (-512.336) (-508.901) * (-509.509) (-509.655) (-508.284) [-510.022] -- 0:00:11
808500 -- (-513.693) (-510.552) [-510.477] (-512.497) * [-510.139] (-509.985) (-508.602) (-510.999) -- 0:00:11
809000 -- (-510.013) (-514.651) [-509.436] (-509.608) * (-509.024) (-510.234) (-508.548) [-508.849] -- 0:00:11
809500 -- (-513.812) (-519.599) [-510.552] (-510.597) * [-509.515] (-508.819) (-509.604) (-509.634) -- 0:00:11
810000 -- [-510.411] (-518.965) (-511.497) (-509.017) * [-508.211] (-510.534) (-509.821) (-508.500) -- 0:00:11
Average standard deviation of split frequencies: 0.005737
810500 -- (-508.742) [-508.973] (-510.063) (-510.169) * [-509.744] (-512.376) (-509.840) (-508.350) -- 0:00:11
811000 -- (-508.473) (-508.974) [-510.177] (-510.299) * (-508.977) (-509.946) [-509.416] (-509.924) -- 0:00:11
811500 -- (-510.151) (-509.310) [-509.496] (-510.890) * (-508.893) [-512.933] (-508.699) (-510.640) -- 0:00:11
812000 -- (-515.565) (-515.583) (-509.784) [-508.349] * [-511.279] (-509.532) (-510.625) (-511.774) -- 0:00:11
812500 -- (-512.230) (-508.747) [-509.360] (-510.151) * (-510.527) (-510.558) [-508.369] (-512.661) -- 0:00:11
813000 -- (-509.079) [-508.782] (-511.657) (-510.869) * (-515.298) (-510.513) (-509.201) [-509.143] -- 0:00:11
813500 -- (-513.479) [-517.054] (-509.036) (-510.150) * (-514.131) (-511.549) (-508.825) [-510.068] -- 0:00:11
814000 -- (-509.573) (-509.147) (-509.516) [-515.310] * (-513.792) [-510.474] (-511.812) (-509.891) -- 0:00:11
814500 -- (-509.663) [-509.214] (-509.356) (-510.415) * (-514.659) (-511.721) (-511.607) [-508.876] -- 0:00:11
815000 -- (-508.601) (-509.448) (-509.683) [-509.696] * (-508.312) (-509.000) [-512.267] (-508.966) -- 0:00:11
Average standard deviation of split frequencies: 0.005931
815500 -- (-508.526) (-513.411) (-509.171) [-510.080] * (-512.955) (-509.655) (-513.521) [-511.347] -- 0:00:11
816000 -- [-512.647] (-512.028) (-511.579) (-511.398) * (-510.281) (-509.105) [-509.176] (-509.420) -- 0:00:11
816500 -- [-510.700] (-509.078) (-509.682) (-513.472) * (-511.689) (-509.353) (-515.946) [-508.938] -- 0:00:11
817000 -- (-510.127) (-509.344) [-510.191] (-514.851) * (-512.031) (-511.067) (-514.278) [-511.025] -- 0:00:11
817500 -- [-509.093] (-509.898) (-508.959) (-516.550) * [-512.091] (-508.996) (-510.041) (-513.372) -- 0:00:11
818000 -- (-509.956) [-512.742] (-509.830) (-512.254) * (-509.641) (-510.592) (-514.325) [-509.639] -- 0:00:11
818500 -- (-508.905) (-511.750) (-511.329) [-516.023] * (-514.467) (-509.431) [-509.956] (-511.583) -- 0:00:11
819000 -- (-515.745) (-512.749) (-511.718) [-510.377] * (-512.253) [-508.388] (-514.584) (-511.804) -- 0:00:11
819500 -- [-510.056] (-514.323) (-510.241) (-508.573) * (-511.535) (-509.903) (-508.298) [-509.261] -- 0:00:11
820000 -- (-512.433) (-509.839) [-508.789] (-509.073) * (-510.269) [-511.338] (-511.738) (-510.574) -- 0:00:10
Average standard deviation of split frequencies: 0.005323
820500 -- (-511.477) [-509.253] (-511.129) (-509.147) * (-510.837) (-509.292) (-512.551) [-509.017] -- 0:00:10
821000 -- [-511.371] (-509.843) (-509.561) (-510.698) * (-510.057) (-509.988) [-509.705] (-512.922) -- 0:00:10
821500 -- (-510.660) (-512.716) (-510.724) [-514.073] * (-509.804) (-510.222) [-509.221] (-511.815) -- 0:00:10
822000 -- (-511.671) [-511.076] (-508.492) (-508.266) * [-511.261] (-510.134) (-509.277) (-509.735) -- 0:00:10
822500 -- (-510.369) (-513.287) (-510.732) [-509.134] * (-510.958) (-510.155) (-508.602) [-509.347] -- 0:00:10
823000 -- (-511.466) (-511.047) (-510.545) [-508.170] * [-509.973] (-510.885) (-511.968) (-516.885) -- 0:00:10
823500 -- (-510.599) (-511.892) (-509.695) [-508.740] * [-510.702] (-511.131) (-515.603) (-508.355) -- 0:00:10
824000 -- [-510.018] (-511.246) (-510.782) (-513.314) * [-512.229] (-509.273) (-511.081) (-509.722) -- 0:00:10
824500 -- [-508.831] (-510.048) (-515.051) (-509.682) * (-509.809) (-508.281) [-510.250] (-513.745) -- 0:00:10
825000 -- (-511.024) (-509.242) [-510.366] (-510.474) * (-509.259) (-511.522) [-511.186] (-511.452) -- 0:00:10
Average standard deviation of split frequencies: 0.005212
825500 -- (-513.887) (-512.874) [-509.415] (-513.229) * (-509.898) (-511.572) [-509.534] (-509.575) -- 0:00:10
826000 -- [-508.505] (-509.681) (-512.318) (-510.658) * [-509.348] (-509.510) (-510.686) (-511.111) -- 0:00:10
826500 -- (-510.016) [-508.249] (-511.889) (-514.674) * [-510.110] (-509.013) (-510.632) (-509.201) -- 0:00:10
827000 -- (-509.778) (-510.153) (-511.059) [-512.768] * [-512.834] (-511.834) (-511.525) (-510.420) -- 0:00:10
827500 -- (-509.672) [-509.877] (-509.307) (-513.158) * (-510.647) (-514.167) (-509.204) [-513.142] -- 0:00:10
828000 -- (-511.579) (-512.917) [-510.606] (-509.586) * [-508.421] (-511.134) (-510.653) (-514.685) -- 0:00:10
828500 -- [-511.268] (-511.192) (-511.462) (-512.701) * (-511.468) (-513.989) (-509.717) [-513.495] -- 0:00:10
829000 -- (-510.057) [-512.610] (-509.990) (-511.603) * (-516.651) (-510.701) [-510.734] (-510.247) -- 0:00:10
829500 -- (-521.393) [-512.218] (-509.251) (-510.996) * (-513.671) (-510.830) (-512.255) [-508.850] -- 0:00:10
830000 -- (-511.954) (-508.805) (-512.129) [-511.553] * (-510.620) [-510.480] (-509.235) (-510.431) -- 0:00:10
Average standard deviation of split frequencies: 0.004691
830500 -- (-510.902) (-510.361) [-508.647] (-510.089) * (-510.673) [-508.697] (-509.085) (-511.883) -- 0:00:10
831000 -- [-509.896] (-513.317) (-511.742) (-509.194) * (-508.654) (-508.147) [-508.788] (-508.764) -- 0:00:10
831500 -- (-509.844) (-514.852) (-511.059) [-509.203] * [-513.079] (-510.815) (-509.117) (-511.471) -- 0:00:10
832000 -- [-509.179] (-508.853) (-510.589) (-510.537) * [-509.000] (-511.033) (-509.923) (-512.029) -- 0:00:10
832500 -- (-508.750) (-508.781) [-509.371] (-511.481) * (-512.262) [-509.496] (-509.627) (-510.248) -- 0:00:10
833000 -- (-509.482) [-510.176] (-510.631) (-508.629) * (-511.419) (-509.947) (-512.372) [-510.089] -- 0:00:10
833500 -- (-508.645) (-510.443) (-510.055) [-511.292] * [-508.910] (-511.000) (-510.860) (-509.241) -- 0:00:10
834000 -- [-511.179] (-509.895) (-509.810) (-509.398) * (-512.398) [-512.314] (-510.696) (-510.403) -- 0:00:10
834500 -- [-508.883] (-510.189) (-511.723) (-508.872) * (-510.960) (-512.640) [-508.984] (-510.395) -- 0:00:10
835000 -- (-509.059) [-509.942] (-513.205) (-509.848) * [-509.787] (-511.749) (-509.916) (-509.127) -- 0:00:10
Average standard deviation of split frequencies: 0.005000
835500 -- (-508.674) (-513.140) (-508.979) [-509.469] * [-510.519] (-511.967) (-508.839) (-510.451) -- 0:00:10
836000 -- [-509.164] (-511.124) (-510.623) (-509.963) * (-512.444) (-511.929) (-510.648) [-511.658] -- 0:00:10
836500 -- (-509.367) (-509.245) (-509.956) [-508.827] * (-508.537) (-508.046) (-511.507) [-510.793] -- 0:00:09
837000 -- (-511.477) (-509.009) (-512.700) [-509.125] * (-508.427) (-509.721) (-515.901) [-513.343] -- 0:00:09
837500 -- [-515.249] (-510.117) (-509.484) (-512.498) * (-511.665) [-509.846] (-511.069) (-512.090) -- 0:00:09
838000 -- (-509.790) (-511.837) (-509.810) [-510.901] * [-511.951] (-509.911) (-516.458) (-508.280) -- 0:00:09
838500 -- [-510.541] (-516.530) (-509.720) (-509.186) * [-510.504] (-510.744) (-510.086) (-508.446) -- 0:00:09
839000 -- (-509.309) (-510.296) [-508.409] (-512.379) * (-510.514) (-509.061) (-509.940) [-510.828] -- 0:00:09
839500 -- (-511.864) [-509.022] (-508.548) (-512.308) * (-510.104) (-511.865) (-518.404) [-509.504] -- 0:00:09
840000 -- [-509.958] (-513.158) (-512.819) (-512.410) * [-509.599] (-510.629) (-511.761) (-510.464) -- 0:00:09
Average standard deviation of split frequencies: 0.005047
840500 -- (-509.384) [-512.288] (-509.307) (-509.720) * [-509.705] (-509.378) (-509.097) (-511.003) -- 0:00:09
841000 -- [-511.379] (-509.900) (-509.840) (-510.214) * (-514.552) (-509.394) (-508.928) [-511.410] -- 0:00:09
841500 -- (-509.219) (-509.727) [-510.692] (-512.916) * (-511.710) (-508.894) (-509.013) [-513.021] -- 0:00:09
842000 -- (-509.798) [-510.044] (-510.924) (-512.759) * [-511.182] (-510.166) (-517.321) (-508.493) -- 0:00:09
842500 -- (-509.196) [-510.410] (-510.286) (-509.218) * (-512.040) [-509.560] (-512.891) (-510.122) -- 0:00:09
843000 -- [-510.543] (-510.560) (-509.909) (-509.566) * (-509.697) [-510.901] (-509.631) (-510.724) -- 0:00:09
843500 -- (-511.023) (-511.743) (-513.172) [-509.254] * [-512.803] (-513.155) (-508.835) (-510.008) -- 0:00:09
844000 -- (-509.141) (-510.305) [-515.735] (-510.367) * (-510.191) (-512.075) (-510.813) [-510.300] -- 0:00:09
844500 -- (-508.715) [-509.544] (-511.246) (-510.999) * (-511.148) [-510.593] (-512.400) (-510.722) -- 0:00:09
845000 -- [-508.716] (-510.956) (-511.550) (-513.790) * (-510.251) (-511.840) (-510.020) [-508.959] -- 0:00:09
Average standard deviation of split frequencies: 0.004532
845500 -- [-509.342] (-510.175) (-512.675) (-511.451) * (-509.837) (-509.113) [-511.845] (-511.908) -- 0:00:09
