--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:54:13 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1829/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -509.72 -512.97
2 -509.70 -513.14
--------------------------------------
TOTAL -509.71 -513.06
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896317 0.091299 0.370767 1.497552 0.861194 1301.42 1401.21 1.000
r(A<->C){all} 0.173371 0.021769 0.000006 0.477635 0.133155 230.30 287.97 1.000
r(A<->G){all} 0.158302 0.017592 0.000055 0.424371 0.125572 277.87 343.90 1.002
r(A<->T){all} 0.170954 0.019100 0.000026 0.444903 0.140646 201.74 239.85 1.000
r(C<->G){all} 0.163259 0.019414 0.000192 0.438593 0.125586 191.08 206.50 1.003
r(C<->T){all} 0.168732 0.020077 0.000066 0.443045 0.132555 179.13 221.88 1.001
r(G<->T){all} 0.165381 0.020818 0.000006 0.455956 0.126109 206.18 225.82 1.000
pi(A){all} 0.224445 0.000439 0.184482 0.267419 0.224292 1201.86 1297.81 1.002
pi(C){all} 0.332292 0.000589 0.286077 0.382628 0.331999 1048.97 1121.39 1.001
pi(G){all} 0.276871 0.000510 0.235466 0.324590 0.276586 1054.69 1097.69 1.000
pi(T){all} 0.166392 0.000364 0.129413 0.201974 0.165688 1062.95 1200.26 1.000
alpha{1,2} 0.412611 0.225093 0.000183 1.367010 0.242858 1091.46 1119.08 1.000
alpha{3} 0.459195 0.240542 0.000246 1.457568 0.306271 1288.39 1335.07 1.000
pinvar{all} 0.995592 0.000029 0.985125 0.999997 0.997325 1473.41 1487.20 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -488.955332
Model 2: PositiveSelection -488.95533
Model 0: one-ratio -488.95534
Model 7: beta -488.955334
Model 8: beta&w>1 -488.955333
Model 0 vs 1 1.5999999959603883E-5
Model 2 vs 1 3.999999989900971E-6
Model 8 vs 7 1.9999999949504854E-6
>C1
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C2
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C3
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C4
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C5
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C6
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=125
C1 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C2 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C3 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C4 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C5 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C6 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
**************************************************
C1 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C2 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C3 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C4 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C5 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C6 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
**************************************************
C1 FGVDNHVDAEWLKLTSLGLRPRAIR
C2 FGVDNHVDAEWLKLTSLGLRPRAIR
C3 FGVDNHVDAEWLKLTSLGLRPRAIR
C4 FGVDNHVDAEWLKLTSLGLRPRAIR
C5 FGVDNHVDAEWLKLTSLGLRPRAIR
C6 FGVDNHVDAEWLKLTSLGLRPRAIR
*************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 125 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 125 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3750]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3750]--->[3750]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.460 Mb, Max= 30.654 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C2 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C3 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C4 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C5 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
C6 VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
**************************************************
C1 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C2 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C3 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C4 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C5 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
C6 GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
**************************************************
C1 FGVDNHVDAEWLKLTSLGLRPRAIR
C2 FGVDNHVDAEWLKLTSLGLRPRAIR
C3 FGVDNHVDAEWLKLTSLGLRPRAIR
C4 FGVDNHVDAEWLKLTSLGLRPRAIR
C5 FGVDNHVDAEWLKLTSLGLRPRAIR
C6 FGVDNHVDAEWLKLTSLGLRPRAIR
*************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
C2 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
C3 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
C4 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
C5 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
C6 GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
**************************************************
C1 ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
C2 ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
C3 ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
C4 ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
C5 ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
C6 ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
**************************************************
C1 ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
C2 ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
C3 ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
C4 ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
C5 ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
C6 ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
**************************************************
C1 GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
C2 GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
C3 GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
C4 GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
C5 GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
C6 GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
**************************************************
C1 CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
C2 CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
C3 CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
C4 CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
C5 CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
C6 CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
**************************************************
C1 ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
C2 ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
C3 ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
C4 ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
C5 ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
C6 ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
**************************************************
C1 TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
C2 TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
C3 TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
C4 TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
C5 TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
C6 TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
**************************************************
C1 AGGCCTTAGGCCGCGTGCAATTAGG
C2 AGGCCTTAGGCCGCGTGCAATTAGG
C3 AGGCCTTAGGCCGCGTGCAATTAGG
C4 AGGCCTTAGGCCGCGTGCAATTAGG
C5 AGGCCTTAGGCCGCGTGCAATTAGG
C6 AGGCCTTAGGCCGCGTGCAATTAGG
*************************
>C1
GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
AGGCCTTAGGCCGCGTGCAATTAGG
>C2
GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
AGGCCTTAGGCCGCGTGCAATTAGG
>C3
GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
AGGCCTTAGGCCGCGTGCAATTAGG
>C4
GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
AGGCCTTAGGCCGCGTGCAATTAGG
>C5
GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
AGGCCTTAGGCCGCGTGCAATTAGG
>C6
GTGCGCTGCAGCGCTTCGGCCCCGGGGCTAACCGGCGACCTGGCACACGG
ACAACAGATCACGGTACCGGTCACAAGACCGTATTCGGCGTCGACCACTC
ACTTGGGGATGATCACCACACTAAAGCAGACCGCTGGTGTCGCTGACACC
GGCGACACCGTCACCCCGCGGATCCGCCAACGCGTCACCGTCGGGAAGAT
CACCGAGTACACGCCGGGTCAGCAGGTCAACGTGGCGGCTGTGATCACAG
ATCACCCTGATATGATGGTCACCACGGCTCCAACAATCTGCATTATGCCA
TTCGGCGTCGACAACCACGTCGACGCCGAATGGCTAAAGCTCACCTCGTT
AGGCCTTAGGCCGCGTGCAATTAGG
>C1
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C2
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C3
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C4
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C5
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
>C6
VRCSASAPGLTGDLAHGQQITVPVTRPYSASTTHLGMITTLKQTAGVADT
GDTVTPRIRQRVTVGKITEYTPGQQVNVAAVITDHPDMMVTTAPTICIMP
FGVDNHVDAEWLKLTSLGLRPRAIR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 375 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579859576
Setting output file names to "/data/7res/ML1829/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 119450550
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5299824772
Seed = 1845484020
Swapseed = 1579859576
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -839.267981 -- -24.965149
Chain 2 -- -839.267933 -- -24.965149
Chain 3 -- -839.267981 -- -24.965149
Chain 4 -- -839.267933 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -839.267933 -- -24.965149
Chain 2 -- -839.267981 -- -24.965149
Chain 3 -- -839.267981 -- -24.965149
Chain 4 -- -839.267981 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-839.268] (-839.268) (-839.268) (-839.268) * [-839.268] (-839.268) (-839.268) (-839.268)
500 -- (-522.676) (-520.007) (-530.036) [-520.075] * (-527.828) (-515.009) (-528.880) [-531.408] -- 0:00:00
1000 -- (-518.820) (-515.527) (-520.184) [-519.297] * (-521.667) (-523.264) [-518.512] (-518.394) -- 0:00:00
1500 -- (-522.159) (-523.459) (-515.860) [-517.241] * (-522.895) (-525.974) [-524.969] (-523.204) -- 0:00:00
2000 -- (-526.384) (-516.951) [-520.785] (-514.840) * (-518.632) (-516.333) (-524.640) [-515.088] -- 0:00:00
2500 -- [-521.798] (-525.609) (-516.155) (-521.425) * (-521.064) (-519.982) [-521.867] (-524.842) -- 0:00:00
3000 -- (-520.342) [-520.642] (-524.186) (-523.755) * (-521.019) [-516.134] (-514.228) (-526.419) -- 0:00:00
3500 -- (-525.578) (-526.141) (-512.925) [-518.880] * (-521.969) (-516.320) (-518.217) [-519.339] -- 0:00:00
4000 -- (-527.410) [-516.031] (-522.127) (-516.658) * (-520.038) (-516.684) (-521.998) [-518.551] -- 0:00:00
4500 -- (-514.822) (-517.134) [-519.956] (-521.173) * (-518.161) [-516.789] (-519.346) (-520.525) -- 0:00:00
5000 -- [-521.166] (-516.539) (-515.581) (-517.363) * (-524.961) (-522.046) [-520.306] (-514.843) -- 0:00:00
Average standard deviation of split frequencies: 0.081983