846000 -- (-509.321) [-509.154] (-512.341) (-511.363) * (-510.147) (-511.817) (-511.963) [-509.800] -- 0:00:09
846500 -- (-513.792) (-512.972) [-510.129] (-508.995) * [-509.127] (-510.192) (-509.346) (-509.579) -- 0:00:09
847000 -- (-509.624) (-515.031) (-508.551) [-509.822] * (-510.842) (-513.261) (-511.234) [-511.167] -- 0:00:09
847500 -- (-509.161) [-511.063] (-509.065) (-511.101) * (-509.795) [-512.365] (-514.924) (-509.536) -- 0:00:09
848000 -- (-508.600) (-510.807) (-513.127) [-508.768] * (-514.108) (-510.411) [-510.913] (-512.991) -- 0:00:09
848500 -- (-510.967) (-510.879) (-509.715) [-509.322] * (-510.112) (-508.929) (-510.001) [-512.024] -- 0:00:09
849000 -- (-509.342) (-513.809) [-511.922] (-509.173) * [-512.053] (-513.239) (-508.801) (-514.418) -- 0:00:09
849500 -- [-512.949] (-511.343) (-514.296) (-510.004) * (-509.872) (-514.875) [-512.612] (-510.534) -- 0:00:09
850000 -- (-509.582) [-509.751] (-514.495) (-509.932) * (-509.150) [-509.843] (-510.756) (-514.457) -- 0:00:09
Average standard deviation of split frequencies: 0.004618
850500 -- [-510.479] (-514.437) (-516.719) (-515.525) * [-508.336] (-509.689) (-514.504) (-511.118) -- 0:00:09
851000 -- (-512.831) (-513.321) (-512.068) [-509.276] * (-512.235) (-508.659) [-513.354] (-512.111) -- 0:00:09
851500 -- (-509.553) (-510.841) (-515.424) [-509.793] * (-510.713) [-510.415] (-513.666) (-513.048) -- 0:00:09
852000 -- (-509.308) (-510.397) [-508.387] (-512.234) * (-511.379) [-511.715] (-510.813) (-510.375) -- 0:00:09
852500 -- [-508.477] (-512.150) (-510.359) (-512.483) * (-509.412) [-510.641] (-514.076) (-509.570) -- 0:00:08
853000 -- (-508.870) (-511.403) (-510.937) [-510.635] * (-509.808) (-510.934) (-509.439) [-508.750] -- 0:00:08
853500 -- (-508.488) [-510.279] (-510.292) (-510.884) * (-509.763) [-510.564] (-511.123) (-509.190) -- 0:00:08
854000 -- [-509.473] (-509.128) (-514.476) (-509.598) * (-509.782) (-510.193) [-513.112] (-509.489) -- 0:00:08
854500 -- (-513.277) [-510.866] (-511.389) (-509.616) * (-515.305) (-515.002) (-509.862) [-511.968] -- 0:00:08
855000 -- [-515.157] (-509.476) (-510.104) (-513.214) * [-509.828] (-513.527) (-508.503) (-509.084) -- 0:00:08
Average standard deviation of split frequencies: 0.004846
855500 -- (-509.802) [-510.113] (-511.108) (-509.626) * (-511.756) [-511.562] (-510.818) (-510.629) -- 0:00:08
856000 -- [-510.719] (-509.319) (-509.879) (-511.141) * (-512.397) (-511.224) (-513.296) [-512.965] -- 0:00:08
856500 -- (-515.158) [-510.789] (-508.402) (-509.460) * (-511.341) (-509.923) [-510.516] (-511.820) -- 0:00:08
857000 -- (-512.864) (-510.076) (-509.133) [-509.341] * (-509.923) (-510.091) (-509.563) [-508.388] -- 0:00:08
857500 -- [-508.549] (-509.134) (-509.011) (-509.041) * [-510.684] (-512.086) (-511.109) (-508.972) -- 0:00:08
858000 -- (-510.811) (-511.647) (-508.881) [-508.375] * (-516.304) (-510.042) (-511.174) [-509.914] -- 0:00:08
858500 -- (-508.557) (-510.590) (-508.790) [-510.109] * [-511.024] (-510.393) (-511.330) (-511.489) -- 0:00:08
859000 -- (-510.417) (-508.951) [-508.412] (-508.758) * (-509.166) (-510.183) (-508.068) [-509.991] -- 0:00:08
859500 -- [-508.950] (-510.112) (-508.642) (-512.435) * (-512.455) (-510.130) [-508.778] (-509.756) -- 0:00:08
860000 -- (-508.609) [-508.807] (-514.028) (-509.974) * [-510.262] (-512.748) (-513.899) (-509.826) -- 0:00:08
Average standard deviation of split frequencies: 0.004966
860500 -- [-508.668] (-509.922) (-511.618) (-509.199) * (-509.951) [-511.401] (-512.046) (-510.965) -- 0:00:08
861000 -- (-514.734) (-508.430) (-514.591) [-510.745] * (-510.807) [-511.854] (-508.477) (-511.131) -- 0:00:08
861500 -- [-513.419] (-509.541) (-522.290) (-512.228) * (-513.342) (-512.386) (-510.178) [-510.226] -- 0:00:08
862000 -- (-510.318) (-508.891) [-510.152] (-509.745) * [-508.436] (-511.463) (-508.936) (-509.822) -- 0:00:08
862500 -- (-508.762) (-510.516) (-509.206) [-510.923] * (-513.418) (-510.685) (-509.657) [-511.435] -- 0:00:08
863000 -- (-515.331) (-512.241) [-509.670] (-511.588) * [-511.569] (-510.977) (-510.405) (-510.591) -- 0:00:08
863500 -- (-511.945) [-509.044] (-511.086) (-511.023) * (-512.191) [-510.610] (-509.042) (-510.674) -- 0:00:08
864000 -- (-512.967) (-510.947) (-508.650) [-509.830] * (-512.612) (-510.026) [-508.793] (-509.980) -- 0:00:08
864500 -- [-511.033] (-511.340) (-510.687) (-510.242) * [-510.348] (-509.976) (-510.800) (-510.686) -- 0:00:08
865000 -- (-515.952) (-510.997) (-511.654) [-510.348] * (-510.604) (-509.392) (-513.001) [-509.032] -- 0:00:08
Average standard deviation of split frequencies: 0.004827
865500 -- [-512.071] (-511.479) (-512.619) (-509.374) * (-510.976) (-509.643) [-511.259] (-511.047) -- 0:00:08
866000 -- (-510.396) (-508.769) (-510.436) [-509.436] * (-510.518) [-512.815] (-511.151) (-510.645) -- 0:00:08
866500 -- [-511.730] (-510.927) (-512.363) (-515.203) * (-509.277) [-508.400] (-510.313) (-511.922) -- 0:00:08
867000 -- (-516.622) [-509.717] (-508.924) (-516.742) * [-510.122] (-513.248) (-512.026) (-511.656) -- 0:00:08
867500 -- (-514.384) [-510.951] (-509.460) (-510.943) * (-512.290) (-511.573) (-511.319) [-509.047] -- 0:00:08
868000 -- [-509.477] (-513.516) (-508.604) (-509.770) * [-510.327] (-511.124) (-509.297) (-512.606) -- 0:00:08
868500 -- (-508.927) (-516.719) [-508.825] (-509.134) * (-509.236) [-513.806] (-510.132) (-512.075) -- 0:00:08
869000 -- (-511.551) [-508.989] (-509.908) (-512.311) * (-509.947) [-510.803] (-513.574) (-513.018) -- 0:00:07
869500 -- (-510.674) [-510.446] (-509.849) (-510.752) * (-511.343) (-510.273) (-511.212) [-512.083] -- 0:00:07
870000 -- (-508.162) (-510.754) (-511.009) [-512.384] * (-508.486) [-509.672] (-510.659) (-510.199) -- 0:00:07
Average standard deviation of split frequencies: 0.004548
870500 -- (-508.926) (-511.720) (-509.354) [-511.507] * (-509.408) (-511.577) [-509.934] (-509.876) -- 0:00:07
871000 -- (-509.535) [-510.928] (-511.389) (-514.919) * (-510.746) [-508.671] (-509.698) (-511.563) -- 0:00:07
871500 -- [-509.503] (-510.810) (-512.151) (-509.110) * (-510.064) (-508.518) (-509.096) [-508.648] -- 0:00:07
872000 -- (-510.466) [-510.829] (-509.714) (-509.866) * (-511.315) (-508.703) [-509.375] (-508.834) -- 0:00:07
872500 -- (-509.597) (-512.714) [-511.161] (-511.853) * [-509.684] (-511.099) (-513.153) (-508.433) -- 0:00:07
873000 -- (-512.105) (-513.795) [-511.371] (-508.932) * (-510.012) [-509.485] (-511.126) (-515.604) -- 0:00:07
873500 -- (-510.496) [-510.692] (-510.110) (-510.853) * (-510.309) (-509.343) (-509.732) [-509.069] -- 0:00:07
874000 -- [-509.489] (-511.016) (-511.253) (-514.028) * (-510.683) (-512.482) (-508.830) [-508.686] -- 0:00:07
874500 -- (-513.514) [-509.409] (-514.720) (-512.621) * (-511.400) [-509.637] (-511.243) (-510.242) -- 0:00:07
875000 -- (-511.588) [-508.150] (-511.435) (-508.987) * (-511.166) [-509.438] (-511.383) (-510.128) -- 0:00:07
Average standard deviation of split frequencies: 0.004879
875500 -- (-510.307) (-512.068) [-511.365] (-509.864) * [-511.680] (-509.100) (-514.647) (-509.961) -- 0:00:07
876000 -- [-508.778] (-511.231) (-509.214) (-510.422) * (-511.105) [-509.046] (-510.566) (-509.736) -- 0:00:07
876500 -- (-509.225) (-510.338) (-508.603) [-510.016] * (-512.145) [-511.052] (-510.917) (-509.543) -- 0:00:07
877000 -- [-510.021] (-512.897) (-509.523) (-514.241) * (-509.797) [-510.000] (-510.719) (-511.510) -- 0:00:07
877500 -- (-509.249) (-513.166) [-511.021] (-510.865) * (-512.136) (-509.897) [-511.018] (-509.624) -- 0:00:07
878000 -- (-512.469) (-514.199) [-511.423] (-510.906) * (-509.052) (-510.960) (-511.260) [-510.543] -- 0:00:07
878500 -- [-509.426] (-509.447) (-513.724) (-509.658) * (-508.974) (-509.773) (-512.974) [-509.877] -- 0:00:07
879000 -- (-509.089) [-513.522] (-508.638) (-510.630) * [-514.924] (-509.572) (-513.389) (-509.284) -- 0:00:07
879500 -- [-510.694] (-514.432) (-508.441) (-510.688) * (-511.317) (-508.844) (-510.793) [-509.218] -- 0:00:07
880000 -- (-508.795) (-509.217) [-508.518] (-511.967) * (-510.237) (-508.714) [-510.400] (-512.470) -- 0:00:07
Average standard deviation of split frequencies: 0.004853
880500 -- (-510.757) [-509.858] (-509.298) (-509.918) * (-511.950) (-509.139) (-511.656) [-511.526] -- 0:00:07
881000 -- (-514.446) [-510.032] (-514.859) (-511.884) * (-509.612) (-509.604) (-510.907) [-516.757] -- 0:00:07
881500 -- (-513.760) (-513.183) [-509.791] (-512.825) * (-509.120) [-511.537] (-510.643) (-513.157) -- 0:00:07
882000 -- (-510.223) (-510.520) [-512.912] (-509.324) * (-511.109) (-509.740) (-513.390) [-512.197] -- 0:00:07
882500 -- (-510.117) [-511.278] (-511.708) (-509.778) * (-512.904) (-511.495) [-511.230] (-514.205) -- 0:00:07
883000 -- (-510.117) [-508.798] (-512.978) (-509.295) * [-511.104] (-511.665) (-511.669) (-510.468) -- 0:00:07
883500 -- [-509.750] (-508.863) (-509.929) (-509.639) * (-515.177) [-509.896] (-511.754) (-510.767) -- 0:00:07
884000 -- (-509.441) [-509.802] (-510.547) (-517.447) * (-511.424) [-514.533] (-512.062) (-510.268) -- 0:00:07
884500 -- (-513.704) (-511.313) (-513.598) [-510.121] * (-509.196) (-509.532) (-511.291) [-509.805] -- 0:00:07
885000 -- (-510.407) (-508.707) [-515.216] (-509.670) * (-510.068) (-513.702) (-510.475) [-511.749] -- 0:00:07
Average standard deviation of split frequencies: 0.005214
885500 -- (-509.749) [-508.626] (-511.748) (-510.278) * (-514.586) (-512.533) [-508.838] (-510.007) -- 0:00:06
886000 -- (-509.731) (-509.913) [-512.176] (-510.944) * [-509.384] (-515.564) (-510.595) (-509.907) -- 0:00:06
886500 -- (-512.748) (-513.565) [-513.143] (-511.280) * (-510.517) (-512.740) (-508.792) [-509.349] -- 0:00:06
887000 -- (-508.521) (-511.717) [-512.109] (-511.391) * (-509.619) (-512.492) (-509.812) [-510.813] -- 0:00:06
887500 -- (-509.679) (-514.226) [-510.158] (-509.938) * (-509.541) (-512.865) (-509.251) [-508.978] -- 0:00:06
888000 -- [-508.431] (-513.449) (-512.400) (-508.855) * (-509.920) [-510.686] (-511.388) (-508.838) -- 0:00:06
888500 -- (-508.996) (-511.933) (-512.056) [-510.159] * (-512.707) (-510.196) [-511.130] (-510.131) -- 0:00:06
889000 -- [-510.368] (-511.957) (-512.880) (-508.647) * [-509.906] (-511.257) (-509.720) (-511.668) -- 0:00:06
889500 -- (-509.395) [-513.493] (-509.957) (-512.236) * (-509.893) [-510.785] (-509.975) (-509.955) -- 0:00:06
890000 -- (-508.709) (-514.349) [-509.710] (-511.613) * [-510.137] (-512.474) (-510.182) (-508.240) -- 0:00:06
Average standard deviation of split frequencies: 0.005116
890500 -- [-509.975] (-510.786) (-512.693) (-510.906) * [-509.114] (-516.544) (-517.313) (-508.555) -- 0:00:06
891000 -- (-512.074) (-516.128) [-510.436] (-509.871) * [-509.047] (-512.424) (-512.720) (-509.069) -- 0:00:06
891500 -- (-512.408) (-510.898) [-512.306] (-510.325) * [-508.991] (-509.853) (-509.005) (-508.871) -- 0:00:06
892000 -- (-509.675) (-510.567) (-511.123) [-509.404] * (-508.996) [-509.730] (-511.761) (-511.179) -- 0:00:06
892500 -- (-510.392) [-509.315] (-509.353) (-513.920) * [-513.232] (-511.102) (-508.794) (-509.828) -- 0:00:06
893000 -- [-511.718] (-509.954) (-509.065) (-512.020) * (-509.213) [-508.357] (-508.334) (-509.791) -- 0:00:06
893500 -- (-510.174) [-510.155] (-510.505) (-513.669) * [-508.400] (-508.883) (-508.332) (-510.241) -- 0:00:06
894000 -- (-511.691) [-509.895] (-509.649) (-511.250) * (-509.629) (-509.810) [-508.947] (-509.677) -- 0:00:06
894500 -- [-511.322] (-509.895) (-511.593) (-510.217) * (-510.105) [-514.734] (-509.987) (-515.837) -- 0:00:06
895000 -- [-509.629] (-510.654) (-510.140) (-509.382) * (-513.812) [-510.759] (-510.645) (-515.083) -- 0:00:06
Average standard deviation of split frequencies: 0.004560
895500 -- (-510.157) [-512.222] (-514.159) (-510.770) * (-511.723) (-508.774) (-509.444) [-509.440] -- 0:00:06
896000 -- (-509.086) (-512.452) [-511.918] (-510.667) * [-510.511] (-508.972) (-510.657) (-509.735) -- 0:00:06
896500 -- (-511.666) (-510.690) [-511.015] (-511.370) * (-512.569) (-510.104) [-509.182] (-508.917) -- 0:00:06
897000 -- (-509.771) (-516.756) [-512.385] (-511.472) * [-512.818] (-509.202) (-513.845) (-509.241) -- 0:00:06
897500 -- (-510.200) (-510.304) (-517.695) [-509.136] * (-510.740) (-509.110) [-509.079] (-515.031) -- 0:00:06
898000 -- (-511.552) (-510.284) (-510.497) [-511.882] * [-510.076] (-509.556) (-509.536) (-510.815) -- 0:00:06
898500 -- (-509.513) [-508.646] (-511.499) (-517.033) * (-511.786) (-512.176) [-510.671] (-510.308) -- 0:00:06
899000 -- (-509.511) [-509.466] (-512.392) (-510.140) * [-510.821] (-509.428) (-510.986) (-511.157) -- 0:00:06
899500 -- (-509.483) (-510.690) (-509.671) [-508.471] * [-509.601] (-510.020) (-510.523) (-510.475) -- 0:00:06
900000 -- (-510.545) (-512.493) (-509.356) [-514.452] * (-511.832) (-511.504) (-509.759) [-509.849] -- 0:00:06
Average standard deviation of split frequencies: 0.004431
900500 -- [-511.503] (-510.626) (-512.639) (-508.586) * [-511.368] (-509.400) (-509.753) (-510.258) -- 0:00:06
901000 -- (-509.089) [-512.337] (-510.312) (-509.467) * [-509.076] (-509.199) (-509.220) (-511.061) -- 0:00:06
901500 -- [-513.447] (-510.080) (-512.341) (-509.328) * (-513.072) (-511.064) [-511.754] (-516.284) -- 0:00:06
902000 -- (-510.227) (-514.066) (-510.879) [-508.900] * (-511.751) (-509.011) (-512.426) [-510.922] -- 0:00:05
902500 -- (-509.904) (-512.148) [-510.606] (-509.604) * (-510.926) [-508.731] (-511.520) (-508.703) -- 0:00:05
903000 -- [-509.469] (-510.408) (-513.493) (-512.887) * (-512.348) (-508.616) [-512.009] (-509.179) -- 0:00:05
903500 -- (-508.741) (-514.344) [-513.717] (-510.576) * (-510.369) (-510.672) (-509.617) [-509.545] -- 0:00:05
904000 -- (-509.458) (-512.283) [-508.361] (-509.540) * [-509.530] (-511.704) (-510.143) (-512.773) -- 0:00:05
904500 -- (-510.107) [-508.983] (-509.109) (-509.640) * (-508.902) (-509.520) [-512.277] (-510.641) -- 0:00:05
905000 -- [-509.238] (-508.852) (-509.843) (-513.874) * (-511.099) (-509.093) (-510.571) [-512.723] -- 0:00:05
Average standard deviation of split frequencies: 0.004475
905500 -- (-512.054) (-509.730) (-509.638) [-509.894] * (-510.972) (-511.562) [-510.766] (-509.407) -- 0:00:05
906000 -- (-512.069) (-508.890) (-513.056) [-508.861] * (-510.236) [-509.676] (-509.437) (-509.865) -- 0:00:05
906500 -- [-511.529] (-516.260) (-511.562) (-513.335) * (-513.853) (-510.779) [-509.921] (-509.493) -- 0:00:05
907000 -- (-512.955) (-516.154) (-510.800) [-510.162] * [-514.095] (-511.957) (-511.514) (-510.266) -- 0:00:05
907500 -- [-510.961] (-509.861) (-510.382) (-511.996) * (-509.135) (-512.133) (-510.392) [-510.415] -- 0:00:05
908000 -- (-513.498) [-510.771] (-515.161) (-514.445) * (-510.327) [-510.622] (-508.754) (-510.215) -- 0:00:05
908500 -- (-511.864) (-511.638) [-509.066] (-509.250) * (-511.957) [-510.491] (-508.990) (-509.873) -- 0:00:05
909000 -- (-511.264) (-510.006) (-510.910) [-508.687] * [-509.758] (-510.152) (-508.842) (-508.889) -- 0:00:05
909500 -- (-512.518) [-510.219] (-510.708) (-509.752) * (-510.536) (-509.913) (-515.014) [-509.501] -- 0:00:05
910000 -- (-509.991) [-512.243] (-511.610) (-509.830) * (-509.142) (-513.091) (-511.737) [-508.653] -- 0:00:05
Average standard deviation of split frequencies: 0.004624
910500 -- [-509.186] (-512.121) (-508.652) (-508.826) * (-508.777) [-510.499] (-508.441) (-510.159) -- 0:00:05
911000 -- (-509.577) (-509.306) [-510.681] (-509.025) * (-512.314) (-511.585) (-509.831) [-509.484] -- 0:00:05
911500 -- (-508.962) (-511.759) (-512.178) [-509.576] * (-511.402) (-511.010) (-511.012) [-508.629] -- 0:00:05
912000 -- (-511.112) (-515.335) [-509.844] (-510.097) * (-510.489) [-511.457] (-515.932) (-510.131) -- 0:00:05
912500 -- (-511.497) (-512.354) (-513.208) [-509.437] * (-509.483) [-512.878] (-516.177) (-509.790) -- 0:00:05
913000 -- (-512.107) (-511.178) (-508.793) [-510.165] * (-508.705) (-512.894) (-509.855) [-508.785] -- 0:00:05
913500 -- (-509.851) [-509.031] (-512.438) (-510.577) * (-508.847) (-508.245) (-510.479) [-510.462] -- 0:00:05
914000 -- (-512.160) (-508.732) [-510.154] (-509.364) * (-511.008) (-508.826) [-509.288] (-509.479) -- 0:00:05
914500 -- (-509.950) (-511.333) [-510.174] (-509.637) * (-508.632) [-508.459] (-512.413) (-512.453) -- 0:00:05
915000 -- (-510.280) (-509.023) (-511.023) [-508.830] * [-510.768] (-511.807) (-512.898) (-514.038) -- 0:00:05
Average standard deviation of split frequencies: 0.004323
915500 -- (-509.983) (-509.895) [-510.117] (-508.882) * (-513.465) [-513.964] (-511.262) (-513.419) -- 0:00:05
916000 -- (-509.732) [-508.693] (-512.095) (-510.496) * (-519.039) [-508.710] (-509.795) (-511.672) -- 0:00:05
916500 -- (-509.483) [-509.457] (-513.955) (-510.182) * (-512.947) (-509.484) [-509.896] (-513.242) -- 0:00:05
917000 -- (-512.064) (-510.089) [-511.910] (-510.333) * (-512.765) (-509.643) [-510.530] (-511.339) -- 0:00:05
917500 -- [-510.216] (-511.799) (-508.833) (-508.734) * (-511.089) (-514.303) [-509.937] (-510.932) -- 0:00:05
918000 -- [-509.880] (-513.509) (-508.404) (-508.831) * [-510.726] (-509.263) (-510.328) (-512.215) -- 0:00:05
918500 -- (-509.301) (-509.503) [-508.190] (-511.697) * [-508.414] (-509.017) (-511.774) (-511.660) -- 0:00:04
919000 -- (-509.501) (-509.592) [-508.557] (-512.241) * (-508.838) (-512.064) (-510.980) [-512.643] -- 0:00:04
919500 -- (-508.840) (-513.556) (-520.817) [-509.257] * (-509.638) [-514.203] (-512.271) (-511.871) -- 0:00:04
920000 -- (-512.674) (-511.271) [-511.144] (-508.789) * (-509.951) (-510.794) [-510.229] (-509.360) -- 0:00:04
Average standard deviation of split frequencies: 0.004472
920500 -- (-513.988) (-508.293) (-509.809) [-511.735] * [-511.588] (-510.670) (-509.437) (-511.565) -- 0:00:04
921000 -- (-514.626) (-509.165) (-511.218) [-512.235] * (-510.805) (-510.269) [-508.385] (-509.793) -- 0:00:04
921500 -- (-509.486) [-511.700] (-512.343) (-513.035) * [-510.227] (-512.746) (-508.734) (-510.762) -- 0:00:04