5500 -- (-520.278) (-519.113) (-524.054) [-521.266] * (-516.984) (-523.335) (-518.325) [-517.909] -- 0:00:00
6000 -- (-514.897) (-523.935) (-518.806) [-519.873] * (-519.867) (-522.722) [-521.761] (-520.846) -- 0:00:00
6500 -- [-520.083] (-516.176) (-520.396) (-532.468) * (-530.188) [-516.521] (-522.387) (-520.853) -- 0:00:00
7000 -- (-527.398) (-528.093) (-519.422) [-520.525] * (-519.378) (-521.353) [-520.867] (-524.231) -- 0:00:00
7500 -- [-519.598] (-525.053) (-516.958) (-530.598) * (-523.566) (-521.021) [-522.512] (-520.792) -- 0:02:12
8000 -- (-523.103) (-521.773) (-520.342) [-524.089] * (-524.931) (-516.357) (-524.206) [-517.522] -- 0:02:04
8500 -- (-528.786) (-525.615) (-529.446) [-532.374] * (-510.781) [-517.584] (-525.305) (-519.987) -- 0:01:56
9000 -- [-525.836] (-511.850) (-522.839) (-529.609) * (-509.329) (-524.999) (-530.279) [-516.715] -- 0:01:50
9500 -- [-526.085] (-524.159) (-521.897) (-517.655) * (-513.194) (-517.046) [-516.995] (-524.833) -- 0:01:44
10000 -- [-517.140] (-522.234) (-521.024) (-514.442) * (-513.279) (-521.383) [-520.014] (-518.202) -- 0:01:39
Average standard deviation of split frequencies: 0.064991
10500 -- [-516.269] (-547.162) (-524.558) (-511.632) * (-515.241) (-518.292) [-520.819] (-526.008) -- 0:01:34
11000 -- (-521.209) (-520.036) (-524.123) [-513.732] * (-510.295) (-523.065) (-519.912) [-512.190] -- 0:01:29
11500 -- (-525.287) (-517.209) (-528.461) [-509.974] * (-510.953) (-518.871) [-518.114] (-510.269) -- 0:01:25
12000 -- (-526.772) [-513.271] (-531.906) (-509.819) * (-510.846) [-523.328] (-519.172) (-510.042) -- 0:01:22
12500 -- (-523.799) (-508.774) (-522.399) [-509.974] * (-511.053) (-517.821) [-515.540] (-515.666) -- 0:01:19
13000 -- [-521.590] (-510.801) (-520.219) (-509.800) * (-516.819) (-519.191) [-518.308] (-511.161) -- 0:01:15
13500 -- (-514.316) [-510.501] (-526.054) (-513.497) * (-510.096) (-535.586) (-524.471) [-510.887] -- 0:01:13
14000 -- [-519.905] (-512.236) (-517.325) (-508.825) * (-509.014) [-521.478] (-516.546) (-510.448) -- 0:01:10
14500 -- (-517.552) (-510.303) (-523.602) [-510.802] * (-509.694) [-524.621] (-519.735) (-515.176) -- 0:01:07
15000 -- (-518.838) (-510.416) (-516.764) [-509.670] * [-511.088] (-541.252) (-518.127) (-514.267) -- 0:01:05
Average standard deviation of split frequencies: 0.051560
15500 -- (-515.544) [-510.811] (-520.538) (-508.838) * (-509.556) (-524.422) [-521.035] (-511.229) -- 0:01:03
16000 -- (-521.379) (-510.888) [-516.164] (-511.405) * (-510.603) [-508.518] (-528.279) (-511.391) -- 0:01:01
16500 -- (-519.009) (-509.289) [-516.304] (-512.036) * (-513.584) [-508.782] (-517.759) (-510.530) -- 0:00:59
17000 -- (-527.334) [-510.217] (-523.329) (-509.124) * [-508.590] (-510.358) (-522.656) (-510.005) -- 0:00:57
17500 -- (-514.165) [-508.562] (-529.223) (-513.356) * [-511.672] (-509.257) (-515.234) (-510.039) -- 0:00:56
18000 -- (-521.284) (-510.720) (-528.972) [-510.661] * [-510.488] (-512.028) (-512.835) (-512.806) -- 0:00:54
18500 -- (-522.998) (-514.511) [-517.776] (-511.313) * [-510.395] (-510.271) (-522.783) (-509.341) -- 0:00:53
19000 -- (-519.186) (-512.573) (-525.852) [-509.186] * (-510.302) [-510.417] (-517.870) (-508.855) -- 0:00:51
19500 -- (-523.299) [-517.156] (-515.100) (-510.511) * [-508.561] (-509.150) (-522.217) (-513.014) -- 0:00:50
20000 -- (-527.326) (-511.927) (-525.153) [-508.824] * (-509.680) (-512.233) (-513.662) [-512.839] -- 0:00:49
Average standard deviation of split frequencies: 0.059876
20500 -- [-515.824] (-510.183) (-522.702) (-508.843) * (-510.723) (-511.002) [-514.554] (-510.204) -- 0:00:47
21000 -- [-517.250] (-508.562) (-518.409) (-510.532) * (-510.199) [-509.514] (-517.201) (-510.148) -- 0:00:46
21500 -- (-520.840) [-510.969] (-520.850) (-509.298) * (-509.687) (-509.501) (-519.520) [-511.285] -- 0:00:45
22000 -- (-520.683) [-509.611] (-516.662) (-508.811) * (-508.296) (-509.045) [-521.901] (-509.776) -- 0:01:28
22500 -- [-513.907] (-510.572) (-528.416) (-508.865) * (-510.743) (-508.562) (-525.276) [-508.753] -- 0:01:26
23000 -- (-519.152) (-510.760) [-517.932] (-512.287) * [-508.276] (-510.706) (-527.379) (-509.856) -- 0:01:24
23500 -- (-519.325) [-509.046] (-516.855) (-511.221) * (-511.101) (-513.003) [-514.542] (-511.839) -- 0:01:23
24000 -- (-518.614) (-512.917) [-520.064] (-513.262) * (-514.320) (-510.184) [-514.116] (-512.897) -- 0:01:21
24500 -- (-521.060) (-511.712) (-522.095) [-513.219] * (-511.858) (-509.671) (-519.788) [-509.199] -- 0:01:19
25000 -- (-518.674) (-510.691) (-522.782) [-509.373] * (-513.523) (-510.272) (-512.898) [-509.134] -- 0:01:18
Average standard deviation of split frequencies: 0.043061
25500 -- (-516.803) (-511.879) (-524.815) [-510.468] * (-512.336) [-510.199] (-519.120) (-512.624) -- 0:01:16
26000 -- (-522.456) (-509.706) [-514.808] (-510.499) * (-511.679) (-510.152) (-521.859) [-513.498] -- 0:01:14
26500 -- [-519.363] (-511.052) (-521.748) (-508.823) * (-514.149) (-510.160) [-521.879] (-510.581) -- 0:01:13
27000 -- (-518.614) (-510.982) [-523.372] (-512.846) * [-509.841] (-509.566) (-520.104) (-508.805) -- 0:01:12
27500 -- [-520.525] (-511.090) (-519.686) (-511.384) * [-509.357] (-511.826) (-526.652) (-510.934) -- 0:01:10
28000 -- [-518.853] (-511.541) (-522.204) (-509.894) * [-509.263] (-509.583) (-519.233) (-509.001) -- 0:01:09
28500 -- (-519.624) (-509.695) [-516.788] (-509.612) * (-512.110) [-510.905] (-518.833) (-510.276) -- 0:01:08
29000 -- (-518.937) (-509.312) [-514.258] (-512.158) * [-509.385] (-508.574) (-519.035) (-511.825) -- 0:01:06
29500 -- [-512.488] (-509.682) (-522.323) (-509.547) * (-510.128) (-512.756) [-516.896] (-511.747) -- 0:01:05
30000 -- (-518.841) (-509.367) [-516.084] (-509.489) * (-511.322) [-512.779] (-519.985) (-510.342) -- 0:01:04
Average standard deviation of split frequencies: 0.043689
30500 -- (-515.823) [-513.210] (-528.167) (-511.237) * (-509.841) (-511.228) (-526.094) [-513.162] -- 0:01:03
31000 -- (-527.116) [-508.673] (-516.017) (-511.022) * (-513.384) [-511.970] (-526.064) (-510.978) -- 0:01:02
31500 -- (-517.993) [-509.723] (-529.915) (-509.386) * (-510.377) (-514.236) [-517.969] (-508.283) -- 0:01:01
32000 -- (-521.949) [-510.207] (-531.264) (-509.082) * (-508.945) (-511.237) [-522.494] (-512.949) -- 0:01:00
32500 -- [-519.100] (-510.371) (-510.562) (-510.371) * (-509.052) [-509.785] (-533.258) (-514.549) -- 0:00:59
33000 -- (-519.639) (-513.109) [-512.283] (-510.274) * (-508.713) (-509.042) (-526.293) [-510.234] -- 0:00:58
33500 -- (-520.366) (-510.109) (-512.550) [-510.897] * (-509.102) (-513.645) [-516.066] (-513.912) -- 0:00:57
34000 -- (-549.052) (-511.399) (-508.648) [-510.558] * (-510.795) (-509.653) [-520.329] (-513.486) -- 0:00:56
34500 -- (-514.635) [-508.300] (-509.526) (-512.614) * [-513.343] (-514.041) (-528.355) (-509.759) -- 0:00:55
35000 -- (-511.927) (-512.192) (-510.662) [-509.150] * (-510.691) (-509.240) (-519.901) [-510.167] -- 0:00:55
Average standard deviation of split frequencies: 0.031703
35500 -- (-513.817) [-509.064] (-513.821) (-508.652) * (-511.048) [-508.467] (-515.060) (-511.476) -- 0:00:54
36000 -- (-511.843) [-515.033] (-508.730) (-509.277) * (-515.040) (-513.247) [-523.297] (-509.447) -- 0:00:53
36500 -- (-508.545) (-510.419) (-509.090) [-510.116] * (-509.217) (-517.411) [-521.845] (-510.004) -- 0:00:52
37000 -- [-509.560] (-514.117) (-509.892) (-511.342) * [-511.834] (-510.265) (-529.000) (-515.460) -- 0:00:52
37500 -- (-509.981) [-509.243] (-509.744) (-510.930) * (-514.118) [-511.105] (-519.010) (-509.988) -- 0:00:51
38000 -- (-510.014) [-510.035] (-510.012) (-508.688) * [-517.099] (-514.175) (-516.312) (-510.388) -- 0:00:50
38500 -- (-509.194) (-511.830) (-511.602) [-512.923] * (-513.011) (-512.907) (-516.094) [-509.505] -- 0:01:14
39000 -- (-513.831) [-509.804] (-510.485) (-511.495) * [-508.752] (-510.727) (-522.168) (-514.142) -- 0:01:13
39500 -- (-509.219) (-516.897) (-510.134) [-509.590] * (-510.417) (-513.076) [-521.570] (-513.756) -- 0:01:12
40000 -- (-508.707) (-510.239) (-509.793) [-510.546] * (-511.185) [-508.848] (-522.904) (-511.479) -- 0:01:12
Average standard deviation of split frequencies: 0.028980
40500 -- (-509.426) [-511.615] (-514.042) (-510.601) * [-511.259] (-512.215) (-529.701) (-513.342) -- 0:01:11
41000 -- (-509.545) (-508.850) (-510.861) [-509.251] * (-511.539) [-509.441] (-526.821) (-514.542) -- 0:01:10
41500 -- [-512.358] (-509.642) (-509.597) (-513.009) * [-510.483] (-509.175) (-519.600) (-512.342) -- 0:01:09
42000 -- (-511.175) (-513.073) [-510.173] (-512.869) * (-510.526) (-510.050) [-515.893] (-516.260) -- 0:01:08
42500 -- (-511.157) (-513.026) (-512.491) [-510.634] * (-511.386) (-508.493) [-517.722] (-513.174) -- 0:01:07
43000 -- [-509.808] (-511.916) (-516.160) (-510.149) * (-512.066) (-509.145) [-527.024] (-512.061) -- 0:01:06
43500 -- (-511.135) [-509.000] (-508.843) (-513.670) * (-512.412) (-513.693) (-521.116) [-510.184] -- 0:01:05
44000 -- (-512.213) (-509.172) (-508.931) [-509.160] * [-512.268] (-513.754) (-523.081) (-512.939) -- 0:01:05
44500 -- (-512.009) (-508.603) (-509.001) [-510.275] * (-516.379) (-512.911) (-513.699) [-513.841] -- 0:01:04
45000 -- (-514.037) (-508.847) (-509.823) [-510.300] * (-514.296) [-510.013] (-520.273) (-514.870) -- 0:01:03
Average standard deviation of split frequencies: 0.025620
45500 -- (-514.515) [-509.165] (-508.633) (-510.309) * (-510.430) [-509.495] (-516.889) (-511.539) -- 0:01:02
46000 -- (-510.694) [-510.310] (-509.282) (-512.124) * (-513.351) [-509.530] (-516.278) (-509.857) -- 0:01:02
46500 -- [-509.023] (-510.326) (-510.281) (-513.191) * (-514.427) (-508.901) (-517.716) [-509.988] -- 0:01:01
47000 -- (-509.698) [-509.822] (-510.529) (-509.074) * (-508.957) (-509.594) (-520.985) [-511.547] -- 0:01:00
47500 -- (-509.036) (-511.263) [-508.290] (-510.908) * (-510.229) (-508.944) [-512.855] (-511.646) -- 0:01:00
48000 -- [-513.690] (-510.627) (-511.860) (-511.984) * (-511.586) (-511.854) [-515.602] (-511.407) -- 0:00:59
48500 -- (-511.888) [-509.254] (-509.910) (-510.815) * (-512.821) [-510.524] (-518.718) (-514.998) -- 0:00:58
49000 -- (-511.234) (-512.736) (-512.370) [-510.760] * (-509.384) [-510.145] (-519.179) (-509.806) -- 0:00:58
49500 -- (-508.299) (-510.450) (-508.613) [-508.969] * [-510.047] (-508.895) (-519.230) (-513.224) -- 0:00:57
50000 -- (-510.470) [-511.510] (-512.110) (-508.720) * (-509.137) [-512.281] (-520.858) (-509.397) -- 0:00:57
Average standard deviation of split frequencies: 0.029604
50500 -- (-509.362) (-510.438) (-510.345) [-510.717] * (-509.616) (-511.716) [-516.462] (-508.689) -- 0:00:56