922000 -- (-509.537) [-508.373] (-513.773) (-510.518) * [-508.266] (-512.889) (-510.170) (-510.212) -- 0:00:04
922500 -- (-512.950) (-509.304) [-509.421] (-511.613) * (-512.063) [-511.524] (-510.855) (-509.341) -- 0:00:04
923000 -- [-509.653] (-510.567) (-509.043) (-509.082) * (-511.537) [-508.803] (-511.020) (-508.136) -- 0:00:04
923500 -- (-509.589) (-512.085) [-508.523] (-509.080) * [-510.477] (-508.321) (-508.612) (-508.455) -- 0:00:04
924000 -- (-508.880) (-511.357) (-508.657) [-509.290] * (-510.975) (-508.130) (-510.734) [-511.864] -- 0:00:04
924500 -- (-511.577) (-511.187) (-510.204) [-509.317] * (-514.611) (-510.939) (-510.440) [-510.198] -- 0:00:04
925000 -- (-511.036) [-510.310] (-508.991) (-510.462) * [-511.695] (-514.535) (-513.409) (-513.802) -- 0:00:04
Average standard deviation of split frequencies: 0.004276
925500 -- (-511.328) (-509.058) [-509.320] (-509.714) * (-509.222) [-512.679] (-509.591) (-512.350) -- 0:00:04
926000 -- (-515.407) (-511.529) (-510.277) [-508.317] * [-512.402] (-510.453) (-509.984) (-509.726) -- 0:00:04
926500 -- (-510.265) (-510.240) (-511.287) [-508.476] * (-512.039) (-510.325) (-511.490) [-509.504] -- 0:00:04
927000 -- [-508.916] (-508.655) (-511.972) (-510.453) * (-509.669) [-508.907] (-509.581) (-510.569) -- 0:00:04
927500 -- (-510.309) [-508.627] (-509.335) (-509.026) * (-511.556) (-509.707) (-510.131) [-513.032] -- 0:00:04
928000 -- (-510.727) (-509.208) (-509.970) [-509.793] * [-512.094] (-510.725) (-509.811) (-513.472) -- 0:00:04
928500 -- [-510.907] (-510.251) (-509.503) (-511.638) * (-508.346) (-509.085) (-508.458) [-512.131] -- 0:00:04
929000 -- [-509.658] (-510.805) (-511.704) (-509.385) * (-510.178) [-509.406] (-508.983) (-509.289) -- 0:00:04
929500 -- [-511.718] (-512.339) (-510.122) (-510.356) * [-510.943] (-509.557) (-509.216) (-508.918) -- 0:00:04
930000 -- (-509.857) [-508.911] (-510.698) (-510.019) * (-510.465) [-510.073] (-516.193) (-509.319) -- 0:00:04
Average standard deviation of split frequencies: 0.004592
930500 -- [-510.471] (-511.668) (-513.294) (-511.364) * (-510.330) (-511.938) (-515.107) [-509.254] -- 0:00:04
931000 -- (-511.131) (-510.220) [-508.711] (-510.478) * (-511.065) (-515.455) (-510.105) [-509.411] -- 0:00:04
931500 -- (-511.986) [-510.876] (-510.724) (-511.395) * (-515.336) (-510.869) (-513.673) [-509.248] -- 0:00:04
932000 -- (-509.815) [-508.428] (-510.215) (-511.136) * (-511.123) (-512.590) (-510.005) [-510.650] -- 0:00:04
932500 -- [-509.698] (-509.752) (-510.348) (-508.814) * (-510.998) (-510.011) [-509.514] (-510.276) -- 0:00:04
933000 -- (-511.854) (-508.992) (-511.043) [-509.639] * (-510.009) (-511.503) (-508.729) [-509.505] -- 0:00:04
933500 -- (-510.806) (-511.481) (-510.551) [-509.046] * (-511.268) [-510.933] (-513.220) (-511.691) -- 0:00:04
934000 -- (-512.447) (-508.602) (-510.060) [-510.691] * (-511.116) [-510.796] (-509.051) (-509.703) -- 0:00:04
934500 -- [-509.757] (-509.764) (-515.280) (-515.671) * (-511.530) (-509.964) (-508.913) [-513.223] -- 0:00:03
935000 -- [-512.366] (-509.781) (-512.356) (-510.838) * (-510.604) [-509.006] (-511.133) (-512.753) -- 0:00:03
Average standard deviation of split frequencies: 0.004667
935500 -- (-511.324) (-509.074) (-513.450) [-509.604] * (-509.763) (-508.737) (-509.865) [-509.697] -- 0:00:03
936000 -- (-510.431) [-510.381] (-512.105) (-510.419) * (-512.153) [-509.422] (-510.002) (-510.667) -- 0:00:03
936500 -- (-510.013) (-508.596) (-509.032) [-508.194] * [-509.737] (-508.995) (-509.498) (-515.515) -- 0:00:03
937000 -- (-513.208) (-515.443) (-511.014) [-508.533] * (-513.026) (-508.585) (-510.574) [-511.547] -- 0:00:03
937500 -- (-510.051) (-510.699) [-511.646] (-511.380) * (-511.036) (-510.043) [-508.967] (-514.038) -- 0:00:03
938000 -- (-509.071) (-511.361) [-512.521] (-511.645) * (-510.238) (-512.869) (-509.153) [-509.015] -- 0:00:03
938500 -- (-513.128) (-515.093) [-509.680] (-511.049) * (-511.374) (-511.179) [-511.780] (-510.244) -- 0:00:03
939000 -- (-510.871) (-510.564) [-510.005] (-511.584) * (-510.262) (-512.102) [-510.595] (-509.992) -- 0:00:03
939500 -- (-512.639) (-508.571) (-510.773) [-513.418] * (-510.753) (-510.286) [-512.195] (-508.641) -- 0:00:03
940000 -- (-509.618) [-509.817] (-510.358) (-512.990) * (-510.978) (-510.714) (-509.747) [-508.896] -- 0:00:03
Average standard deviation of split frequencies: 0.005145
940500 -- (-509.098) (-510.306) [-511.702] (-510.364) * (-511.774) (-512.128) [-512.167] (-508.881) -- 0:00:03
941000 -- (-508.195) [-513.195] (-511.880) (-511.765) * (-511.876) (-509.863) [-512.711] (-510.599) -- 0:00:03
941500 -- (-510.116) [-511.573] (-511.883) (-509.600) * (-509.390) (-509.717) (-514.005) [-509.886] -- 0:00:03
942000 -- [-511.061] (-512.246) (-510.774) (-509.186) * [-509.489] (-510.719) (-512.415) (-510.411) -- 0:00:03
942500 -- (-509.933) (-512.264) (-510.431) [-508.354] * [-511.549] (-508.472) (-509.949) (-509.523) -- 0:00:03
943000 -- (-513.905) [-512.046] (-509.172) (-509.725) * [-509.776] (-508.786) (-509.979) (-509.213) -- 0:00:03
943500 -- (-511.007) (-510.783) (-509.575) [-510.233] * [-508.960] (-509.995) (-509.448) (-510.704) -- 0:00:03
944000 -- (-508.677) [-512.272] (-508.894) (-510.191) * [-508.484] (-509.474) (-511.323) (-510.699) -- 0:00:03
944500 -- (-508.582) (-508.906) [-508.193] (-514.098) * (-512.605) [-508.337] (-509.367) (-508.444) -- 0:00:03
945000 -- (-510.256) [-509.429] (-509.932) (-514.333) * [-509.272] (-508.399) (-509.957) (-510.375) -- 0:00:03
Average standard deviation of split frequencies: 0.005149
945500 -- (-513.022) (-511.610) [-512.898] (-510.128) * (-509.431) (-508.399) (-510.906) [-509.956] -- 0:00:03
946000 -- (-510.634) [-508.525] (-509.966) (-516.873) * [-512.472] (-508.358) (-509.781) (-511.549) -- 0:00:03
946500 -- [-510.430] (-508.847) (-510.147) (-520.935) * (-513.831) (-508.614) [-511.778] (-512.211) -- 0:00:03
947000 -- (-508.867) (-508.928) (-514.117) [-509.677] * (-512.633) (-511.164) [-509.110] (-509.523) -- 0:00:03
947500 -- (-508.551) (-508.719) [-517.305] (-509.345) * [-510.734] (-509.208) (-513.815) (-510.437) -- 0:00:03
948000 -- [-508.976] (-511.346) (-512.240) (-509.278) * (-508.968) [-510.118] (-510.000) (-514.621) -- 0:00:03
948500 -- (-508.993) (-510.189) (-511.825) [-513.813] * (-509.735) (-509.661) [-510.979] (-509.808) -- 0:00:03
949000 -- (-510.142) [-512.094] (-509.877) (-515.839) * (-510.285) [-509.705] (-511.356) (-508.915) -- 0:00:03
949500 -- (-510.516) (-510.054) [-508.578] (-512.757) * (-509.738) (-512.264) (-510.834) [-510.985] -- 0:00:03
950000 -- [-508.998] (-510.496) (-509.241) (-512.482) * (-512.460) (-510.019) (-515.753) [-508.785] -- 0:00:03
Average standard deviation of split frequencies: 0.005223
950500 -- (-511.320) [-508.502] (-512.529) (-510.614) * (-511.086) [-509.020] (-511.701) (-510.910) -- 0:00:03
951000 -- (-509.482) (-513.304) [-510.632] (-513.798) * (-511.256) (-508.579) [-512.076] (-513.076) -- 0:00:02
951500 -- (-508.598) (-509.113) [-509.254] (-512.686) * (-511.145) (-508.358) [-508.950] (-509.446) -- 0:00:02
952000 -- (-509.621) (-512.973) [-509.561] (-510.579) * (-515.184) [-510.110] (-510.726) (-509.084) -- 0:00:02
952500 -- (-509.372) [-508.586] (-509.151) (-510.362) * (-512.886) (-511.940) [-510.714] (-510.708) -- 0:00:02
953000 -- (-509.730) [-508.982] (-508.666) (-509.406) * (-513.732) (-513.895) (-510.662) [-512.300] -- 0:00:02
953500 -- [-512.485] (-508.798) (-511.412) (-509.610) * (-511.230) (-510.871) [-511.903] (-510.594) -- 0:00:02
954000 -- (-509.733) [-511.793] (-509.190) (-511.501) * (-510.571) [-511.481] (-509.180) (-509.938) -- 0:00:02
954500 -- (-508.566) [-509.800] (-509.791) (-509.755) * [-511.141] (-509.799) (-508.695) (-509.650) -- 0:00:02
955000 -- (-508.670) [-510.996] (-510.545) (-510.527) * [-511.068] (-514.117) (-510.077) (-509.384) -- 0:00:02
Average standard deviation of split frequencies: 0.004865
955500 -- (-512.526) [-509.926] (-510.668) (-509.184) * [-509.374] (-509.086) (-508.581) (-512.452) -- 0:00:02
956000 -- (-510.685) (-512.735) [-510.760] (-509.676) * (-510.810) [-510.226] (-511.172) (-508.976) -- 0:00:02
956500 -- (-521.883) (-512.530) [-510.412] (-509.613) * (-513.777) (-510.163) [-511.502] (-508.363) -- 0:00:02
957000 -- (-515.013) [-512.777] (-509.282) (-509.645) * [-509.111] (-511.540) (-514.421) (-511.539) -- 0:00:02
957500 -- (-509.705) (-510.159) (-512.254) [-509.168] * (-510.186) (-508.560) (-514.010) [-510.147] -- 0:00:02
958000 -- (-510.647) [-508.334] (-510.915) (-510.884) * (-509.704) (-510.478) [-508.965] (-512.583) -- 0:00:02
958500 -- (-510.148) (-508.685) [-509.445] (-509.126) * (-509.258) (-509.658) [-508.911] (-509.124) -- 0:00:02
959000 -- [-509.496] (-509.436) (-513.491) (-509.901) * (-511.950) [-509.677] (-509.059) (-510.358) -- 0:00:02
959500 -- (-509.748) (-508.995) [-508.774] (-509.024) * (-509.316) (-509.618) [-510.086] (-509.782) -- 0:00:02