51000 -- (-509.918) (-509.572) [-508.400] (-514.594) * (-512.075) (-510.148) [-520.576] (-509.706) -- 0:00:55
51500 -- (-508.934) [-510.785] (-509.778) (-510.996) * [-511.459] (-517.281) (-519.120) (-508.336) -- 0:00:55
52000 -- (-509.781) (-513.329) [-509.181] (-509.198) * (-511.128) (-513.729) [-516.212] (-510.486) -- 0:00:54
52500 -- [-511.636] (-511.397) (-508.740) (-508.939) * (-510.964) (-512.477) [-518.065] (-509.973) -- 0:00:54
53000 -- (-510.905) (-514.569) (-509.264) [-508.887] * (-510.370) (-516.749) (-523.748) [-511.489] -- 0:00:53
53500 -- (-514.591) (-510.522) (-509.670) [-508.544] * (-512.954) (-512.516) (-520.265) [-513.704] -- 0:00:53
54000 -- [-508.880] (-513.939) (-513.947) (-512.757) * (-510.178) (-511.718) (-517.728) [-511.138] -- 0:00:52
54500 -- [-510.640] (-509.685) (-509.885) (-508.659) * [-511.000] (-508.853) (-522.770) (-511.453) -- 0:00:52
55000 -- (-510.600) (-509.044) (-513.273) [-511.208] * (-510.460) (-510.163) (-538.412) [-508.903] -- 0:01:08
Average standard deviation of split frequencies: 0.029884
55500 -- (-509.266) (-511.208) [-514.079] (-508.910) * (-511.721) [-510.983] (-527.050) (-509.036) -- 0:01:08
56000 -- (-509.433) (-508.456) [-509.736] (-509.715) * (-509.692) (-509.677) (-510.925) [-508.526] -- 0:01:07
56500 -- (-509.411) (-509.374) [-510.477] (-509.969) * (-511.672) [-509.109] (-510.773) (-514.969) -- 0:01:06
57000 -- (-509.732) (-510.091) [-511.656] (-515.053) * (-509.228) [-509.160] (-511.270) (-510.747) -- 0:01:06
57500 -- (-509.605) (-510.180) (-509.803) [-510.664] * (-512.875) (-509.130) (-514.337) [-509.303] -- 0:01:05
58000 -- (-510.105) [-511.638] (-511.445) (-510.471) * (-509.731) (-510.334) (-513.686) [-511.170] -- 0:01:04
58500 -- (-510.264) (-510.217) (-515.320) [-510.029] * [-508.626] (-511.016) (-512.731) (-513.260) -- 0:01:04
59000 -- (-514.723) (-510.272) (-511.231) [-513.016] * [-509.312] (-515.422) (-512.456) (-511.369) -- 0:01:03
59500 -- (-509.675) [-510.106] (-512.909) (-510.685) * (-510.302) (-509.287) (-512.883) [-509.849] -- 0:01:03
60000 -- (-511.660) (-510.472) (-509.341) [-510.314] * (-510.439) (-509.466) [-509.886] (-509.872) -- 0:01:02
Average standard deviation of split frequencies: 0.028121
60500 -- (-509.426) [-509.681] (-509.509) (-511.171) * (-510.348) (-510.125) [-510.663] (-510.801) -- 0:01:02
61000 -- (-510.507) [-509.537] (-509.547) (-512.965) * [-511.522] (-511.137) (-514.027) (-509.108) -- 0:01:01
61500 -- (-512.486) (-509.240) [-509.852] (-510.725) * (-511.406) (-509.566) [-512.844] (-508.360) -- 0:01:01
62000 -- (-510.835) [-510.205] (-509.936) (-513.963) * (-510.426) [-509.430] (-510.660) (-510.138) -- 0:01:00
62500 -- (-512.007) (-516.024) (-514.122) [-509.327] * (-510.587) [-511.400] (-512.418) (-512.258) -- 0:01:00
63000 -- [-511.386] (-509.524) (-509.361) (-511.815) * (-512.299) [-508.968] (-510.325) (-510.864) -- 0:00:59
63500 -- (-509.686) (-511.790) [-509.179] (-509.188) * (-509.970) [-508.232] (-510.115) (-510.953) -- 0:00:58
64000 -- (-510.987) (-508.701) [-509.221] (-509.585) * [-512.698] (-509.483) (-509.993) (-512.074) -- 0:00:58
64500 -- (-509.248) (-510.024) (-510.151) [-510.135] * (-511.213) [-508.279] (-509.473) (-512.421) -- 0:00:58
65000 -- (-509.479) (-511.436) [-509.073] (-509.179) * (-510.988) (-509.582) [-509.640] (-511.429) -- 0:00:57
Average standard deviation of split frequencies: 0.024025
65500 -- (-512.316) [-510.793] (-508.966) (-509.135) * (-514.032) [-509.478] (-511.924) (-510.734) -- 0:00:57
66000 -- [-509.908] (-510.662) (-509.062) (-510.676) * (-510.384) [-509.537] (-509.465) (-509.815) -- 0:00:56
66500 -- (-509.736) [-509.915] (-510.079) (-512.600) * (-512.002) [-509.451] (-510.757) (-509.586) -- 0:00:56
67000 -- (-511.342) [-512.665] (-509.791) (-510.475) * (-508.753) [-512.080] (-512.594) (-513.640) -- 0:00:55
67500 -- (-508.415) (-512.263) (-509.203) [-509.375] * (-510.223) [-511.235] (-509.924) (-509.793) -- 0:00:55
68000 -- (-509.666) (-514.389) [-508.787] (-508.472) * (-509.104) [-513.102] (-509.694) (-510.574) -- 0:00:54
68500 -- (-510.102) (-509.247) (-510.310) [-509.595] * (-514.905) (-511.303) [-508.640] (-510.980) -- 0:00:54
69000 -- (-511.048) [-508.951] (-513.869) (-511.723) * [-515.658] (-513.525) (-508.119) (-509.240) -- 0:00:53
69500 -- (-510.385) [-511.704] (-513.353) (-509.209) * (-513.780) [-512.153] (-508.454) (-509.229) -- 0:00:53
70000 -- (-509.572) [-511.561] (-510.363) (-510.758) * (-514.085) [-508.873] (-509.167) (-508.478) -- 0:00:53
Average standard deviation of split frequencies: 0.028790
70500 -- (-508.961) [-510.461] (-510.964) (-515.707) * [-508.678] (-513.332) (-509.883) (-514.265) -- 0:00:52
71000 -- [-508.364] (-509.094) (-509.764) (-512.704) * (-509.186) (-509.376) [-508.643] (-511.661) -- 0:00:52
71500 -- (-509.003) (-511.124) [-511.119] (-509.748) * [-512.302] (-508.811) (-509.176) (-510.538) -- 0:00:51
72000 -- (-509.778) (-508.527) (-510.854) [-510.296] * [-509.572] (-509.862) (-509.031) (-511.582) -- 0:01:04
72500 -- (-512.006) (-511.150) [-510.833] (-511.486) * (-509.924) [-510.528] (-510.286) (-511.480) -- 0:01:03
73000 -- (-511.318) (-509.098) [-511.544] (-510.764) * [-512.244] (-510.537) (-508.398) (-508.868) -- 0:01:03
73500 -- (-512.260) (-509.532) [-509.385] (-509.660) * (-509.975) [-509.407] (-509.774) (-511.521) -- 0:01:03
74000 -- (-509.646) [-508.363] (-509.447) (-511.186) * (-517.081) (-510.411) (-511.651) [-510.941] -- 0:01:02
74500 -- [-509.681] (-509.700) (-511.072) (-509.323) * (-512.636) (-509.307) (-510.581) [-512.894] -- 0:01:02
75000 -- [-508.190] (-510.018) (-510.796) (-508.955) * (-512.705) (-509.482) (-511.923) [-511.407] -- 0:01:01
Average standard deviation of split frequencies: 0.031666
75500 -- [-511.376] (-508.674) (-508.739) (-509.205) * (-510.884) (-509.811) [-508.970] (-510.571) -- 0:01:01
76000 -- (-508.491) (-508.503) (-509.159) [-509.691] * (-511.613) [-510.313] (-509.129) (-509.317) -- 0:01:00
76500 -- (-511.166) [-510.660] (-510.003) (-509.785) * (-510.232) (-512.151) (-512.345) [-509.213] -- 0:01:00
77000 -- [-508.837] (-511.114) (-508.921) (-512.021) * (-512.203) (-515.505) [-510.731] (-513.859) -- 0:00:59
77500 -- (-511.497) (-508.799) (-514.838) [-511.257] * (-509.624) (-510.968) [-509.764] (-511.703) -- 0:00:59
78000 -- (-512.384) (-512.269) [-513.166] (-509.806) * (-510.010) (-510.525) [-509.896] (-510.667) -- 0:00:59
78500 -- (-510.432) (-512.916) [-509.514] (-512.944) * (-511.559) (-512.777) (-510.362) [-513.823] -- 0:00:58
79000 -- (-511.228) (-523.133) (-513.061) [-508.789] * [-511.306] (-512.288) (-509.003) (-509.268) -- 0:00:58
79500 -- [-509.234] (-510.754) (-514.537) (-510.757) * (-509.270) [-510.881] (-510.730) (-509.562) -- 0:00:57
80000 -- (-512.097) (-513.157) (-516.284) [-509.833] * (-509.062) (-510.789) [-509.849] (-510.704) -- 0:00:57
Average standard deviation of split frequencies: 0.032141
80500 -- (-517.321) [-511.303] (-509.644) (-509.863) * (-509.346) (-509.511) (-511.518) [-510.809] -- 0:00:57
81000 -- [-510.313] (-510.371) (-509.913) (-509.602) * (-508.929) (-512.061) (-510.315) [-508.858] -- 0:00:56
81500 -- (-509.292) (-510.163) [-509.370] (-508.962) * (-509.866) (-511.531) [-509.823] (-512.299) -- 0:00:56
82000 -- [-513.311] (-511.039) (-510.188) (-515.136) * [-510.404] (-508.704) (-509.760) (-511.241) -- 0:00:55
82500 -- (-509.653) [-509.534] (-510.585) (-511.755) * [-513.540] (-511.018) (-513.503) (-510.988) -- 0:00:55
83000 -- (-508.929) [-510.097] (-508.875) (-509.356) * [-510.447] (-509.251) (-513.004) (-512.864) -- 0:00:55
83500 -- (-510.829) (-510.206) [-509.773] (-511.972) * (-510.730) (-509.454) (-509.459) [-510.735] -- 0:00:54
84000 -- (-510.005) [-511.079] (-511.953) (-509.819) * (-512.163) [-509.344] (-513.829) (-509.437) -- 0:00:54
84500 -- (-510.719) [-510.589] (-512.134) (-510.357) * [-509.414] (-510.639) (-511.019) (-509.602) -- 0:00:54
85000 -- (-511.513) (-513.891) [-508.590] (-509.138) * (-511.141) (-515.622) [-509.609] (-510.370) -- 0:00:53
Average standard deviation of split frequencies: 0.032889
85500 -- (-510.249) (-511.009) [-510.326] (-510.967) * (-511.546) [-515.077] (-510.908) (-517.604) -- 0:00:53
86000 -- (-510.173) (-514.646) (-512.540) [-508.807] * (-512.379) (-509.204) [-510.914] (-513.785) -- 0:00:53
86500 -- (-513.659) (-511.660) (-509.420) [-508.877] * (-511.751) (-512.697) [-508.907] (-508.887) -- 0:00:52
87000 -- (-510.331) (-513.399) [-509.080] (-510.674) * [-509.827] (-511.263) (-510.006) (-510.105) -- 0:00:52
87500 -- (-513.354) [-509.313] (-513.841) (-510.739) * (-510.053) (-513.300) [-510.227] (-510.844) -- 0:00:52
88000 -- [-513.073] (-511.648) (-513.855) (-508.129) * (-509.928) (-508.814) (-509.990) [-515.332] -- 0:00:51
88500 -- (-508.707) (-509.284) (-511.493) [-508.278] * (-508.965) (-513.717) [-509.455] (-514.053) -- 0:01:01
89000 -- [-509.606] (-510.563) (-511.055) (-509.218) * (-512.246) (-515.884) (-512.103) [-510.989] -- 0:01:01
89500 -- [-509.509] (-511.685) (-517.224) (-509.563) * (-510.460) [-510.512] (-509.631) (-510.879) -- 0:01:01
90000 -- (-509.469) [-511.065] (-511.094) (-510.502) * [-515.777] (-509.146) (-509.499) (-512.427) -- 0:01:00
Average standard deviation of split frequencies: 0.033919
90500 -- [-509.191] (-515.837) (-510.181) (-509.138) * [-511.527] (-511.394) (-509.534) (-512.049) -- 0:01:00
91000 -- [-509.918] (-512.229) (-509.059) (-509.806) * (-509.906) [-510.036] (-509.475) (-508.226) -- 0:00:59
91500 -- (-509.030) (-509.105) (-511.832) [-509.374] * [-510.679] (-509.408) (-511.456) (-509.143) -- 0:00:59
92000 -- (-513.346) (-509.311) [-511.994] (-509.312) * [-511.318] (-511.061) (-511.437) (-508.227) -- 0:00:59
92500 -- (-509.306) (-514.408) (-509.612) [-509.581] * [-511.168] (-510.210) (-509.482) (-508.208) -- 0:00:58
93000 -- [-512.416] (-515.346) (-509.543) (-509.384) * (-512.211) (-512.798) (-512.286) [-509.773] -- 0:00:58
93500 -- (-510.201) (-510.589) [-509.501] (-509.734) * (-513.482) (-510.239) [-509.098] (-511.390) -- 0:00:58
94000 -- (-514.627) (-510.818) (-509.464) [-508.826] * (-513.918) (-509.892) [-512.065] (-509.727) -- 0:00:57
94500 -- (-511.271) [-510.266] (-508.898) (-510.216) * (-509.284) (-512.638) [-510.526] (-509.565) -- 0:00:57
95000 -- (-509.166) (-509.859) [-512.727] (-508.983) * (-508.664) (-510.686) [-508.254] (-512.595) -- 0:00:57
Average standard deviation of split frequencies: 0.032047
95500 -- (-508.434) (-508.969) [-508.771] (-509.286) * [-511.368] (-509.186) (-511.188) (-510.239) -- 0:00:56