960000 -- (-511.532) [-510.795] (-511.156) (-512.286) * (-510.737) [-511.061] (-509.185) (-509.265) -- 0:00:02
Average standard deviation of split frequencies: 0.004645
960500 -- [-509.228] (-517.611) (-511.276) (-510.435) * [-510.225] (-510.268) (-510.089) (-510.136) -- 0:00:02
961000 -- [-509.716] (-511.031) (-508.849) (-511.271) * [-509.770] (-510.529) (-511.606) (-509.267) -- 0:00:02
961500 -- (-509.108) (-510.311) [-510.566] (-511.271) * (-508.440) [-512.702] (-516.144) (-510.203) -- 0:00:02
962000 -- (-509.955) (-510.699) (-515.382) [-510.914] * (-510.708) (-512.179) [-511.349] (-511.511) -- 0:00:02
962500 -- (-510.966) [-510.670] (-509.661) (-508.591) * (-511.734) [-508.757] (-510.915) (-512.365) -- 0:00:02
963000 -- (-510.835) (-512.451) (-508.932) [-510.285] * (-511.530) [-508.709] (-508.998) (-510.294) -- 0:00:02
963500 -- (-510.626) (-512.397) (-509.907) [-510.997] * (-510.470) (-509.358) [-508.845] (-509.377) -- 0:00:02
964000 -- (-510.554) (-513.847) [-509.848] (-513.986) * [-510.505] (-508.919) (-509.283) (-512.348) -- 0:00:02
964500 -- (-509.342) [-508.981] (-514.157) (-510.818) * (-512.552) (-508.727) [-511.263] (-513.124) -- 0:00:02
965000 -- [-513.086] (-511.315) (-511.564) (-508.990) * (-510.821) [-508.424] (-509.509) (-511.318) -- 0:00:02
Average standard deviation of split frequencies: 0.004847
965500 -- (-512.118) (-511.281) [-510.528] (-511.971) * (-508.916) (-510.851) (-509.427) [-510.175] -- 0:00:02
966000 -- (-512.997) (-512.704) [-509.929] (-511.362) * (-509.588) (-509.541) [-508.739] (-510.036) -- 0:00:02
966500 -- (-514.311) [-509.845] (-511.931) (-508.698) * (-510.176) (-509.577) [-509.955] (-509.399) -- 0:00:02
967000 -- (-512.024) (-509.617) (-508.411) [-510.719] * (-509.248) [-508.822] (-508.497) (-510.257) -- 0:00:02
967500 -- (-512.196) (-510.667) [-509.317] (-512.872) * (-509.477) (-510.353) (-508.221) [-510.397] -- 0:00:01
968000 -- [-512.825] (-509.319) (-509.265) (-512.448) * (-510.432) (-509.867) [-510.440] (-510.129) -- 0:00:01
968500 -- (-509.404) (-508.994) [-512.861] (-508.301) * (-511.132) [-508.367] (-510.481) (-510.598) -- 0:00:01
969000 -- (-511.732) (-510.955) [-511.667] (-508.766) * (-512.631) (-509.995) [-508.959] (-514.654) -- 0:00:01
969500 -- [-512.373] (-509.134) (-512.362) (-511.480) * (-511.747) (-508.440) [-510.280] (-509.957) -- 0:00:01
970000 -- (-510.448) (-508.413) [-510.144] (-509.439) * (-508.318) (-510.068) (-509.582) [-509.847] -- 0:00:01
Average standard deviation of split frequencies: 0.004954
970500 -- [-509.137] (-511.074) (-511.478) (-514.687) * (-508.318) (-509.730) [-511.220] (-511.104) -- 0:00:01
971000 -- (-512.519) [-511.245] (-508.685) (-516.289) * (-509.454) (-510.268) (-512.267) [-510.621] -- 0:00:01
971500 -- (-511.428) (-510.889) (-512.363) [-512.975] * (-512.152) (-509.945) [-508.732] (-510.377) -- 0:00:01
972000 -- [-508.924] (-509.286) (-512.280) (-513.894) * (-508.892) (-511.967) [-511.736] (-509.974) -- 0:00:01
972500 -- [-510.205] (-509.107) (-512.174) (-508.987) * (-508.841) (-509.945) (-511.025) [-509.014] -- 0:00:01
973000 -- (-509.037) (-509.096) [-511.809] (-512.986) * (-509.482) (-508.947) (-513.083) [-508.603] -- 0:00:01
973500 -- (-509.261) [-509.473] (-509.796) (-511.783) * [-510.620] (-510.223) (-512.239) (-514.834) -- 0:00:01
974000 -- (-510.408) (-509.792) (-510.697) [-511.482] * (-510.635) (-512.937) (-509.553) [-512.867] -- 0:00:01
974500 -- (-509.883) [-509.531] (-509.465) (-510.158) * (-512.252) (-513.037) (-510.803) [-510.938] -- 0:00:01
975000 -- (-513.967) [-510.698] (-510.439) (-510.593) * (-513.483) [-511.710] (-511.128) (-511.090) -- 0:00:01
Average standard deviation of split frequencies: 0.004766
975500 -- [-509.755] (-509.648) (-508.847) (-509.799) * (-511.701) (-511.608) [-508.468] (-508.934) -- 0:00:01
976000 -- (-512.385) [-508.432] (-510.943) (-511.123) * [-509.219] (-510.999) (-510.054) (-512.457) -- 0:00:01
976500 -- (-508.962) [-509.320] (-511.277) (-512.856) * (-510.397) (-508.535) (-512.697) [-517.341] -- 0:00:01
977000 -- [-508.547] (-508.653) (-509.701) (-512.683) * (-510.077) [-509.078] (-512.287) (-509.336) -- 0:00:01
977500 -- [-509.169] (-509.040) (-509.838) (-511.941) * (-508.644) (-508.384) [-508.774] (-512.022) -- 0:00:01
978000 -- (-510.724) (-508.330) (-512.074) [-509.936] * (-510.700) [-510.409] (-510.236) (-511.257) -- 0:00:01
978500 -- (-511.538) [-509.112] (-509.704) (-510.433) * (-510.677) [-511.929] (-510.247) (-511.522) -- 0:00:01
979000 -- (-510.430) (-515.299) [-509.757] (-510.708) * (-511.767) [-509.923] (-510.357) (-511.669) -- 0:00:01
979500 -- (-508.629) (-508.873) [-509.680] (-508.789) * (-510.303) (-511.281) [-512.254] (-509.285) -- 0:00:01
980000 -- (-509.081) (-509.688) [-508.568] (-508.871) * (-509.010) (-511.369) [-508.833] (-509.004) -- 0:00:01
Average standard deviation of split frequencies: 0.005159
980500 -- (-508.298) (-510.772) [-513.579] (-509.343) * (-509.593) (-509.668) [-509.201] (-509.985) -- 0:00:01
981000 -- (-511.166) (-510.255) [-509.174] (-511.652) * [-509.673] (-512.023) (-514.535) (-510.218) -- 0:00:01
981500 -- (-509.201) (-511.612) (-509.328) [-511.527] * (-510.942) (-510.378) (-511.153) [-508.878] -- 0:00:01
982000 -- (-513.416) (-511.124) [-508.567] (-513.114) * (-513.491) (-512.795) (-509.942) [-509.233] -- 0:00:01
982500 -- (-511.506) [-510.442] (-510.810) (-518.893) * (-508.404) (-513.050) [-509.953] (-511.029) -- 0:00:01
983000 -- (-509.896) [-510.403] (-510.390) (-509.237) * (-511.364) (-510.505) (-508.959) [-510.155] -- 0:00:01
983500 -- (-511.177) (-509.297) [-510.004] (-509.617) * (-509.846) [-510.125] (-512.959) (-508.914) -- 0:00:01
984000 -- (-509.834) (-509.410) [-511.745] (-508.540) * [-510.614] (-509.893) (-511.973) (-511.954) -- 0:00:00
984500 -- [-511.675] (-513.417) (-514.423) (-508.420) * (-508.880) (-509.076) (-510.432) [-511.323] -- 0:00:00
985000 -- (-508.881) (-511.705) (-509.803) [-511.899] * (-509.478) (-508.996) (-513.636) [-509.971] -- 0:00:00
Average standard deviation of split frequencies: 0.004558
985500 -- (-510.251) [-510.685] (-510.435) (-509.529) * [-510.795] (-512.315) (-510.954) (-509.322) -- 0:00:00
986000 -- [-509.799] (-511.883) (-510.008) (-512.935) * (-508.217) (-509.329) (-508.826) [-510.077] -- 0:00:00
986500 -- (-509.172) (-508.382) [-509.944] (-513.381) * (-512.695) (-509.321) (-510.701) [-510.269] -- 0:00:00
987000 -- [-509.526] (-509.968) (-511.685) (-513.553) * (-510.206) (-511.285) [-513.231] (-509.839) -- 0:00:00
987500 -- (-509.766) (-510.776) [-510.678] (-510.609) * (-509.653) (-510.750) (-508.827) [-510.559] -- 0:00:00
988000 -- (-510.939) (-513.103) [-510.914] (-509.284) * (-509.122) (-515.478) (-510.038) [-511.069] -- 0:00:00
988500 -- (-512.072) [-511.319] (-512.889) (-509.234) * (-509.691) [-509.051] (-509.546) (-512.209) -- 0:00:00
989000 -- (-511.504) [-512.793] (-512.508) (-509.368) * (-509.966) [-509.994] (-510.205) (-513.600) -- 0:00:00
989500 -- (-511.920) (-510.897) [-517.531] (-509.300) * [-508.525] (-509.577) (-510.183) (-510.778) -- 0:00:00
990000 -- (-514.747) [-510.581] (-513.263) (-510.268) * (-510.992) [-511.670] (-510.111) (-509.600) -- 0:00:00
Average standard deviation of split frequencies: 0.005107
990500 -- (-509.570) (-511.935) [-511.531] (-509.835) * (-511.003) (-514.436) [-509.238] (-510.598) -- 0:00:00
991000 -- (-510.137) [-511.122] (-510.672) (-513.713) * (-511.165) (-509.533) [-509.007] (-511.522) -- 0:00:00
991500 -- (-510.539) [-508.926] (-509.613) (-510.083) * (-509.820) (-510.012) [-509.536] (-514.002) -- 0:00:00
992000 -- [-509.373] (-510.434) (-509.918) (-509.605) * (-510.989) (-509.917) (-508.965) [-510.009] -- 0:00:00
992500 -- (-511.243) (-512.066) [-509.319] (-510.220) * (-509.601) [-509.533] (-511.973) (-512.201) -- 0:00:00
993000 -- (-511.816) (-511.922) [-512.686] (-512.546) * [-512.738] (-509.366) (-510.839) (-511.305) -- 0:00:00
993500 -- [-509.573] (-511.314) (-509.430) (-513.780) * (-510.048) [-509.257] (-513.800) (-512.026) -- 0:00:00
994000 -- [-509.480] (-514.155) (-508.678) (-510.986) * (-512.578) (-508.242) [-511.734] (-512.662) -- 0:00:00
994500 -- (-509.281) [-510.980] (-509.560) (-515.178) * (-511.584) [-508.635] (-513.053) (-509.777) -- 0:00:00
995000 -- (-511.551) (-514.661) [-509.533] (-512.613) * (-512.177) (-508.957) [-511.292] (-511.838) -- 0:00:00
Average standard deviation of split frequencies: 0.005080
995500 -- (-515.390) (-509.592) [-509.246] (-512.293) * (-510.277) [-509.927] (-513.738) (-514.698) -- 0:00:00
996000 -- (-509.282) (-510.761) (-508.536) [-509.415] * (-512.158) (-509.403) [-511.127] (-511.400) -- 0:00:00
996500 -- (-511.640) (-508.731) [-509.343] (-509.425) * (-514.819) (-513.598) (-513.066) [-509.657] -- 0:00:00
997000 -- (-513.218) [-509.163] (-511.893) (-508.878) * (-512.574) (-508.394) (-513.105) [-508.831] -- 0:00:00