96000 -- (-510.672) [-508.757] (-511.577) (-509.441) * (-510.172) [-510.682] (-510.984) (-508.982) -- 0:00:56
96500 -- [-510.228] (-509.139) (-510.229) (-509.113) * [-510.434] (-508.908) (-510.785) (-511.829) -- 0:00:56
97000 -- (-511.995) [-509.730] (-510.958) (-509.551) * (-511.513) [-510.966] (-511.733) (-508.951) -- 0:00:55
97500 -- (-511.364) (-508.913) [-508.811] (-512.182) * (-514.870) [-510.475] (-509.027) (-508.592) -- 0:00:55
98000 -- (-512.018) (-511.807) [-512.967] (-510.250) * (-510.486) (-508.499) [-509.538] (-508.989) -- 0:00:55
98500 -- (-512.463) (-509.597) (-510.033) [-509.749] * (-511.870) (-508.873) [-509.070] (-510.666) -- 0:00:54
99000 -- (-515.015) (-513.685) (-516.284) [-509.316] * (-509.744) [-509.682] (-510.163) (-511.527) -- 0:00:54
99500 -- (-511.800) (-509.003) (-511.574) [-509.419] * (-510.897) (-510.532) [-511.520] (-511.262) -- 0:00:54
100000 -- [-511.126] (-511.443) (-510.359) (-511.346) * (-511.019) (-510.051) [-509.669] (-510.282) -- 0:00:54
Average standard deviation of split frequencies: 0.029398
100500 -- (-510.502) (-511.209) [-509.696] (-512.401) * (-508.816) [-510.018] (-510.573) (-510.985) -- 0:00:53
101000 -- (-509.651) (-509.857) [-508.198] (-511.745) * [-508.206] (-512.166) (-512.563) (-513.200) -- 0:00:53
101500 -- [-511.257] (-509.580) (-510.990) (-513.421) * (-509.197) (-509.276) [-510.382] (-513.271) -- 0:00:53
102000 -- (-514.976) (-510.035) (-511.921) [-511.279] * (-508.187) (-510.515) (-518.277) [-511.378] -- 0:00:52
102500 -- [-513.032] (-509.560) (-514.149) (-511.978) * (-508.249) (-514.148) [-508.980] (-510.056) -- 0:00:52
103000 -- (-510.048) (-510.706) [-511.472] (-513.729) * (-510.253) [-511.932] (-508.568) (-512.628) -- 0:00:52
103500 -- [-512.570] (-510.342) (-510.394) (-509.613) * (-511.032) (-512.909) [-510.362] (-509.715) -- 0:00:51
104000 -- [-511.674] (-516.606) (-511.110) (-509.333) * (-512.298) (-512.973) [-511.518] (-511.047) -- 0:00:51
104500 -- [-510.231] (-510.551) (-510.997) (-510.035) * [-510.718] (-510.559) (-510.729) (-510.503) -- 0:00:51
105000 -- (-511.511) (-510.391) (-510.288) [-510.211] * (-513.334) [-509.291] (-511.517) (-511.145) -- 0:00:59
Average standard deviation of split frequencies: 0.028556
105500 -- (-509.841) (-511.803) (-512.837) [-511.720] * (-510.210) [-510.086] (-510.041) (-510.400) -- 0:00:59
106000 -- [-510.905] (-517.885) (-511.992) (-512.196) * (-510.884) [-511.260] (-508.816) (-509.596) -- 0:00:59
106500 -- (-512.707) [-511.238] (-509.077) (-510.486) * [-511.637] (-509.070) (-514.690) (-511.338) -- 0:00:58
107000 -- (-515.369) [-515.729] (-512.300) (-511.098) * (-510.395) (-512.048) [-508.922] (-510.648) -- 0:00:58
107500 -- (-511.660) [-509.017] (-508.740) (-510.219) * (-511.670) (-515.231) (-508.554) [-510.681] -- 0:00:58
108000 -- (-509.202) (-509.128) (-509.648) [-509.066] * (-509.025) (-515.441) [-508.256] (-512.256) -- 0:00:57
108500 -- (-511.681) (-511.240) (-510.004) [-512.173] * (-508.373) (-510.782) (-514.824) [-509.914] -- 0:00:57
109000 -- (-509.458) (-512.748) [-512.200] (-510.459) * (-511.972) [-511.616] (-513.415) (-510.660) -- 0:00:57
109500 -- (-508.990) (-508.818) (-512.740) [-510.955] * (-514.787) [-509.328] (-516.758) (-514.557) -- 0:00:56
110000 -- (-510.689) [-508.734] (-515.977) (-512.549) * (-511.410) [-510.352] (-509.165) (-509.560) -- 0:00:56
Average standard deviation of split frequencies: 0.028114
110500 -- (-514.702) [-508.567] (-512.781) (-509.312) * (-510.229) (-511.321) [-508.715] (-511.770) -- 0:00:56
111000 -- (-508.841) (-511.133) [-510.395] (-510.604) * (-509.603) (-510.528) (-509.529) [-508.791] -- 0:00:56
111500 -- [-510.979] (-510.329) (-511.278) (-508.890) * (-510.864) (-510.464) (-508.521) [-510.437] -- 0:00:55
112000 -- [-510.766] (-508.876) (-514.715) (-514.774) * [-508.641] (-512.415) (-509.160) (-508.059) -- 0:00:55
112500 -- (-511.338) [-510.029] (-510.111) (-509.473) * (-508.211) (-512.189) (-508.871) [-509.320] -- 0:00:55
113000 -- (-508.859) (-508.697) (-511.473) [-511.008] * (-508.199) (-510.117) (-512.111) [-510.760] -- 0:00:54
113500 -- [-510.208] (-511.093) (-513.015) (-509.965) * [-509.828] (-510.030) (-511.147) (-509.109) -- 0:00:54
114000 -- (-509.196) (-509.991) (-513.294) [-509.559] * (-512.719) (-512.014) (-509.715) [-508.226] -- 0:00:54
114500 -- (-509.677) [-510.491] (-510.438) (-508.551) * [-508.835] (-511.166) (-510.617) (-510.497) -- 0:00:54
115000 -- (-516.603) (-509.700) (-510.106) [-508.694] * [-508.218] (-515.625) (-508.966) (-513.362) -- 0:00:53
Average standard deviation of split frequencies: 0.028447
115500 -- (-513.526) (-511.949) [-512.270] (-508.860) * [-509.600] (-508.366) (-510.156) (-509.680) -- 0:00:53
116000 -- (-511.573) (-513.326) (-509.561) [-509.359] * [-508.962] (-508.439) (-515.398) (-509.912) -- 0:00:53
116500 -- (-509.591) (-511.827) [-509.680] (-508.697) * (-509.088) (-509.836) (-515.023) [-509.111] -- 0:00:53
117000 -- (-508.262) (-511.560) (-509.586) [-508.607] * [-509.407] (-511.851) (-509.133) (-511.718) -- 0:00:52
117500 -- (-509.076) (-513.572) (-510.738) [-510.070] * (-510.178) [-510.163] (-510.220) (-512.801) -- 0:00:52
118000 -- [-509.891] (-511.321) (-511.839) (-514.957) * (-510.943) [-509.486] (-508.769) (-509.222) -- 0:00:52
118500 -- (-509.873) (-510.076) (-511.144) [-510.687] * (-511.265) [-510.521] (-511.881) (-512.561) -- 0:00:52
119000 -- (-509.682) (-509.970) (-513.443) [-509.296] * [-508.236] (-511.066) (-513.694) (-509.325) -- 0:00:51
119500 -- (-509.822) (-510.777) [-511.115] (-508.713) * (-508.299) (-510.348) (-510.983) [-509.518] -- 0:00:51
120000 -- (-514.226) [-510.174] (-511.129) (-511.600) * (-510.236) (-509.187) [-512.662] (-512.053) -- 0:00:51
Average standard deviation of split frequencies: 0.026524
120500 -- (-511.704) (-508.742) (-515.494) [-511.889] * (-510.778) (-510.006) [-510.621] (-509.970) -- 0:00:51
121000 -- (-516.256) (-510.506) (-509.944) [-510.228] * [-509.506] (-510.129) (-510.793) (-509.285) -- 0:00:50
121500 -- [-512.390] (-512.971) (-513.957) (-514.523) * [-511.150] (-512.295) (-508.358) (-511.176) -- 0:00:57
122000 -- (-511.812) (-509.410) [-509.667] (-510.776) * (-513.091) [-510.454] (-508.453) (-509.852) -- 0:00:57
122500 -- [-509.542] (-509.268) (-508.805) (-511.798) * (-510.353) [-510.288] (-513.620) (-510.219) -- 0:00:57
123000 -- (-509.461) [-508.891] (-510.117) (-515.781) * (-510.728) [-511.840] (-515.236) (-511.460) -- 0:00:57
123500 -- [-510.231] (-508.875) (-509.601) (-513.515) * (-510.525) (-509.334) [-512.832] (-508.488) -- 0:00:56
124000 -- (-509.235) [-509.098] (-512.804) (-514.524) * (-508.844) (-513.289) [-510.575] (-510.626) -- 0:00:56
124500 -- (-510.747) (-509.262) (-512.505) [-511.411] * (-513.905) [-509.984] (-509.794) (-509.605) -- 0:00:56
125000 -- (-509.069) [-509.783] (-513.321) (-512.580) * [-509.174] (-511.683) (-509.615) (-510.665) -- 0:00:56
Average standard deviation of split frequencies: 0.027644
125500 -- (-508.454) (-509.277) [-509.288] (-510.585) * (-512.645) (-509.900) [-510.450] (-510.550) -- 0:00:55
126000 -- (-512.127) (-511.845) (-509.154) [-510.213] * (-512.689) [-509.768] (-508.636) (-509.911) -- 0:00:55
126500 -- [-510.517] (-511.901) (-509.730) (-511.386) * (-510.139) (-514.707) [-512.273] (-510.041) -- 0:00:55
127000 -- (-509.986) [-508.508] (-513.444) (-509.879) * [-513.504] (-513.107) (-512.064) (-510.204) -- 0:00:54
127500 -- (-510.457) (-513.268) (-509.002) [-509.238] * (-510.831) [-512.436] (-510.877) (-509.974) -- 0:00:54
128000 -- (-511.715) (-509.006) [-509.199] (-509.124) * (-511.668) (-511.965) (-509.402) [-508.622] -- 0:00:54
128500 -- [-511.797] (-512.289) (-510.161) (-510.048) * (-511.855) [-512.188] (-511.861) (-510.930) -- 0:00:54
129000 -- (-509.715) (-509.395) (-513.770) [-508.706] * (-513.051) (-509.877) (-511.669) [-509.744] -- 0:00:54
129500 -- (-511.070) (-511.585) [-508.726] (-511.584) * (-515.213) (-512.429) (-510.632) [-512.238] -- 0:00:53
130000 -- (-514.635) (-515.103) [-511.889] (-510.378) * (-512.800) (-512.061) [-512.051] (-510.790) -- 0:00:53
Average standard deviation of split frequencies: 0.024874
130500 -- (-514.112) (-510.383) [-509.989] (-514.329) * [-510.358] (-508.801) (-516.942) (-511.796) -- 0:00:53
131000 -- [-509.892] (-510.398) (-511.957) (-515.769) * (-512.639) (-508.700) [-511.426] (-511.847) -- 0:00:53
131500 -- (-511.219) (-512.806) [-512.033] (-509.072) * (-511.733) (-510.272) (-509.312) [-509.844] -- 0:00:52
132000 -- (-509.312) (-510.384) (-510.291) [-508.925] * [-511.681] (-512.881) (-513.318) (-510.376) -- 0:00:52
132500 -- [-510.221] (-509.841) (-512.592) (-508.598) * (-512.885) (-522.166) [-510.794] (-510.347) -- 0:00:52
133000 -- (-510.149) [-513.781] (-511.185) (-509.752) * (-510.803) (-509.671) (-512.192) [-511.190] -- 0:00:52
133500 -- (-509.398) (-514.452) (-511.658) [-514.545] * (-510.562) [-511.610] (-510.176) (-509.483) -- 0:00:51
134000 -- (-511.295) (-509.175) [-508.573] (-513.687) * (-508.499) (-509.459) (-511.640) [-508.683] -- 0:00:51
134500 -- (-508.789) (-511.329) [-509.881] (-515.094) * (-509.296) [-514.612] (-513.631) (-510.622) -- 0:00:51
135000 -- [-509.210] (-510.988) (-508.974) (-509.671) * (-509.046) (-510.339) (-509.068) [-509.683] -- 0:00:51
Average standard deviation of split frequencies: 0.025540
135500 -- (-514.014) (-512.293) [-510.314] (-510.285) * (-510.134) (-509.482) [-509.167] (-511.307) -- 0:00:51
136000 -- (-513.575) [-510.757] (-508.804) (-512.608) * (-509.035) (-513.260) (-512.659) [-509.358] -- 0:00:50
136500 -- (-514.620) [-509.988] (-511.692) (-511.555) * [-509.959] (-515.481) (-513.492) (-509.053) -- 0:00:50
137000 -- (-515.298) [-511.000] (-512.367) (-511.689) * (-510.342) [-511.983] (-512.412) (-509.498) -- 0:00:50
137500 -- (-512.239) (-512.987) (-511.737) [-509.003] * [-513.475] (-509.308) (-508.971) (-509.200) -- 0:00:50
138000 -- (-511.667) [-512.542] (-511.623) (-509.923) * [-514.099] (-509.270) (-513.930) (-510.311) -- 0:00:56
138500 -- (-512.030) [-512.678] (-511.759) (-510.835) * (-513.476) (-514.201) (-510.696) [-509.160] -- 0:00:55
139000 -- (-514.343) (-512.090) [-509.329] (-508.507) * (-510.526) (-510.217) [-510.487] (-509.957) -- 0:00:55
139500 -- (-510.997) (-511.398) [-511.086] (-508.438) * [-509.978] (-509.600) (-514.917) (-511.191) -- 0:00:55
140000 -- (-511.621) (-513.934) [-508.609] (-512.743) * (-510.643) (-509.728) [-509.101] (-513.076) -- 0:00:55
Average standard deviation of split frequencies: 0.026139
140500 -- (-513.572) (-513.057) [-510.511] (-513.269) * (-510.311) [-510.068] (-511.135) (-513.324) -- 0:00:55
141000 -- (-510.734) (-512.523) (-510.350) [-509.615] * (-510.328) (-509.731) (-512.577) [-510.258] -- 0:00:54
141500 -- (-509.391) (-512.120) [-510.505] (-512.072) * (-510.237) [-512.773] (-517.298) (-509.740) -- 0:00:54
142000 -- (-510.429) (-511.203) [-510.758] (-511.885) * (-510.874) (-509.170) (-513.566) [-510.241] -- 0:00:54
142500 -- (-509.580) (-509.664) [-510.576] (-511.375) * (-508.697) [-509.594] (-510.533) (-509.829) -- 0:00:54
143000 -- (-509.648) (-509.177) [-509.561] (-513.615) * (-508.570) [-509.067] (-510.220) (-509.665) -- 0:00:53
143500 -- [-510.935] (-508.632) (-509.946) (-511.181) * [-510.946] (-509.501) (-511.937) (-510.409) -- 0:00:53
144000 -- (-509.246) [-511.916] (-509.984) (-510.565) * [-508.968] (-511.062) (-511.738) (-511.411) -- 0:00:53
144500 -- (-513.912) (-509.903) [-508.453] (-509.267) * [-510.488] (-512.018) (-511.639) (-508.884) -- 0:00:53
145000 -- [-508.995] (-509.031) (-509.332) (-508.631) * (-509.763) [-509.966] (-509.902) (-510.299) -- 0:00:53
Average standard deviation of split frequencies: 0.025992
145500 -- (-508.978) (-510.122) (-512.127) [-515.526] * [-509.901] (-511.201) (-513.585) (-511.224) -- 0:00:52
146000 -- (-508.732) (-509.315) [-509.043] (-511.760) * (-511.662) [-510.253] (-514.184) (-511.163) -- 0:00:52
146500 -- [-508.172] (-509.770) (-510.242) (-512.713) * (-513.172) (-508.580) [-510.299] (-512.174) -- 0:00:52
147000 -- (-509.121) [-511.660] (-508.324) (-511.959) * (-510.805) (-509.109) (-511.056) [-513.471] -- 0:00:52
147500 -- (-511.760) (-511.734) [-509.155] (-509.719) * (-511.946) [-511.144] (-512.582) (-508.848) -- 0:00:52
148000 -- [-511.270] (-512.605) (-511.795) (-509.098) * (-515.605) (-510.333) (-510.772) [-508.243] -- 0:00:51
148500 -- (-512.891) [-512.278] (-510.297) (-516.075) * [-513.472] (-508.744) (-510.011) (-511.670) -- 0:00:51
149000 -- (-510.579) (-512.957) (-512.997) [-510.740] * (-508.834) [-510.132] (-509.766) (-510.206) -- 0:00:51
149500 -- (-511.996) [-510.278] (-510.384) (-509.470) * (-511.720) (-510.110) (-515.245) [-509.136] -- 0:00:51
150000 -- (-510.771) (-512.303) (-510.831) [-509.846] * (-511.814) (-511.973) [-511.068] (-508.875) -- 0:00:51
Average standard deviation of split frequencies: 0.025656
150500 -- (-509.630) (-513.800) [-509.920] (-509.021) * (-510.281) [-508.940] (-515.570) (-511.529) -- 0:00:50
151000 -- (-514.167) [-509.940] (-514.997) (-512.829) * (-509.604) [-509.230] (-515.705) (-509.620) -- 0:00:50
151500 -- [-512.867] (-509.161) (-509.177) (-508.664) * (-510.514) (-510.330) (-513.963) [-509.059] -- 0:00:50
152000 -- (-513.371) (-508.897) [-509.619] (-512.154) * [-511.298] (-512.299) (-514.118) (-508.252) -- 0:00:50
152500 -- (-511.817) (-509.623) [-510.138] (-510.709) * (-509.482) [-510.451] (-509.058) (-508.647) -- 0:00:50
153000 -- [-510.235] (-517.731) (-510.522) (-511.171) * (-511.953) (-508.483) (-509.647) [-510.432] -- 0:00:49
153500 -- [-511.262] (-510.729) (-511.560) (-513.066) * [-509.991] (-509.532) (-508.600) (-512.352) -- 0:00:49
154000 -- (-512.902) (-508.369) [-510.859] (-515.123) * [-509.195] (-508.309) (-509.674) (-509.594) -- 0:00:49
154500 -- (-509.300) [-509.226] (-509.546) (-510.910) * (-509.756) [-510.227] (-509.955) (-511.838) -- 0:00:54
155000 -- (-511.872) (-511.102) (-515.502) [-509.596] * [-511.437] (-509.226) (-513.220) (-510.749) -- 0:00:54
Average standard deviation of split frequencies: 0.023721
155500 -- (-512.922) (-510.075) (-513.735) [-510.936] * (-512.220) (-510.845) [-511.144] (-514.934) -- 0:00:54
156000 -- (-509.577) (-509.988) [-510.354] (-509.311) * [-509.361] (-509.605) (-514.304) (-512.869) -- 0:00:54
156500 -- (-509.485) (-511.005) [-511.141] (-513.064) * (-511.781) (-513.346) (-512.358) [-511.923] -- 0:00:53
157000 -- (-508.137) (-517.341) (-510.859) [-509.578] * (-508.823) [-510.545] (-511.395) (-515.249) -- 0:00:53
157500 -- (-510.724) (-509.610) [-511.147] (-509.748) * (-508.931) (-510.539) [-511.708] (-509.585) -- 0:00:53
158000 -- (-509.465) (-511.543) [-508.252] (-511.208) * [-509.206] (-511.899) (-515.261) (-509.321) -- 0:00:53
158500 -- (-511.951) (-509.680) [-508.736] (-511.013) * [-511.305] (-511.328) (-511.313) (-509.769) -- 0:00:53
159000 -- [-511.556] (-512.160) (-510.488) (-510.302) * (-509.264) (-508.869) [-511.972] (-509.808) -- 0:00:52
159500 -- (-509.307) [-508.675] (-511.285) (-508.937) * (-508.288) (-508.802) (-509.400) [-508.397] -- 0:00:52
160000 -- [-508.801] (-509.962) (-513.824) (-511.862) * (-510.643) [-512.974] (-509.848) (-509.998) -- 0:00:52
Average standard deviation of split frequencies: 0.024499
160500 -- (-510.724) (-510.253) (-510.211) [-510.352] * (-511.259) (-512.046) (-510.620) [-509.773] -- 0:00:52
161000 -- [-509.971] (-509.269) (-511.283) (-509.666) * (-509.881) (-510.117) [-511.270] (-509.967) -- 0:00:52
161500 -- [-511.236] (-509.599) (-509.587) (-508.591) * (-509.886) [-509.668] (-514.892) (-510.094) -- 0:00:51
162000 -- (-513.489) (-509.340) [-510.039] (-510.047) * (-510.954) [-510.629] (-511.776) (-508.679) -- 0:00:51
162500 -- (-508.520) [-511.994] (-512.495) (-513.775) * (-511.752) (-514.722) (-510.908) [-510.369] -- 0:00:51
163000 -- [-512.636] (-511.377) (-510.897) (-514.721) * (-514.648) [-511.927] (-510.935) (-510.880) -- 0:00:51
163500 -- (-510.353) [-513.548] (-514.706) (-516.393) * (-518.705) [-512.286] (-510.904) (-522.132) -- 0:00:51
164000 -- (-510.707) (-514.406) [-512.781] (-509.836) * (-509.802) (-510.161) (-511.245) [-512.485] -- 0:00:50
164500 -- (-509.131) [-508.509] (-514.677) (-509.410) * [-512.477] (-514.427) (-515.155) (-512.802) -- 0:00:50
165000 -- (-508.472) (-508.914) [-511.672] (-509.675) * (-513.228) (-512.129) (-512.606) [-509.683] -- 0:00:50
Average standard deviation of split frequencies: 0.023765
165500 -- (-511.495) (-508.985) (-512.225) [-510.957] * (-510.911) [-512.150] (-510.957) (-512.176) -- 0:00:50
166000 -- (-512.804) (-511.658) [-508.959] (-511.665) * (-511.980) [-509.865] (-510.073) (-510.248) -- 0:00:50
166500 -- (-509.033) (-510.407) [-514.653] (-514.657) * (-508.728) (-510.576) [-509.314] (-509.846) -- 0:00:50
167000 -- (-508.543) (-509.992) (-513.974) [-513.788] * (-509.682) [-508.673] (-512.511) (-510.777) -- 0:00:49
167500 -- (-509.970) (-510.805) (-509.695) [-511.299] * (-509.150) (-510.391) (-508.949) [-510.853] -- 0:00:49
168000 -- (-509.457) (-508.455) [-509.409] (-511.977) * (-508.777) [-512.108] (-513.202) (-509.694) -- 0:00:49
168500 -- [-509.280] (-509.039) (-510.376) (-512.316) * (-510.170) (-511.475) (-510.388) [-510.424] -- 0:00:49
169000 -- (-509.372) (-510.038) [-509.326] (-510.364) * (-510.729) (-513.758) (-509.235) [-511.017] -- 0:00:49
169500 -- (-510.934) (-510.885) (-510.429) [-511.692] * (-511.515) [-510.932] (-512.423) (-513.225) -- 0:00:48
170000 -- [-510.095] (-509.642) (-512.232) (-509.784) * (-508.944) [-510.395] (-512.587) (-513.236) -- 0:00:48
Average standard deviation of split frequencies: 0.023785
170500 -- (-510.436) (-511.549) [-509.744] (-509.747) * [-509.531] (-513.389) (-512.229) (-511.763) -- 0:00:48
171000 -- (-509.624) (-511.684) [-509.443] (-508.774) * (-510.080) [-508.739] (-509.680) (-510.196) -- 0:00:53
171500 -- [-508.475] (-509.013) (-510.863) (-513.171) * (-512.574) (-510.266) [-510.976] (-508.286) -- 0:00:53
172000 -- (-510.651) (-509.006) (-514.087) [-509.663] * (-509.841) (-509.261) [-511.365] (-508.315) -- 0:00:52
172500 -- (-509.452) (-512.912) (-512.384) [-509.833] * (-510.287) (-509.324) [-510.035] (-509.030) -- 0:00:52
173000 -- (-511.873) (-510.020) [-509.305] (-510.034) * (-510.464) [-509.639] (-509.419) (-509.032) -- 0:00:52
173500 -- (-512.820) (-509.700) [-510.416] (-512.333) * [-511.397] (-510.324) (-510.376) (-512.640) -- 0:00:52
174000 -- (-510.913) (-512.236) [-510.828] (-511.798) * (-512.494) [-509.919] (-508.829) (-508.432) -- 0:00:52
174500 -- (-513.444) (-509.995) [-510.242] (-511.637) * (-509.393) (-508.171) (-508.465) [-508.365] -- 0:00:52
175000 -- (-510.332) [-510.373] (-514.907) (-510.597) * [-513.061] (-510.029) (-508.459) (-511.024) -- 0:00:51
Average standard deviation of split frequencies: 0.023362
175500 -- [-509.336] (-510.148) (-510.964) (-510.152) * (-513.225) (-508.595) [-509.220] (-511.097) -- 0:00:51
176000 -- (-511.916) (-511.077) [-510.971] (-511.126) * [-513.160] (-509.334) (-514.540) (-512.429) -- 0:00:51
176500 -- (-511.074) (-509.833) (-508.383) [-514.673] * (-513.352) [-508.348] (-510.516) (-509.683) -- 0:00:51
177000 -- (-516.173) (-511.887) (-511.643) [-509.111] * [-509.949] (-508.405) (-509.744) (-511.767) -- 0:00:51
177500 -- (-513.431) (-515.338) [-511.529] (-511.016) * [-514.690] (-509.191) (-511.009) (-508.619) -- 0:00:50
178000 -- [-509.974] (-510.757) (-509.298) (-508.952) * (-514.708) [-509.226] (-516.445) (-508.652) -- 0:00:50
178500 -- (-509.062) (-509.398) (-508.578) [-509.330] * (-508.802) (-514.658) [-515.611] (-511.472) -- 0:00:50
179000 -- [-511.959] (-509.417) (-510.982) (-508.336) * (-510.189) (-513.856) [-510.011] (-511.454) -- 0:00:50
179500 -- (-511.811) [-509.467] (-512.661) (-509.063) * (-511.330) (-508.732) [-515.002] (-511.391) -- 0:00:50
180000 -- (-509.321) (-511.334) (-511.392) [-509.550] * (-509.436) (-509.217) (-512.502) [-511.597] -- 0:00:50
Average standard deviation of split frequencies: 0.021889
180500 -- (-510.585) (-509.931) [-511.573] (-509.819) * [-511.487] (-511.282) (-510.143) (-511.222) -- 0:00:49
181000 -- [-510.791] (-508.847) (-511.330) (-509.653) * (-511.071) (-512.285) [-511.618] (-510.528) -- 0:00:49
181500 -- (-509.812) [-510.013] (-510.830) (-512.673) * [-508.864] (-511.639) (-509.421) (-510.090) -- 0:00:49
182000 -- [-511.661] (-511.779) (-511.288) (-514.960) * [-509.135] (-511.273) (-510.372) (-510.902) -- 0:00:49
182500 -- [-510.788] (-510.160) (-513.729) (-509.791) * (-519.901) (-514.379) [-509.815] (-512.508) -- 0:00:49
183000 -- [-510.221] (-508.594) (-515.800) (-510.018) * [-511.487] (-510.307) (-509.612) (-509.567) -- 0:00:49
183500 -- [-508.477] (-510.549) (-513.113) (-509.142) * (-508.896) (-515.065) [-510.060] (-510.082) -- 0:00:48
184000 -- [-512.889] (-509.494) (-512.592) (-508.636) * (-511.018) [-511.139] (-509.731) (-509.009) -- 0:00:48
184500 -- (-512.032) [-507.999] (-509.150) (-509.814) * (-515.580) (-513.046) [-509.166] (-511.447) -- 0:00:48
185000 -- (-511.696) [-509.089] (-514.379) (-509.194) * (-509.281) [-512.226] (-510.270) (-511.979) -- 0:00:48
Average standard deviation of split frequencies: 0.019381
185500 -- (-512.080) (-508.757) [-510.022] (-512.946) * (-509.488) [-513.306] (-509.612) (-509.752) -- 0:00:48