997500 -- [-510.522] (-509.569) (-513.061) (-513.099) * (-509.725) (-512.139) [-509.942] (-509.772) -- 0:00:00
998000 -- (-509.042) (-510.253) (-513.496) [-511.338] * (-510.262) (-511.320) (-509.462) [-508.872] -- 0:00:00
998500 -- (-509.387) (-511.243) [-509.322] (-508.765) * (-508.819) (-512.436) [-508.478] (-510.835) -- 0:00:00
999000 -- [-508.939] (-511.650) (-509.140) (-509.450) * (-509.430) (-513.852) [-508.391] (-510.238) -- 0:00:00
999500 -- (-511.574) (-510.453) [-511.186] (-510.003) * (-509.816) [-510.586] (-511.615) (-508.906) -- 0:00:00
1000000 -- [-511.918] (-509.326) (-513.092) (-510.164) * (-509.780) (-510.138) [-511.227] (-508.411) -- 0:00:00
Average standard deviation of split frequencies: 0.004899
Analysis completed in 1 mins 1 seconds
Analysis used 59.79 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -508.00
Likelihood of best state for "cold" chain of run 2 was -508.00
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.3 % ( 70 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
35.8 % ( 27 %) Dirichlet(Pi{all})
35.7 % ( 26 %) Slider(Pi{all})
78.1 % ( 42 %) Multiplier(Alpha{1,2})
78.2 % ( 60 %) Multiplier(Alpha{3})
25.2 % ( 23 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.0 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 32 %) Multiplier(V{all})
97.4 % ( 95 %) Nodeslider(V{all})
30.6 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 66 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
36.0 % ( 33 %) Dirichlet(Pi{all})
35.2 % ( 25 %) Slider(Pi{all})
78.9 % ( 59 %) Multiplier(Alpha{1,2})
77.3 % ( 51 %) Multiplier(Alpha{3})
24.5 % ( 27 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.3 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166165 0.82 0.66
3 | 167123 166575 0.84
4 | 167218 166054 166865
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.51
2 | 166947 0.82 0.67
3 | 166594 167064 0.84
4 | 166545 166383 166467
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -509.65
| 1 |
| 2 1 1 2 |
| 1 2 21 2 2 1 1 2|
|2 2 221 2 1 2 2 2 21 2 1 |
| 1 2 1 *1 112 2 1 1 2 2 |
| 1 1 * 1 *1 2 1 1 2 1 1 1 2 2 2 |
| 2 22 2 1 1 2 1 21 2 2 2 * 2 |
|1 1 1 2 2 1 1 1 1 1|
| * 1 2 2 21 1 2 1 * 1 1 1 1 |
| 1 2 1 2 2 2 2 |
| 1 2 1 2 2 2 2 1 |
| |
| |
| 1 |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -511.69
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -509.72 -512.97
2 -509.70 -513.14
--------------------------------------
TOTAL -509.71 -513.06
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896317 0.091299 0.370767 1.497552 0.861194 1301.42 1401.21 1.000
r(A<->C){all} 0.173371 0.021769 0.000006 0.477635 0.133155 230.30 287.97 1.000
r(A<->G){all} 0.158302 0.017592 0.000055 0.424371 0.125572 277.87 343.90 1.002
r(A<->T){all} 0.170954 0.019100 0.000026 0.444903 0.140646 201.74 239.85 1.000
r(C<->G){all} 0.163259 0.019414 0.000192 0.438593 0.125586 191.08 206.50 1.003
r(C<->T){all} 0.168732 0.020077 0.000066 0.443045 0.132555 179.13 221.88 1.001
r(G<->T){all} 0.165381 0.020818 0.000006 0.455956 0.126109 206.18 225.82 1.000
pi(A){all} 0.224445 0.000439 0.184482 0.267419 0.224292 1201.86 1297.81 1.002
pi(C){all} 0.332292 0.000589 0.286077 0.382628 0.331999 1048.97 1121.39 1.001
pi(G){all} 0.276871 0.000510 0.235466 0.324590 0.276586 1054.69 1097.69 1.000
pi(T){all} 0.166392 0.000364 0.129413 0.201974 0.165688 1062.95 1200.26 1.000
alpha{1,2} 0.412611 0.225093 0.000183 1.367010 0.242858 1091.46 1119.08 1.000
alpha{3} 0.459195 0.240542 0.000246 1.457568 0.306271 1288.39 1335.07 1.000
pinvar{all} 0.995592 0.000029 0.985125 0.999997 0.997325 1473.41 1487.20 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- ...**.
9 -- .*...*
10 -- ..**..
11 -- .**...
12 -- .**.**
13 -- .*.***
14 -- .***.*
15 -- ...*.*
16 -- .*.*..
17 -- .****.
18 -- .*..*.
19 -- ..*.*.
20 -- ....**
21 -- ..****
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 460 0.153231 0.011306 0.145237 0.161226 2
8 459 0.152898 0.003298 0.150566 0.155230 2
9 450 0.149900 0.003769 0.147235 0.152565 2
10 446 0.148568 0.003769 0.145903 0.151233 2
11 440 0.146569 0.000942 0.145903 0.147235 2
12 440 0.146569 0.015075 0.135909 0.157229 2
13 431 0.143571 0.007066 0.138574 0.148568 2
14 427 0.142239 0.001413 0.141239 0.143238 2
15 424 0.141239 0.015075 0.130580 0.151899 2
16 422 0.140573 0.000000 0.140573 0.140573 2
17 417 0.138907 0.005182 0.135243 0.142572 2
18 413 0.137575 0.001413 0.136576 0.138574 2
19 412 0.137242 0.000942 0.136576 0.137908 2
20 401 0.133578 0.002355 0.131912 0.135243 2
21 400 0.133245 0.001884 0.131912 0.134577 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101169 0.009844 0.000047 0.300480 0.071971 1.000 2
length{all}[2] 0.101014 0.009829 0.000019 0.300223 0.071160 1.000 2
length{all}[3] 0.102533 0.010769 0.000021 0.308266 0.070581 1.000 2
length{all}[4] 0.100353 0.010556 0.000005 0.297749 0.070510 1.001 2
length{all}[5] 0.098764 0.009763 0.000008 0.288097 0.067295 1.000 2
length{all}[6] 0.097719 0.009325 0.000074 0.292467 0.067837 1.000 2
length{all}[7] 0.099645 0.009719 0.000244 0.295669 0.068525 1.005 2
length{all}[8] 0.099262 0.009193 0.000252 0.298745 0.073615 0.998 2
length{all}[9] 0.094284 0.009329 0.000293 0.312730 0.060604 0.998 2
length{all}[10] 0.101685 0.009866 0.000027 0.317366 0.071473 0.998 2
length{all}[11] 0.091496 0.007995 0.000375 0.260934 0.062217 0.998 2
length{all}[12] 0.094354 0.009391 0.000028 0.293210 0.060706 0.999 2
length{all}[13] 0.094443 0.009278 0.000010 0.286588 0.061803 0.998 2
length{all}[14] 0.098977 0.010677 0.000534 0.291843 0.064441 0.998 2
length{all}[15] 0.098159 0.009249 0.000005 0.282398 0.073528 0.998 2
length{all}[16] 0.103113 0.008676 0.000082 0.315957 0.074004 0.999 2
length{all}[17] 0.104303 0.010913 0.000371 0.312175 0.074218 0.998 2
length{all}[18] 0.098349 0.009648 0.000955 0.295267 0.068934 1.002 2
length{all}[19] 0.096198 0.008968 0.000338 0.292164 0.063689 0.998 2
length{all}[20] 0.096878 0.010016 0.000122 0.305512 0.065048 0.998 2
length{all}[21] 0.098297 0.009011 0.000244 0.303694 0.066686 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004899
Maximum standard deviation of split frequencies = 0.015075
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 375
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 48 patterns at 125 / 125 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 48 patterns at 125 / 125 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
46848 bytes for conP
4224 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.064834 0.018796 0.044600 0.071891 0.062692 0.079282 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -530.877931
Iterating by ming2
Initial: fx= 530.877931
x= 0.06483 0.01880 0.04460 0.07189 0.06269 0.07928 0.30000 1.30000
1 h-m-p 0.0000 0.0002 298.8453 ++ 517.193384 m 0.0002 13 | 1/8
2 h-m-p 0.0008 0.0054 55.5436 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 273.3526 +++ 501.388608 m 0.0002 45 | 2/8
4 h-m-p 0.0012 0.0072 41.7950 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 245.4120 ++ 492.433426 m 0.0001 76 | 3/8
6 h-m-p 0.0011 0.0105 29.3780 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 213.1390 ++ 491.634567 m 0.0000 107 | 4/8
8 h-m-p 0.0001 0.0151 20.7848 ----------.. | 4/8
9 h-m-p 0.0000 0.0001 173.9817 ++ 489.877681 m 0.0001 137 | 5/8
10 h-m-p 0.0005 0.0228 13.8494 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 123.0983 ++ 488.955340 m 0.0001 168 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 Y 488.955340 0 1.6000 179 | 6/8
13 h-m-p 0.0783 8.0000 0.0000 -C 488.955340 0 0.0049 193
Out..
lnL = -488.955340
194 lfun, 194 eigenQcodon, 1164 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.036074 0.094788 0.102274 0.096603 0.090937 0.060231 0.299834 0.594531 0.594957
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.987542
np = 9
lnL0 = -547.264397
Iterating by ming2
Initial: fx= 547.264397
x= 0.03607 0.09479 0.10227 0.09660 0.09094 0.06023 0.29983 0.59453 0.59496
1 h-m-p 0.0000 0.0003 292.4049 +++ 521.458816 m 0.0003 15 | 1/9
2 h-m-p 0.0001 0.0006 182.5494 ++ 506.716739 m 0.0006 27 | 2/9
3 h-m-p 0.0000 0.0000 26315.1185 ++ 491.608918 m 0.0000 39 | 3/9
4 h-m-p 0.0001 0.0006 101.3641 ++ 490.009576 m 0.0006 51 | 4/9
5 h-m-p 0.0000 0.0001 484.6996 ++ 489.639937 m 0.0001 63 | 5/9
6 h-m-p 0.0000 0.0000 5104.3614 ++ 488.955341 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 488.955341 m 8.0000 87 | 6/9
8 h-m-p 0.0079 1.3310 0.1225 ++++ 488.955339 m 1.3310 104 | 6/9
9 h-m-p 0.1545 1.0630 1.0552 -------------C 488.955339 0 0.0000 132 | 6/9
10 h-m-p 0.0160 8.0000 0.0002 +++++ 488.955339 m 8.0000 147 | 6/9
11 h-m-p 0.0002 0.0296 5.4641 ++++ 488.955333 m 0.0296 164 | 7/9
12 h-m-p 1.6000 8.0000 0.0487 ++ 488.955332 m 8.0000 176 | 7/9
13 h-m-p 0.2175 1.0875 0.4963 ++ 488.955332 m 1.0875 190 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 N 488.955332 0 1.6000 204 | 8/9
15 h-m-p 0.0160 8.0000 0.0000 N 488.955332 0 0.0160 217
Out..