186000 -- (-510.174) (-509.907) [-510.818] (-510.963) * (-508.396) (-513.139) [-509.893] (-510.485) -- 0:00:48
186500 -- (-510.872) (-512.424) [-510.514] (-509.971) * (-508.782) (-512.875) [-510.444] (-509.478) -- 0:00:47
187000 -- (-510.845) (-509.887) (-510.678) [-513.344] * (-509.129) (-509.348) [-509.116] (-517.022) -- 0:00:52
187500 -- (-510.462) [-508.418] (-510.986) (-517.367) * (-508.481) [-509.714] (-512.239) (-512.255) -- 0:00:52
188000 -- (-508.693) [-508.757] (-515.525) (-510.783) * (-512.593) (-509.042) (-510.402) [-509.467] -- 0:00:51
188500 -- (-511.457) (-509.196) (-511.219) [-511.511] * (-509.005) [-509.656] (-508.781) (-511.687) -- 0:00:51
189000 -- (-512.374) (-510.021) (-509.653) [-509.613] * [-509.198] (-509.226) (-511.765) (-510.316) -- 0:00:51
189500 -- (-511.958) (-511.222) (-511.346) [-508.888] * (-513.197) (-510.034) [-510.407] (-510.164) -- 0:00:51
190000 -- (-510.223) (-512.249) (-509.831) [-510.310] * (-509.576) (-516.796) (-510.215) [-509.490] -- 0:00:51
Average standard deviation of split frequencies: 0.019488
190500 -- (-510.582) [-508.431] (-511.317) (-511.351) * (-509.894) [-511.136] (-511.860) (-508.441) -- 0:00:50
191000 -- [-509.683] (-512.583) (-510.335) (-512.820) * (-510.653) (-510.680) [-509.327] (-510.610) -- 0:00:50
191500 -- (-513.104) (-510.658) (-510.361) [-509.797] * (-508.659) [-509.692] (-513.407) (-509.939) -- 0:00:50
192000 -- (-509.329) (-511.663) (-509.620) [-513.056] * (-508.940) [-510.037] (-509.647) (-510.172) -- 0:00:50
192500 -- [-509.517] (-508.313) (-513.562) (-509.496) * (-509.640) (-510.402) [-509.350] (-515.328) -- 0:00:50
193000 -- [-509.526] (-509.506) (-514.190) (-508.279) * (-508.940) (-509.837) (-508.921) [-512.093] -- 0:00:50
193500 -- (-514.661) (-510.214) [-508.792] (-509.659) * (-515.400) (-509.804) (-511.203) [-511.846] -- 0:00:50
194000 -- (-513.738) (-510.168) [-510.715] (-512.043) * (-509.735) [-510.836] (-510.140) (-512.303) -- 0:00:49
194500 -- (-513.326) (-509.478) [-509.427] (-510.497) * [-508.612] (-509.818) (-508.820) (-511.195) -- 0:00:49
195000 -- (-513.355) [-508.491] (-511.107) (-512.671) * (-510.332) (-510.464) (-508.404) [-510.403] -- 0:00:49
Average standard deviation of split frequencies: 0.019241
195500 -- (-514.909) (-508.681) (-510.405) [-510.022] * (-514.568) (-512.419) (-509.115) [-513.169] -- 0:00:49
196000 -- (-510.074) (-509.984) (-509.637) [-511.904] * (-510.993) (-514.888) (-510.663) [-509.120] -- 0:00:49
196500 -- (-511.533) (-510.120) (-510.144) [-511.213] * (-511.366) (-514.042) (-509.899) [-511.461] -- 0:00:49
197000 -- (-509.169) (-509.239) (-509.285) [-511.351] * (-511.282) (-509.509) [-509.489] (-509.486) -- 0:00:48
197500 -- (-510.075) (-508.435) [-508.120] (-513.117) * (-510.628) (-509.484) [-512.549] (-509.452) -- 0:00:48
198000 -- (-511.437) (-509.824) [-509.075] (-513.191) * [-511.445] (-511.316) (-510.780) (-509.246) -- 0:00:48
198500 -- (-513.744) [-509.949] (-509.271) (-510.056) * [-512.808] (-510.323) (-512.269) (-509.344) -- 0:00:48
199000 -- [-510.949] (-510.018) (-510.767) (-511.312) * [-509.229] (-510.329) (-509.504) (-512.088) -- 0:00:48
199500 -- (-511.421) (-509.381) [-509.374] (-513.450) * [-510.343] (-509.735) (-511.359) (-512.980) -- 0:00:48
200000 -- (-509.359) (-508.944) (-511.623) [-513.543] * (-514.448) (-512.818) [-509.222] (-517.544) -- 0:00:48
Average standard deviation of split frequencies: 0.020175
200500 -- (-509.843) [-508.828] (-509.608) (-509.976) * (-508.133) [-508.510] (-511.323) (-511.623) -- 0:00:47
201000 -- (-509.762) (-508.511) (-511.369) [-516.403] * (-508.239) (-511.470) [-510.291] (-510.940) -- 0:00:47
201500 -- (-514.231) (-510.408) [-508.320] (-512.415) * (-509.003) (-515.167) (-513.607) [-508.383] -- 0:00:47
202000 -- (-511.437) (-512.324) [-510.917] (-512.450) * (-512.287) (-511.858) (-508.474) [-509.930] -- 0:00:47
202500 -- [-508.603] (-516.238) (-512.569) (-509.665) * (-510.315) (-514.681) (-510.505) [-509.115] -- 0:00:47
203000 -- (-508.252) (-515.311) [-510.904] (-509.953) * (-509.296) (-511.527) (-510.523) [-510.478] -- 0:00:51
203500 -- (-508.343) (-512.097) [-508.746] (-510.209) * (-509.964) (-509.920) (-510.223) [-508.989] -- 0:00:50
204000 -- [-509.582] (-510.642) (-509.054) (-509.712) * (-509.121) (-508.865) [-510.570] (-514.229) -- 0:00:50
204500 -- (-509.735) (-510.172) (-511.688) [-508.531] * (-510.218) [-512.115] (-509.797) (-511.057) -- 0:00:50
205000 -- [-509.855] (-514.089) (-509.782) (-515.067) * (-511.666) (-514.828) [-509.002] (-509.086) -- 0:00:50
Average standard deviation of split frequencies: 0.021268
205500 -- (-510.157) (-511.053) (-508.696) [-516.148] * (-511.529) (-514.907) [-508.955] (-511.672) -- 0:00:50
206000 -- (-514.728) (-510.602) (-509.259) [-513.213] * (-511.031) (-511.618) [-508.848] (-512.201) -- 0:00:50
206500 -- (-514.188) [-508.749] (-508.434) (-510.485) * [-509.045] (-508.656) (-508.713) (-513.513) -- 0:00:49
207000 -- [-509.893] (-509.433) (-509.784) (-512.085) * [-510.144] (-511.695) (-509.145) (-512.353) -- 0:00:49
207500 -- (-513.832) [-509.866] (-509.671) (-511.575) * [-508.947] (-510.254) (-509.722) (-510.695) -- 0:00:49
208000 -- (-510.220) (-509.031) [-511.255] (-511.028) * (-511.625) [-510.077] (-509.436) (-510.587) -- 0:00:49
208500 -- (-510.132) [-509.701] (-508.820) (-512.216) * [-511.779] (-508.641) (-509.331) (-516.459) -- 0:00:49
209000 -- (-511.093) [-509.360] (-510.078) (-513.226) * (-511.206) [-511.807] (-512.501) (-508.823) -- 0:00:49
209500 -- (-511.031) [-508.967] (-510.237) (-512.894) * (-509.122) (-510.192) (-511.307) [-509.326] -- 0:00:49
210000 -- (-508.989) [-510.429] (-510.935) (-508.772) * (-510.753) (-511.124) [-510.391] (-512.254) -- 0:00:48
Average standard deviation of split frequencies: 0.021507
210500 -- (-508.901) [-512.250] (-514.205) (-508.527) * (-511.504) (-509.550) (-510.822) [-511.145] -- 0:00:48
211000 -- (-513.058) [-508.147] (-510.179) (-508.446) * (-512.323) [-509.721] (-511.466) (-511.443) -- 0:00:48
211500 -- (-514.935) (-512.565) (-512.563) [-509.667] * (-509.471) (-514.739) (-510.127) [-509.112] -- 0:00:48
212000 -- (-510.599) (-508.903) [-510.286] (-512.621) * [-509.861] (-515.945) (-509.205) (-510.589) -- 0:00:48
212500 -- (-518.860) [-510.164] (-510.182) (-510.169) * [-510.229] (-511.320) (-510.735) (-510.422) -- 0:00:48
213000 -- (-509.504) [-509.375] (-513.088) (-510.074) * (-508.831) (-513.036) (-512.902) [-512.648] -- 0:00:48
213500 -- [-508.268] (-508.692) (-510.881) (-512.117) * [-508.731] (-510.047) (-509.954) (-509.678) -- 0:00:47
214000 -- (-508.703) [-511.495] (-510.621) (-513.292) * (-508.924) (-511.317) (-509.624) [-508.533] -- 0:00:47
214500 -- (-508.852) [-509.673] (-511.576) (-509.274) * (-510.648) (-511.990) [-509.615] (-513.746) -- 0:00:47
215000 -- (-510.843) (-513.530) (-508.612) [-511.027] * (-511.971) (-512.758) [-508.720] (-513.482) -- 0:00:47
Average standard deviation of split frequencies: 0.021461
215500 -- (-509.655) (-512.457) (-509.604) [-510.722] * (-510.824) (-509.789) (-509.093) [-513.586] -- 0:00:47
216000 -- (-515.897) [-509.063] (-514.006) (-510.181) * (-509.809) (-508.347) [-508.515] (-511.623) -- 0:00:47
216500 -- (-510.859) (-511.791) (-510.485) [-510.592] * (-510.847) (-513.673) [-509.776] (-509.242) -- 0:00:47
217000 -- (-514.065) [-513.517] (-510.065) (-510.013) * [-511.982] (-511.906) (-512.592) (-510.740) -- 0:00:46
217500 -- [-510.462] (-515.628) (-510.918) (-513.136) * (-513.885) [-514.447] (-513.670) (-510.934) -- 0:00:46
218000 -- (-509.907) (-510.884) (-510.896) [-508.621] * (-511.111) (-509.672) (-509.521) [-509.829] -- 0:00:46
218500 -- (-509.502) (-510.615) (-513.277) [-509.413] * (-509.326) (-513.132) [-510.021] (-509.179) -- 0:00:46
219000 -- (-512.231) [-508.863] (-510.148) (-509.352) * (-508.964) (-512.836) [-511.163] (-510.309) -- 0:00:49
219500 -- [-509.728] (-508.977) (-508.727) (-508.990) * (-510.011) (-509.765) [-514.263] (-512.374) -- 0:00:49
220000 -- (-508.498) (-509.961) [-508.777] (-508.357) * (-510.955) (-513.305) [-510.622] (-508.660) -- 0:00:49
Average standard deviation of split frequencies: 0.020860
220500 -- (-509.501) (-512.402) (-512.478) [-509.700] * (-510.232) (-511.022) (-510.947) [-508.538] -- 0:00:49
221000 -- (-511.859) (-510.396) (-513.013) [-513.025] * (-509.803) (-510.865) (-511.544) [-509.956] -- 0:00:49
221500 -- [-510.234] (-508.639) (-512.804) (-514.243) * (-514.037) [-509.064] (-512.245) (-515.942) -- 0:00:49
222000 -- (-509.916) (-511.554) (-511.917) [-509.967] * (-510.762) (-512.497) [-510.436] (-515.938) -- 0:00:49
222500 -- (-511.933) (-509.926) (-509.479) [-512.028] * (-508.746) (-513.850) [-510.402] (-511.352) -- 0:00:48
223000 -- [-511.490] (-509.107) (-510.188) (-510.245) * (-514.960) (-510.561) (-510.351) [-510.724] -- 0:00:48
223500 -- [-510.315] (-509.290) (-509.726) (-510.869) * [-511.083] (-510.198) (-509.094) (-510.112) -- 0:00:48
224000 -- (-509.832) (-514.923) (-513.801) [-509.955] * (-508.480) (-510.541) (-510.505) [-510.462] -- 0:00:48
224500 -- (-510.448) (-510.319) (-509.286) [-508.242] * [-509.763] (-509.647) (-511.294) (-512.811) -- 0:00:48
225000 -- (-509.051) (-511.445) (-509.185) [-508.078] * (-510.380) (-511.178) [-511.051] (-514.110) -- 0:00:48
Average standard deviation of split frequencies: 0.018541
225500 -- (-512.333) (-511.454) (-509.232) [-510.085] * (-509.038) [-509.502] (-508.366) (-511.643) -- 0:00:48
226000 -- [-514.475] (-510.856) (-509.010) (-511.957) * [-509.666] (-508.919) (-513.397) (-510.443) -- 0:00:47
226500 -- [-512.265] (-510.107) (-513.845) (-511.292) * (-511.503) (-509.787) [-511.726] (-509.701) -- 0:00:47
227000 -- (-512.341) (-509.332) (-512.544) [-513.168] * (-508.608) (-511.428) [-511.858] (-510.531) -- 0:00:47
227500 -- (-510.914) [-509.257] (-515.076) (-509.593) * (-512.565) (-510.646) (-516.853) [-509.463] -- 0:00:47
228000 -- (-509.854) (-511.033) [-510.499] (-513.501) * (-513.022) [-510.931] (-511.603) (-513.255) -- 0:00:47
228500 -- (-511.510) [-511.717] (-510.932) (-511.200) * (-511.208) (-508.651) [-510.316] (-511.893) -- 0:00:47
229000 -- [-509.563] (-510.337) (-511.085) (-514.242) * (-510.781) [-516.232] (-510.415) (-512.859) -- 0:00:47
229500 -- (-509.090) (-511.388) [-508.910] (-510.800) * (-508.474) [-512.511] (-511.482) (-508.703) -- 0:00:47
230000 -- [-508.427] (-508.090) (-508.766) (-509.376) * (-509.356) (-513.372) (-509.464) [-508.467] -- 0:00:46
Average standard deviation of split frequencies: 0.018279
230500 -- (-509.394) [-510.072] (-509.831) (-512.468) * (-509.503) (-517.164) [-509.442] (-510.064) -- 0:00:46
231000 -- (-509.943) [-510.010] (-509.589) (-514.464) * (-509.706) (-510.736) [-509.106] (-510.607) -- 0:00:46
231500 -- (-512.776) (-509.424) (-512.508) [-512.005] * [-512.324] (-508.192) (-510.186) (-510.879) -- 0:00:46
232000 -- (-509.633) [-509.153] (-517.054) (-514.002) * (-514.483) (-508.430) (-512.490) [-509.022] -- 0:00:46
232500 -- (-510.070) (-508.470) (-516.957) [-509.614] * (-512.985) [-508.379] (-509.584) (-513.863) -- 0:00:46
233000 -- [-509.952] (-509.639) (-510.349) (-510.037) * (-514.713) (-509.880) (-510.962) [-510.037] -- 0:00:46
233500 -- (-511.041) (-509.798) [-510.064] (-513.370) * [-508.763] (-510.635) (-514.004) (-511.796) -- 0:00:45
234000 -- (-513.131) (-511.717) (-509.625) [-512.055] * (-513.196) (-510.431) [-510.009] (-509.428) -- 0:00:45
234500 -- (-512.202) (-511.223) (-514.438) [-511.785] * [-509.203] (-511.637) (-511.091) (-512.780) -- 0:00:45
235000 -- (-513.323) [-509.870] (-512.059) (-512.690) * (-509.050) (-509.790) [-508.815] (-512.454) -- 0:00:45
Average standard deviation of split frequencies: 0.017136
235500 -- (-510.364) (-510.707) [-509.692] (-510.500) * (-519.313) (-509.144) [-517.320] (-510.535) -- 0:00:48
236000 -- (-510.471) [-515.167] (-510.955) (-511.043) * (-511.034) (-508.173) [-508.857] (-512.367) -- 0:00:48
236500 -- [-511.983] (-512.211) (-509.639) (-511.260) * (-511.199) [-508.490] (-512.513) (-509.322) -- 0:00:48
237000 -- (-509.335) (-512.333) [-513.439] (-509.230) * (-508.512) [-511.130] (-510.226) (-512.092) -- 0:00:48
237500 -- (-511.521) (-509.264) (-514.141) [-509.362] * (-509.831) (-508.838) [-508.388] (-512.034) -- 0:00:48
238000 -- (-509.682) [-509.818] (-510.541) (-512.071) * [-508.859] (-509.122) (-508.139) (-510.358) -- 0:00:48
238500 -- (-513.639) [-510.356] (-510.135) (-510.520) * [-508.452] (-508.881) (-508.487) (-510.688) -- 0:00:47
239000 -- (-510.046) (-510.545) (-509.151) [-508.317] * (-510.746) (-512.660) (-512.977) [-509.968] -- 0:00:47
239500 -- [-509.215] (-508.849) (-515.496) (-510.389) * (-509.816) (-509.739) [-511.582] (-513.099) -- 0:00:47
240000 -- [-515.305] (-513.454) (-514.300) (-510.857) * (-508.804) (-509.128) [-509.885] (-515.093) -- 0:00:47
Average standard deviation of split frequencies: 0.017423
240500 -- (-511.239) (-512.993) [-510.430] (-515.568) * (-509.425) (-509.899) (-509.882) [-510.563] -- 0:00:47
241000 -- [-511.775] (-512.189) (-513.688) (-508.571) * (-508.935) (-509.272) (-509.890) [-512.031] -- 0:00:47
241500 -- (-509.323) (-513.679) (-511.180) [-508.468] * (-508.325) [-508.793] (-509.303) (-509.850) -- 0:00:47
242000 -- (-509.969) [-510.748] (-511.645) (-509.659) * (-511.800) (-511.281) [-509.384] (-509.974) -- 0:00:46
242500 -- (-508.685) (-511.706) (-511.625) [-509.748] * (-512.213) [-509.094] (-512.292) (-508.360) -- 0:00:46
243000 -- (-513.997) (-511.791) [-509.059] (-513.383) * [-511.385] (-508.816) (-512.239) (-508.604) -- 0:00:46
243500 -- (-516.454) (-521.032) [-509.673] (-512.025) * (-511.054) [-509.177] (-511.237) (-513.066) -- 0:00:46
244000 -- (-512.043) (-510.823) (-510.919) [-510.291] * [-511.010] (-508.659) (-510.545) (-511.822) -- 0:00:46
244500 -- [-510.899] (-515.551) (-510.590) (-510.097) * (-513.785) (-509.679) [-511.291] (-510.663) -- 0:00:46
245000 -- [-509.398] (-512.477) (-509.867) (-511.870) * [-509.971] (-511.367) (-512.549) (-513.564) -- 0:00:46
Average standard deviation of split frequencies: 0.016036
245500 -- (-509.010) (-513.593) [-512.664] (-510.331) * (-510.086) [-511.948] (-509.713) (-511.018) -- 0:00:46
246000 -- [-510.109] (-508.761) (-513.230) (-512.452) * [-511.908] (-511.749) (-509.637) (-510.793) -- 0:00:45
246500 -- (-512.119) [-509.587] (-513.368) (-512.993) * (-512.928) (-509.047) [-510.281] (-517.334) -- 0:00:45
247000 -- (-512.091) (-509.490) (-510.689) [-509.437] * [-509.590] (-509.018) (-509.070) (-514.966) -- 0:00:45
247500 -- [-508.963] (-508.739) (-512.285) (-509.358) * (-509.890) [-509.081] (-509.827) (-513.573) -- 0:00:45
248000 -- (-508.556) (-509.980) (-510.101) [-508.413] * (-508.991) (-511.106) [-511.144] (-508.577) -- 0:00:45
248500 -- (-508.424) (-511.342) [-510.542] (-509.191) * (-511.446) [-510.126] (-509.174) (-509.848) -- 0:00:45
249000 -- (-509.911) (-511.600) [-509.035] (-510.550) * (-513.641) (-517.152) (-515.680) [-509.109] -- 0:00:45
249500 -- [-509.148] (-510.965) (-508.844) (-511.229) * [-510.314] (-513.202) (-516.167) (-510.223) -- 0:00:45
250000 -- (-513.319) (-510.145) [-512.036] (-509.447) * (-509.111) (-511.996) (-508.926) [-509.632] -- 0:00:45
Average standard deviation of split frequencies: 0.015254
250500 -- (-511.440) [-509.041] (-511.903) (-510.584) * (-512.226) [-508.668] (-511.602) (-509.600) -- 0:00:44
251000 -- (-510.485) [-509.453] (-513.827) (-510.614) * [-510.700] (-511.021) (-510.501) (-509.125) -- 0:00:44
251500 -- (-510.398) (-511.231) (-509.958) [-509.774] * [-510.593] (-510.230) (-509.564) (-509.930) -- 0:00:44
252000 -- [-509.546] (-514.506) (-509.208) (-509.814) * (-510.460) (-510.465) (-509.786) [-512.293] -- 0:00:47
252500 -- [-511.210] (-509.749) (-510.395) (-511.461) * [-512.326] (-510.987) (-509.031) (-511.064) -- 0:00:47
253000 -- (-510.705) (-511.231) (-510.323) [-512.439] * [-513.219] (-509.714) (-510.692) (-510.844) -- 0:00:47
253500 -- (-510.526) (-509.015) [-511.856] (-509.276) * (-513.674) (-511.895) [-511.376] (-512.068) -- 0:00:47
254000 -- [-509.117] (-511.268) (-513.796) (-510.482) * (-510.251) (-511.545) (-511.130) [-508.515] -- 0:00:46
254500 -- (-508.520) [-509.664] (-514.463) (-512.915) * (-509.203) (-510.968) (-509.230) [-508.385] -- 0:00:46
255000 -- [-509.950] (-511.245) (-509.404) (-511.322) * (-508.459) [-509.232] (-509.215) (-508.993) -- 0:00:46
Average standard deviation of split frequencies: 0.015652
255500 -- [-509.508] (-509.662) (-510.587) (-510.556) * (-508.861) (-513.091) [-510.108] (-509.679) -- 0:00:46
256000 -- (-511.150) (-510.043) (-513.982) [-510.587] * [-509.950] (-510.701) (-512.455) (-510.182) -- 0:00:46
256500 -- [-510.564] (-510.924) (-512.189) (-512.868) * (-509.690) (-510.792) [-508.586] (-511.757) -- 0:00:46
257000 -- (-513.144) (-517.054) (-512.020) [-513.618] * [-508.545] (-508.371) (-508.864) (-510.643) -- 0:00:46
257500 -- (-508.941) (-513.981) [-508.166] (-509.279) * (-511.411) (-509.879) [-509.771] (-509.085) -- 0:00:46
258000 -- [-511.448] (-511.725) (-509.634) (-509.617) * [-508.513] (-509.454) (-511.066) (-510.442) -- 0:00:46
258500 -- (-509.745) (-512.709) [-513.942] (-512.616) * (-511.874) (-509.274) (-510.304) [-509.661] -- 0:00:45
259000 -- (-509.068) [-513.527] (-514.304) (-508.340) * [-510.448] (-509.464) (-510.525) (-508.823) -- 0:00:45
259500 -- (-511.898) [-511.521] (-512.450) (-509.270) * (-513.145) (-516.413) [-511.605] (-511.556) -- 0:00:45
260000 -- (-511.025) (-510.312) (-510.593) [-509.779] * (-514.839) (-510.048) (-511.167) [-509.744] -- 0:00:45
Average standard deviation of split frequencies: 0.014166
260500 -- (-508.820) [-509.699] (-510.402) (-512.200) * (-510.402) [-510.449] (-511.876) (-511.180) -- 0:00:45
261000 -- (-508.216) [-509.683] (-511.853) (-508.745) * (-509.396) (-510.473) [-509.265] (-511.623) -- 0:00:45
261500 -- (-508.993) (-509.922) [-508.894] (-508.922) * (-516.351) (-512.381) [-508.540] (-509.109) -- 0:00:45
262000 -- (-510.250) (-511.614) [-510.696] (-510.150) * [-512.484] (-511.894) (-508.609) (-511.030) -- 0:00:45
262500 -- [-509.807] (-513.112) (-508.210) (-510.345) * [-513.935] (-514.690) (-509.614) (-510.834) -- 0:00:44
263000 -- (-511.036) (-511.825) [-508.237] (-511.442) * (-513.301) (-511.210) (-509.430) [-511.380] -- 0:00:44
263500 -- [-511.068] (-511.266) (-509.375) (-509.913) * (-511.365) (-510.383) (-508.541) [-511.412] -- 0:00:44
264000 -- (-512.099) [-511.734] (-509.444) (-509.528) * (-512.492) (-513.159) [-512.217] (-511.807) -- 0:00:44
264500 -- [-509.611] (-510.531) (-511.483) (-509.988) * (-513.296) (-514.846) [-509.698] (-509.495) -- 0:00:44
265000 -- (-509.546) (-513.509) (-509.892) [-508.409] * (-513.013) [-508.289] (-510.211) (-509.951) -- 0:00:44
Average standard deviation of split frequencies: 0.013525
265500 -- (-510.598) (-509.065) [-510.877] (-511.280) * [-508.890] (-508.619) (-509.715) (-512.634) -- 0:00:44
266000 -- (-509.620) (-513.714) [-511.502] (-509.699) * [-508.242] (-517.004) (-512.018) (-512.885) -- 0:00:44
266500 -- (-513.191) (-512.224) [-510.752] (-509.743) * (-512.290) (-513.209) [-512.445] (-512.536) -- 0:00:44
267000 -- (-510.103) (-510.564) (-511.092) [-508.261] * [-514.477] (-511.188) (-513.957) (-510.468) -- 0:00:43
267500 -- [-508.373] (-509.533) (-512.377) (-509.569) * (-512.293) (-512.247) [-508.669] (-508.812) -- 0:00:43
268000 -- [-509.062] (-513.650) (-509.869) (-512.853) * (-510.222) (-509.221) (-511.420) [-509.744] -- 0:00:43
268500 -- [-508.844] (-510.949) (-510.382) (-510.863) * [-511.096] (-510.558) (-510.961) (-508.528) -- 0:00:43
269000 -- (-509.266) (-509.790) (-511.444) [-510.036] * [-512.037] (-513.089) (-515.334) (-512.877) -- 0:00:46
269500 -- [-512.050] (-509.432) (-510.051) (-509.502) * (-510.158) (-513.841) (-511.239) [-511.184] -- 0:00:46
270000 -- (-510.358) [-511.094] (-509.193) (-510.998) * (-511.955) [-510.421] (-511.401) (-509.802) -- 0:00:45
Average standard deviation of split frequencies: 0.013566
270500 -- (-511.252) (-508.620) (-510.864) [-511.362] * [-509.380] (-508.923) (-510.047) (-514.220) -- 0:00:45
271000 -- (-510.267) (-508.838) (-515.263) [-512.005] * (-509.300) [-509.406] (-508.213) (-515.679) -- 0:00:45
271500 -- [-509.466] (-508.124) (-509.204) (-511.054) * (-509.405) (-511.281) [-508.464] (-509.753) -- 0:00:45
272000 -- (-509.339) (-509.958) (-508.421) [-513.225] * [-510.953] (-508.968) (-508.539) (-515.755) -- 0:00:45
272500 -- (-508.764) (-514.227) (-509.845) [-510.779] * (-510.354) (-509.078) (-511.153) [-512.507] -- 0:00:45
273000 -- (-511.694) [-510.126] (-511.368) (-510.772) * [-508.539] (-512.468) (-509.715) (-513.806) -- 0:00:45
273500 -- (-510.626) [-510.219] (-509.515) (-510.194) * [-509.710] (-512.855) (-510.539) (-514.531) -- 0:00:45
274000 -- (-513.040) (-511.039) (-509.536) [-510.619] * (-510.674) (-512.971) (-512.730) [-510.397] -- 0:00:45
274500 -- (-510.828) (-515.557) [-510.237] (-508.439) * (-510.294) (-511.462) (-512.575) [-510.978] -- 0:00:44
275000 -- [-510.269] (-512.711) (-510.417) (-508.164) * (-512.159) (-510.989) (-511.557) [-509.289] -- 0:00:44
Average standard deviation of split frequencies: 0.012525