lnL = -488.955332
218 lfun, 654 eigenQcodon, 2616 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.043168 0.105222 0.074396 0.076456 0.039753 0.098090 0.000100 0.832042 0.155783 0.398787 1.363693
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.258695
np = 11
lnL0 = -540.380906
Iterating by ming2
Initial: fx= 540.380906
x= 0.04317 0.10522 0.07440 0.07646 0.03975 0.09809 0.00011 0.83204 0.15578 0.39879 1.36369
1 h-m-p 0.0000 0.0000 276.7031 ++ 540.090245 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0012 178.4283 ++++ 512.192669 m 0.0012 32 | 2/11
3 h-m-p 0.0000 0.0000 345.4169 ++ 510.397305 m 0.0000 46 | 3/11
4 h-m-p 0.0001 0.0022 103.9406 +++ 495.068371 m 0.0022 61 | 4/11
5 h-m-p 0.0039 0.0197 13.3913 ------------.. | 4/11
6 h-m-p 0.0000 0.0000 237.7947 ++ 494.873173 m 0.0000 99 | 5/11
7 h-m-p 0.0160 8.0000 4.6203 -------------.. | 5/11
8 h-m-p 0.0000 0.0000 205.8304 ++ 494.238919 m 0.0000 138 | 6/11
9 h-m-p 0.0160 8.0000 4.2097 -------------.. | 6/11
10 h-m-p 0.0000 0.0002 168.1999 ++ 489.718459 m 0.0002 177 | 7/11
11 h-m-p 0.0160 8.0000 2.2628 -------------.. | 7/11
12 h-m-p 0.0000 0.0001 122.2110 ++ 488.955333 m 0.0001 216 | 8/11
13 h-m-p 0.0569 8.0000 0.0000 ++++ 488.955333 m 8.0000 232 | 8/11
14 h-m-p 0.0759 8.0000 0.0001 ++++ 488.955333 m 8.0000 251 | 8/11
15 h-m-p 0.0160 8.0000 1.0956 +++++ 488.955330 m 8.0000 271 | 8/11
16 h-m-p 1.6000 8.0000 0.4341 ++ 488.955330 m 8.0000 285 | 8/11
17 h-m-p 1.1641 8.0000 2.9835 ++ 488.955330 m 8.0000 302 | 8/11
18 h-m-p 1.6000 8.0000 11.9327 ++ 488.955330 m 8.0000 316 | 8/11
19 h-m-p 0.0189 0.0945 31.9672 ++ 488.955330 m 0.0945 330 | 8/11
20 h-m-p 0.6901 8.0000 4.3760 --------Y 488.955330 0 0.0000 352 | 8/11
21 h-m-p 0.3483 1.7414 0.0000 -------------Y 488.955330 0 0.0000 379
Out..
lnL = -488.955330
380 lfun, 1520 eigenQcodon, 6840 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -488.953826 S = -488.952571 -0.000479
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:03
did 20 / 48 patterns 0:03
did 30 / 48 patterns 0:03
did 40 / 48 patterns 0:03
did 48 / 48 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.042346 0.028621 0.030207 0.077822 0.074281 0.020733 0.000100 0.672264 1.825227
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.115313
np = 9
lnL0 = -521.508995
Iterating by ming2
Initial: fx= 521.508995
x= 0.04235 0.02862 0.03021 0.07782 0.07428 0.02073 0.00011 0.67226 1.82523
1 h-m-p 0.0000 0.0000 282.4427 ++ 521.116059 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0413 16.6783 ---------.. | 1/9
3 h-m-p 0.0000 0.0002 282.6625 +++ 507.105057 m 0.0002 46 | 2/9
4 h-m-p 0.0034 0.0526 13.1171 ------------.. | 2/9
5 h-m-p 0.0000 0.0001 264.8021 ++ 502.414456 m 0.0001 80 | 3/9
6 h-m-p 0.0019 0.0822 8.4082 ------------.. | 3/9
7 h-m-p 0.0000 0.0000 238.6566 ++ 501.656005 m 0.0000 114 | 4/9
8 h-m-p 0.0004 0.0980 7.0389 ----------.. | 4/9
9 h-m-p 0.0000 0.0001 206.3108 ++ 497.280910 m 0.0001 146 | 5/9
10 h-m-p 0.0030 0.1202 5.7525 ------------.. | 5/9
11 h-m-p 0.0000 0.0003 169.5569 +++ 489.403550 m 0.0003 181 | 6/9
12 h-m-p 0.0123 0.2932 2.6311 -------------.. | 6/9
13 h-m-p 0.0000 0.0000 122.7426 ++ 488.955334 m 0.0000 216 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 C 488.955334 0 0.0160 228 | 7/9
15 h-m-p 0.1476 8.0000 0.0000 ---Y 488.955334 0 0.0006 245
Out..
lnL = -488.955334
246 lfun, 2706 eigenQcodon, 14760 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.071734 0.086445 0.062514 0.093677 0.096055 0.031129 0.000100 0.900000 0.544525 1.013601 1.300017
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.678535
np = 11
lnL0 = -539.159016
Iterating by ming2
Initial: fx= 539.159016
x= 0.07173 0.08644 0.06251 0.09368 0.09605 0.03113 0.00011 0.90000 0.54453 1.01360 1.30002
1 h-m-p 0.0000 0.0000 258.7427 ++ 538.953507 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0023 105.0125 ++++ 518.063273 m 0.0023 32 | 2/11
3 h-m-p 0.0001 0.0005 270.2843 ++ 500.343813 m 0.0005 46 | 3/11
4 h-m-p 0.0005 0.0025 62.6411 ++ 495.873480 m 0.0025 60 | 4/11
5 h-m-p 0.0000 0.0000 11863.7152 ++ 491.837363 m 0.0000 74 | 5/11
6 h-m-p 0.0035 0.0177 6.8590 ------------.. | 5/11
7 h-m-p 0.0000 0.0000 207.8265 ++ 490.748658 m 0.0000 112 | 6/11
8 h-m-p 0.0009 0.0711 4.9082 -----------.. | 6/11
9 h-m-p 0.0000 0.0001 171.0663 ++ 489.210990 m 0.0001 149 | 7/11
10 h-m-p 0.0030 0.1721 2.0723 ------------.. | 7/11
11 h-m-p 0.0000 0.0000 122.5978 ++ 488.955333 m 0.0000 187 | 8/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 488.955333 m 8.0000 204 | 8/11
13 h-m-p 0.0160 8.0000 0.0020 -----Y 488.955333 0 0.0000 226 | 8/11
14 h-m-p 0.0160 8.0000 0.0001 ---Y 488.955333 0 0.0001 246 | 8/11
15 h-m-p 0.0160 8.0000 0.0001 ---------N 488.955333 0 0.0000 272
Out..
lnL = -488.955333
273 lfun, 3276 eigenQcodon, 18018 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -488.964577 S = -488.953646 -0.004796
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:11
did 20 / 48 patterns 0:11
did 30 / 48 patterns 0:12
did 40 / 48 patterns 0:12
did 48 / 48 patterns 0:12
Time used: 0:12
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=125
NC_011896_1_WP_010908561_1_1953_MLBR_RS09270 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
NC_002677_1_NP_302240_1_1112_ML1829 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
NZ_LVXE01000061_1_WP_010908561_1_2389_A3216_RS12425 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
NZ_LYPH01000044_1_WP_010908561_1_1754_A8144_RS08355 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
NZ_CP029543_1_WP_010908561_1_1978_DIJ64_RS10070 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
NZ_AP014567_1_WP_010908561_1_2031_JK2ML_RS10335 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
**************************************************
NC_011896_1_WP_010908561_1_1953_MLBR_RS09270 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
NC_002677_1_NP_302240_1_1112_ML1829 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
NZ_LVXE01000061_1_WP_010908561_1_2389_A3216_RS12425 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
NZ_LYPH01000044_1_WP_010908561_1_1754_A8144_RS08355 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
NZ_CP029543_1_WP_010908561_1_1978_DIJ64_RS10070 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
NZ_AP014567_1_WP_010908561_1_2031_JK2ML_RS10335 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
**************************************************
NC_011896_1_WP_010908561_1_1953_MLBR_RS09270 FGVDNHVDAEWLKLTSLGLRPRAIR
NC_002677_1_NP_302240_1_1112_ML1829 FGVDNHVDAEWLKLTSLGLRPRAIR
NZ_LVXE01000061_1_WP_010908561_1_2389_A3216_RS12425 FGVDNHVDAEWLKLTSLGLRPRAIR
NZ_LYPH01000044_1_WP_010908561_1_1754_A8144_RS08355 FGVDNHVDAEWLKLTSLGLRPRAIR
NZ_CP029543_1_WP_010908561_1_1978_DIJ64_RS10070 FGVDNHVDAEWLKLTSLGLRPRAIR
NZ_AP014567_1_WP_010908561_1_2031_JK2ML_RS10335 FGVDNHVDAEWLKLTSLGLRPRAIR
*************************
>NC_011896_1_WP_010908561_1_1953_MLBR_RS09270 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT AGGCCTTAGGCCGCGTGCAATTAGG >NC_002677_1_NP_302240_1_1112_ML1829 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT AGGCCTTAGGCCGCGTGCAATTAGG >NZ_LVXE01000061_1_WP_010908561_1_2389_A3216_RS12425 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT AGGCCTTAGGCCGCGTGCAATTAGG >NZ_LYPH01000044_1_WP_010908561_1_1754_A8144_RS08355 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT AGGCCTTAGGCCGCGTGCAATTAGG >NZ_CP029543_1_WP_010908561_1_1978_DIJ64_RS10070 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT AGGCCTTAGGCCGCGTGCAATTAGG >NZ_AP014567_1_WP_010908561_1_2031_JK2ML_RS10335 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT AGGCCTTAGGCCGCGTGCAATTAGG
>NC_011896_1_WP_010908561_1_1953_MLBR_RS09270 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP FGVDNHVDAEWLKLTSLGLRPRAIR >NC_002677_1_NP_302240_1_1112_ML1829 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP FGVDNHVDAEWLKLTSLGLRPRAIR >NZ_LVXE01000061_1_WP_010908561_1_2389_A3216_RS12425 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP FGVDNHVDAEWLKLTSLGLRPRAIR >NZ_LYPH01000044_1_WP_010908561_1_1754_A8144_RS08355 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP FGVDNHVDAEWLKLTSLGLRPRAIR >NZ_CP029543_1_WP_010908561_1_1978_DIJ64_RS10070 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP FGVDNHVDAEWLKLTSLGLRPRAIR >NZ_AP014567_1_WP_010908561_1_2031_JK2ML_RS10335 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP FGVDNHVDAEWLKLTSLGLRPRAIR
#NEXUS
[ID: 5299824772]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908561_1_1953_MLBR_RS09270
NC_002677_1_NP_302240_1_1112_ML1829
NZ_LVXE01000061_1_WP_010908561_1_2389_A3216_RS12425
NZ_LYPH01000044_1_WP_010908561_1_1754_A8144_RS08355
NZ_CP029543_1_WP_010908561_1_1978_DIJ64_RS10070
NZ_AP014567_1_WP_010908561_1_2031_JK2ML_RS10335
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908561_1_1953_MLBR_RS09270,
2 NC_002677_1_NP_302240_1_1112_ML1829,
3 NZ_LVXE01000061_1_WP_010908561_1_2389_A3216_RS12425,
4 NZ_LYPH01000044_1_WP_010908561_1_1754_A8144_RS08355,
5 NZ_CP029543_1_WP_010908561_1_1978_DIJ64_RS10070,
6 NZ_AP014567_1_WP_010908561_1_2031_JK2ML_RS10335
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07197084,2:0.07115962,3:0.07058054,4:0.07051019,5:0.06729459,6:0.06783734);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07197084,2:0.07115962,3:0.07058054,4:0.07051019,5:0.06729459,6:0.06783734);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -509.72 -512.97
2 -509.70 -513.14
--------------------------------------
TOTAL -509.71 -513.06
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896317 0.091299 0.370767 1.497552 0.861194 1301.42 1401.21 1.000
r(A<->C){all} 0.173371 0.021769 0.000006 0.477635 0.133155 230.30 287.97 1.000
r(A<->G){all} 0.158302 0.017592 0.000055 0.424371 0.125572 277.87 343.90 1.002
r(A<->T){all} 0.170954 0.019100 0.000026 0.444903 0.140646 201.74 239.85 1.000
r(C<->G){all} 0.163259 0.019414 0.000192 0.438593 0.125586 191.08 206.50 1.003
r(C<->T){all} 0.168732 0.020077 0.000066 0.443045 0.132555 179.13 221.88 1.001
r(G<->T){all} 0.165381 0.020818 0.000006 0.455956 0.126109 206.18 225.82 1.000
pi(A){all} 0.224445 0.000439 0.184482 0.267419 0.224292 1201.86 1297.81 1.002
pi(C){all} 0.332292 0.000589 0.286077 0.382628 0.331999 1048.97 1121.39 1.001
pi(G){all} 0.276871 0.000510 0.235466 0.324590 0.276586 1054.69 1097.69 1.000
pi(T){all} 0.166392 0.000364 0.129413 0.201974 0.165688 1062.95 1200.26 1.000
alpha{1,2} 0.412611 0.225093 0.000183 1.367010 0.242858 1091.46 1119.08 1.000
alpha{3} 0.459195 0.240542 0.000246 1.457568 0.306271 1288.39 1335.07 1.000
pinvar{all} 0.995592 0.000029 0.985125 0.999997 0.997325 1473.41 1487.20 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1829/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 125
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 4 4 4 4 4 4 | CGC 3 3 3 3 3 3
CTA 3 3 3 3 3 3 | CCA 2 2 2 2 2 2 | Gln CAA 2 2 2 2 2 2 | CGA 0 0 0 0 0 0
CTG 1 1 1 1 1 1 | CCG 6 6 6 6 6 6 | CAG 4 4 4 4 4 4 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 6 6 6 6 6 6 | ACC 11 11 11 11 11 11 | AAC 2 2 2 2 2 2 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 4 4 4 4 4 4 | Lys AAA 0 0 0 0 0 0 | Arg AGA 1 1 1 1 1 1
Met ATG 4 4 4 4 4 4 | ACG 3 3 3 3 3 3 | AAG 3 3 3 3 3 3 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 5 5 5 5 5 5 | Asp GAT 2 2 2 2 2 2 | Gly GGT 2 2 2 2 2 2
GTC 9 9 9 9 9 9 | GCC 2 2 2 2 2 2 | GAC 5 5 5 5 5 5 | GGC 4 4 4 4 4 4
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1
GTG 3 3 3 3 3 3 | GCG 2 2 2 2 2 2 | GAG 1 1 1 1 1 1 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908561_1_1953_MLBR_RS09270
position 1: T:0.09600 C:0.24000 A:0.32000 G:0.34400
position 2: T:0.27200 C:0.34400 A:0.20800 G:0.17600
position 3: T:0.12800 C:0.41600 A:0.14400 G:0.31200
Average T:0.16533 C:0.33333 A:0.22400 G:0.27733
#2: NC_002677_1_NP_302240_1_1112_ML1829
position 1: T:0.09600 C:0.24000 A:0.32000 G:0.34400
position 2: T:0.27200 C:0.34400 A:0.20800 G:0.17600
position 3: T:0.12800 C:0.41600 A:0.14400 G:0.31200
Average T:0.16533 C:0.33333 A:0.22400 G:0.27733
#3: NZ_LVXE01000061_1_WP_010908561_1_2389_A3216_RS12425
position 1: T:0.09600 C:0.24000 A:0.32000 G:0.34400
position 2: T:0.27200 C:0.34400 A:0.20800 G:0.17600
position 3: T:0.12800 C:0.41600 A:0.14400 G:0.31200
Average T:0.16533 C:0.33333 A:0.22400 G:0.27733
#4: NZ_LYPH01000044_1_WP_010908561_1_1754_A8144_RS08355
position 1: T:0.09600 C:0.24000 A:0.32000 G:0.34400
position 2: T:0.27200 C:0.34400 A:0.20800 G:0.17600
position 3: T:0.12800 C:0.41600 A:0.14400 G:0.31200
Average T:0.16533 C:0.33333 A:0.22400 G:0.27733
#5: NZ_CP029543_1_WP_010908561_1_1978_DIJ64_RS10070
position 1: T:0.09600 C:0.24000 A:0.32000 G:0.34400
position 2: T:0.27200 C:0.34400 A:0.20800 G:0.17600
position 3: T:0.12800 C:0.41600 A:0.14400 G:0.31200
Average T:0.16533 C:0.33333 A:0.22400 G:0.27733
#6: NZ_AP014567_1_WP_010908561_1_2031_JK2ML_RS10335
position 1: T:0.09600 C:0.24000 A:0.32000 G:0.34400
position 2: T:0.27200 C:0.34400 A:0.20800 G:0.17600
position 3: T:0.12800 C:0.41600 A:0.14400 G:0.31200
Average T:0.16533 C:0.33333 A:0.22400 G:0.27733
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 6 | TCC 0 | TAC 6 | TGC 12
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 24 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 6
CTC 6 | CCC 0 | CAC 24 | CGC 18
CTA 18 | CCA 12 | Gln Q CAA 12 | CGA 0
CTG 6 | CCG 36 | CAG 24 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 0
ATC 36 | ACC 66 | AAC 12 | AGC 6
ATA 0 | ACA 24 | Lys K AAA 0 | Arg R AGA 6
Met M ATG 24 | ACG 18 | AAG 18 | AGG 12
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 30 | Asp D GAT 12 | Gly G GGT 12
GTC 54 | GCC 12 | GAC 30 | GGC 24
GTA 6 | GCA 12 | Glu E GAA 6 | GGA 6
GTG 18 | GCG 12 | GAG 6 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09600 C:0.24000 A:0.32000 G:0.34400
position 2: T:0.27200 C:0.34400 A:0.20800 G:0.17600
position 3: T:0.12800 C:0.41600 A:0.14400 G:0.31200
Average T:0.16533 C:0.33333 A:0.22400 G:0.27733
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -488.955340 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299834 1.300017
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908561_1_1953_MLBR_RS09270: 0.000004, NC_002677_1_NP_302240_1_1112_ML1829: 0.000004, NZ_LVXE01000061_1_WP_010908561_1_2389_A3216_RS12425: 0.000004, NZ_LYPH01000044_1_WP_010908561_1_1754_A8144_RS08355: 0.000004, NZ_CP029543_1_WP_010908561_1_1978_DIJ64_RS10070: 0.000004, NZ_AP014567_1_WP_010908561_1_2031_JK2ML_RS10335: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29983
omega (dN/dS) = 1.30002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 284.2 90.8 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 284.2 90.8 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 284.2 90.8 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 284.2 90.8 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 284.2 90.8 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 284.2 90.8 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -488.955332 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.316159 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908561_1_1953_MLBR_RS09270: 0.000004, NC_002677_1_NP_302240_1_1112_ML1829: 0.000004, NZ_LVXE01000061_1_WP_010908561_1_2389_A3216_RS12425: 0.000004, NZ_LYPH01000044_1_WP_010908561_1_1754_A8144_RS08355: 0.000004, NZ_CP029543_1_WP_010908561_1_1978_DIJ64_RS10070: 0.000004, NZ_AP014567_1_WP_010908561_1_2031_JK2ML_RS10335: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.31616 0.68384
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 284.5 90.5 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 284.5 90.5 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 284.5 90.5 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 284.5 90.5 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 284.5 90.5 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 284.5 90.5 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -488.955330 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.951073 0.000001 91.627172
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908561_1_1953_MLBR_RS09270: 0.000004, NC_002677_1_NP_302240_1_1112_ML1829: 0.000004, NZ_LVXE01000061_1_WP_010908561_1_2389_A3216_RS12425: 0.000004, NZ_LYPH01000044_1_WP_010908561_1_1754_A8144_RS08355: 0.000004, NZ_CP029543_1_WP_010908561_1_1978_DIJ64_RS10070: 0.000004, NZ_AP014567_1_WP_010908561_1_2031_JK2ML_RS10335: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.95107 0.04893
w: 0.00000 1.00000 91.62717
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 284.5 90.5 5.4341 0.0000 0.0000 0.0 0.0
7..2 0.000 284.5 90.5 5.4341 0.0000 0.0000 0.0 0.0
7..3 0.000 284.5 90.5 5.4341 0.0000 0.0000 0.0 0.0
7..4 0.000 284.5 90.5 5.4341 0.0000 0.0000 0.0 0.0
7..5 0.000 284.5 90.5 5.4341 0.0000 0.0000 0.0 0.0
7..6 0.000 284.5 90.5 5.4341 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908561_1_1953_MLBR_RS09270)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908561_1_1953_MLBR_RS09270)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -488.955334 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.672125 1.825203
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908561_1_1953_MLBR_RS09270: 0.000004, NC_002677_1_NP_302240_1_1112_ML1829: 0.000004, NZ_LVXE01000061_1_WP_010908561_1_2389_A3216_RS12425: 0.000004, NZ_LYPH01000044_1_WP_010908561_1_1754_A8144_RS08355: 0.000004, NZ_CP029543_1_WP_010908561_1_1978_DIJ64_RS10070: 0.000004, NZ_AP014567_1_WP_010908561_1_2031_JK2ML_RS10335: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.67212 q = 1.82520
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00597 0.03101 0.06755 0.11414 0.17092 0.23908 0.32104 0.42160 0.55140 0.74642
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 284.5 90.5 0.2669 0.0000 0.0000 0.0 0.0
7..2 0.000 284.5 90.5 0.2669 0.0000 0.0000 0.0 0.0
7..3 0.000 284.5 90.5 0.2669 0.0000 0.0000 0.0 0.0
7..4 0.000 284.5 90.5 0.2669 0.0000 0.0000 0.0 0.0
7..5 0.000 284.5 90.5 0.2669 0.0000 0.0000 0.0 0.0
7..6 0.000 284.5 90.5 0.2669 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -488.955333 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.659290 0.005000 1.158045 1.591805
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908561_1_1953_MLBR_RS09270: 0.000004, NC_002677_1_NP_302240_1_1112_ML1829: 0.000004, NZ_LVXE01000061_1_WP_010908561_1_2389_A3216_RS12425: 0.000004, NZ_LYPH01000044_1_WP_010908561_1_1754_A8144_RS08355: 0.000004, NZ_CP029543_1_WP_010908561_1_1978_DIJ64_RS10070: 0.000004, NZ_AP014567_1_WP_010908561_1_2031_JK2ML_RS10335: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.65929 p = 0.00500 q = 1.15805
(p1 = 0.34071) w = 1.59181
MLEs of dN/dS (w) for site classes (K=11)
p: 0.06593 0.06593 0.06593 0.06593 0.06593 0.06593 0.06593 0.06593 0.06593 0.06593 0.34071
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 1.59181
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 284.5 90.5 0.5423 0.0000 0.0000 0.0 0.0
7..2 0.000 284.5 90.5 0.5423 0.0000 0.0000 0.0 0.0
7..3 0.000 284.5 90.5 0.5423 0.0000 0.0000 0.0 0.0
7..4 0.000 284.5 90.5 0.5423 0.0000 0.0000 0.0 0.0
7..5 0.000 284.5 90.5 0.5423 0.0000 0.0000 0.0 0.0
7..6 0.000 284.5 90.5 0.5423 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908561_1_1953_MLBR_RS09270)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908561_1_1953_MLBR_RS09270)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:12
Model 1: NearlyNeutral -488.955332 Model 2: PositiveSelection -488.95533 Model 0: one-ratio -488.95534 Model 7: beta -488.955334 Model 8: beta&w>1 -488.955333 Model 0 vs 1 1.5999999959603883E-5 Model 2 vs 1 3.999999989900971E-6 Model 8 vs 7 1.9999999949504854E-6
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