275500 -- (-509.686) (-514.014) [-512.233] (-512.416) * (-512.031) (-509.323) [-511.812] (-513.216) -- 0:00:44
276000 -- (-510.761) [-509.945] (-510.342) (-512.849) * [-510.423] (-510.190) (-509.954) (-510.044) -- 0:00:44
276500 -- (-509.163) (-512.556) (-511.830) [-510.233] * (-515.015) (-510.742) [-509.626] (-511.967) -- 0:00:44
277000 -- [-509.672] (-512.269) (-510.541) (-513.425) * (-509.316) (-511.551) [-515.405] (-509.536) -- 0:00:44
277500 -- (-508.382) (-512.062) (-509.665) [-510.941] * (-510.535) (-511.972) [-511.049] (-508.568) -- 0:00:44
278000 -- (-512.894) [-509.367] (-509.878) (-510.616) * (-510.901) (-509.640) [-511.715] (-509.314) -- 0:00:44
278500 -- (-510.810) [-510.405] (-510.187) (-513.140) * [-509.980] (-511.701) (-511.268) (-509.841) -- 0:00:44
279000 -- (-512.050) (-509.042) [-511.198] (-510.207) * (-509.400) (-510.677) (-514.712) [-509.025] -- 0:00:43
279500 -- (-511.336) [-509.953] (-510.594) (-510.292) * [-509.581] (-513.330) (-511.829) (-511.215) -- 0:00:43
280000 -- (-514.013) (-511.764) [-514.167] (-511.254) * [-508.245] (-517.517) (-509.018) (-510.940) -- 0:00:43
Average standard deviation of split frequencies: 0.012877
280500 -- (-509.406) (-511.795) [-510.232] (-513.868) * [-513.479] (-516.960) (-511.150) (-511.678) -- 0:00:43
281000 -- (-509.541) (-509.275) [-509.802] (-515.340) * (-510.739) [-513.668] (-508.630) (-513.234) -- 0:00:43
281500 -- (-508.171) (-513.509) (-509.201) [-512.462] * (-508.612) (-510.171) (-509.517) [-510.390] -- 0:00:43
282000 -- (-509.552) [-509.459] (-512.427) (-512.356) * (-509.925) (-509.206) (-508.981) [-510.069] -- 0:00:43
282500 -- (-510.914) (-511.175) (-508.833) [-509.984] * (-515.396) (-510.491) [-512.414] (-508.695) -- 0:00:43
283000 -- (-510.066) [-512.094] (-511.083) (-514.529) * (-508.957) (-511.020) (-511.312) [-509.125] -- 0:00:43
283500 -- (-510.054) [-515.520] (-509.682) (-513.799) * [-511.988] (-511.250) (-509.296) (-509.096) -- 0:00:42
284000 -- [-509.385] (-510.923) (-509.664) (-511.022) * [-512.830] (-515.053) (-510.408) (-513.736) -- 0:00:42
284500 -- (-511.149) (-510.592) (-509.279) [-510.600] * [-510.006] (-511.142) (-509.277) (-509.261) -- 0:00:42
285000 -- [-513.731] (-510.241) (-512.634) (-512.556) * (-509.244) (-511.656) (-511.922) [-509.301] -- 0:00:45
Average standard deviation of split frequencies: 0.013003
285500 -- (-511.522) (-509.137) [-508.450] (-512.094) * (-511.077) (-509.885) (-511.855) [-508.344] -- 0:00:45
286000 -- [-510.857] (-511.420) (-511.240) (-509.120) * (-510.461) (-514.058) [-511.912] (-510.783) -- 0:00:44
286500 -- (-509.908) (-511.970) (-512.855) [-510.463] * [-510.093] (-512.381) (-509.418) (-513.250) -- 0:00:44
287000 -- (-509.172) (-509.379) [-509.831] (-515.658) * (-513.372) (-512.428) (-509.505) [-509.153] -- 0:00:44
287500 -- (-512.979) [-511.950] (-509.065) (-517.422) * (-511.934) (-513.184) (-511.342) [-509.126] -- 0:00:44
288000 -- (-509.724) (-509.846) [-513.855] (-509.856) * (-511.585) [-511.372] (-510.995) (-509.752) -- 0:00:44
288500 -- (-509.053) [-509.116] (-509.241) (-512.779) * (-509.612) (-509.459) [-509.967] (-509.787) -- 0:00:44
289000 -- [-509.242] (-508.645) (-510.203) (-514.152) * (-512.895) [-512.223] (-512.846) (-509.537) -- 0:00:44
289500 -- (-508.965) [-515.382] (-509.527) (-509.762) * (-510.387) (-512.236) [-509.919] (-509.363) -- 0:00:44
290000 -- (-509.568) [-509.412] (-508.832) (-509.582) * [-510.392] (-509.817) (-510.297) (-509.325) -- 0:00:44
Average standard deviation of split frequencies: 0.011263
290500 -- (-510.882) (-510.351) [-508.530] (-512.254) * [-512.784] (-510.460) (-510.241) (-510.674) -- 0:00:43
291000 -- (-512.961) [-508.308] (-509.247) (-511.377) * (-511.611) (-509.095) [-508.322] (-511.335) -- 0:00:43
291500 -- [-511.298] (-510.814) (-513.808) (-515.945) * [-509.469] (-509.156) (-508.951) (-509.645) -- 0:00:43
292000 -- (-511.914) (-513.285) [-511.002] (-509.365) * (-511.094) [-510.817] (-510.707) (-511.247) -- 0:00:43
292500 -- (-510.786) (-511.520) [-512.274] (-511.170) * [-509.720] (-509.460) (-512.485) (-509.974) -- 0:00:43
293000 -- (-510.128) (-511.792) (-510.527) [-509.465] * (-512.953) (-510.445) (-510.069) [-509.519] -- 0:00:43
293500 -- (-510.323) (-513.058) [-510.574] (-513.757) * [-508.751] (-511.646) (-509.508) (-511.113) -- 0:00:43
294000 -- (-509.765) (-511.557) (-508.516) [-511.360] * (-508.931) (-511.996) [-508.836] (-510.788) -- 0:00:43
294500 -- [-511.506] (-513.763) (-509.347) (-514.481) * (-509.060) [-511.865] (-511.567) (-509.388) -- 0:00:43
295000 -- (-512.459) (-512.404) (-509.581) [-513.896] * [-512.204] (-513.347) (-513.413) (-510.429) -- 0:00:43
Average standard deviation of split frequencies: 0.011325
295500 -- (-509.178) [-508.531] (-511.520) (-513.172) * [-509.227] (-511.504) (-512.350) (-510.054) -- 0:00:42
296000 -- (-510.847) (-510.468) (-509.002) [-511.883] * (-511.452) (-509.959) (-511.562) [-511.309] -- 0:00:42
296500 -- (-514.164) (-511.167) (-508.545) [-509.435] * (-509.565) [-510.416] (-511.210) (-515.133) -- 0:00:42
297000 -- [-511.563] (-513.712) (-508.693) (-511.981) * [-515.258] (-508.972) (-512.883) (-508.945) -- 0:00:42
297500 -- (-510.361) [-511.563] (-508.593) (-509.078) * (-508.719) [-512.794] (-508.273) (-508.839) -- 0:00:42
298000 -- [-512.869] (-510.149) (-509.859) (-509.510) * (-509.145) [-509.184] (-508.158) (-508.570) -- 0:00:42
298500 -- (-516.378) (-510.127) [-509.380] (-512.639) * (-511.265) (-513.765) [-510.550] (-511.900) -- 0:00:42
299000 -- (-518.728) [-509.210] (-510.319) (-513.173) * (-513.391) (-510.115) (-513.112) [-510.516] -- 0:00:42
299500 -- (-510.794) [-516.102] (-512.962) (-513.411) * (-514.518) [-508.714] (-510.445) (-509.944) -- 0:00:42
300000 -- (-511.553) [-512.528] (-509.432) (-508.752) * (-510.790) [-509.541] (-510.345) (-511.071) -- 0:00:42
Average standard deviation of split frequencies: 0.012635
300500 -- (-510.397) [-508.944] (-511.969) (-510.054) * (-509.317) (-509.550) (-509.431) [-513.078] -- 0:00:44
301000 -- (-510.401) (-509.947) (-514.902) [-510.511] * (-514.679) (-512.149) [-509.319] (-510.125) -- 0:00:44
301500 -- (-509.118) [-511.918] (-509.600) (-510.273) * (-510.540) (-511.115) (-510.771) [-509.145] -- 0:00:44
302000 -- (-510.001) (-512.746) (-512.141) [-511.276] * (-509.325) [-509.512] (-509.610) (-510.697) -- 0:00:43
302500 -- (-516.431) (-509.902) (-509.315) [-509.952] * (-509.841) (-510.290) [-515.008] (-511.213) -- 0:00:43
303000 -- (-509.206) (-508.818) [-510.430] (-512.626) * (-512.340) (-513.068) (-510.664) [-510.565] -- 0:00:43
303500 -- (-508.548) (-509.992) [-509.359] (-511.197) * (-512.428) (-512.114) (-509.201) [-510.205] -- 0:00:43
304000 -- (-509.740) (-509.224) [-509.135] (-511.208) * (-510.611) [-509.453] (-509.607) (-510.155) -- 0:00:43
304500 -- (-511.425) [-508.670] (-509.365) (-509.572) * (-510.318) [-509.757] (-512.366) (-510.009) -- 0:00:43
305000 -- (-515.485) (-509.784) [-510.243] (-508.976) * (-508.673) (-509.006) [-510.265] (-509.732) -- 0:00:43
Average standard deviation of split frequencies: 0.011690
305500 -- [-508.692] (-510.875) (-509.485) (-510.051) * (-515.204) (-516.952) [-509.126] (-509.031) -- 0:00:43
306000 -- [-510.039] (-510.902) (-509.336) (-509.402) * [-510.522] (-510.668) (-512.022) (-510.595) -- 0:00:43
306500 -- (-510.356) [-509.466] (-509.455) (-510.961) * (-510.131) (-509.825) [-509.613] (-512.054) -- 0:00:42
307000 -- (-510.200) (-515.112) (-511.057) [-512.215] * (-509.288) [-509.831] (-510.269) (-513.909) -- 0:00:42
307500 -- [-512.567] (-515.068) (-511.188) (-518.248) * [-511.807] (-522.448) (-508.426) (-511.516) -- 0:00:42
308000 -- [-509.039] (-513.798) (-510.340) (-508.838) * [-508.781] (-509.833) (-510.946) (-510.494) -- 0:00:42
308500 -- (-513.116) (-512.216) (-508.330) [-510.288] * (-511.333) (-510.912) [-510.375] (-510.726) -- 0:00:42
309000 -- (-512.908) (-511.108) (-509.893) [-510.976] * (-508.756) (-509.802) (-510.177) [-510.319] -- 0:00:42
309500 -- (-509.144) (-510.486) [-510.005] (-509.903) * (-509.717) (-508.877) (-512.663) [-510.473] -- 0:00:42
310000 -- (-508.685) [-511.215] (-513.459) (-511.254) * [-511.737] (-509.046) (-514.592) (-508.855) -- 0:00:42
Average standard deviation of split frequencies: 0.011855
310500 -- [-511.329] (-510.621) (-508.686) (-512.432) * (-509.916) (-509.474) (-511.276) [-508.998] -- 0:00:42
311000 -- (-509.597) [-509.746] (-509.301) (-509.185) * (-513.064) [-509.458] (-512.847) (-509.394) -- 0:00:42
311500 -- [-511.196] (-510.388) (-516.032) (-509.614) * (-510.967) (-508.781) (-509.551) [-512.096] -- 0:00:41
312000 -- (-514.826) (-511.373) [-510.103] (-512.010) * (-513.689) [-513.295] (-509.079) (-511.077) -- 0:00:41
312500 -- (-509.411) [-510.200] (-512.956) (-513.159) * (-510.574) (-511.386) (-510.857) [-513.301] -- 0:00:41
313000 -- [-511.387] (-508.487) (-512.103) (-512.608) * (-510.709) (-510.410) (-509.421) [-510.208] -- 0:00:41
313500 -- (-510.638) (-514.332) [-509.823] (-511.965) * (-508.997) (-509.763) [-510.136] (-511.211) -- 0:00:41
314000 -- (-514.965) (-512.600) [-513.665] (-508.587) * (-512.713) (-512.302) (-511.245) [-509.368] -- 0:00:41
314500 -- [-510.213] (-517.454) (-512.412) (-508.163) * (-511.335) (-509.654) (-509.655) [-511.602] -- 0:00:41
315000 -- (-511.033) (-511.724) (-508.703) [-510.338] * (-512.800) [-509.263] (-512.711) (-511.116) -- 0:00:41
Average standard deviation of split frequencies: 0.012400
315500 -- [-509.402] (-510.711) (-509.931) (-509.311) * (-510.726) (-511.003) [-508.920] (-511.117) -- 0:00:41
316000 -- [-509.593] (-513.377) (-510.847) (-511.933) * [-510.486] (-511.217) (-511.408) (-508.922) -- 0:00:41
316500 -- (-510.984) (-516.725) [-511.196] (-509.280) * [-511.054] (-509.266) (-509.998) (-512.314) -- 0:00:41
317000 -- [-516.789] (-515.429) (-510.262) (-510.465) * [-514.265] (-510.976) (-509.114) (-510.196) -- 0:00:43
317500 -- (-512.152) (-512.329) (-511.765) [-509.063] * (-510.751) (-511.637) (-520.842) [-509.936] -- 0:00:42
318000 -- (-511.163) (-508.427) (-510.706) [-509.837] * [-509.375] (-511.127) (-514.695) (-510.880) -- 0:00:42
318500 -- (-509.343) [-511.040] (-513.139) (-510.400) * (-509.710) (-512.215) (-514.852) [-509.324] -- 0:00:42
319000 -- (-510.390) (-509.685) [-510.464] (-510.070) * [-508.423] (-509.224) (-510.799) (-508.806) -- 0:00:42
319500 -- (-512.378) (-510.436) (-510.220) [-514.943] * (-515.943) [-508.480] (-509.478) (-511.997) -- 0:00:42
320000 -- (-516.656) (-510.092) (-508.981) [-510.052] * (-516.767) [-511.455] (-509.813) (-512.731) -- 0:00:42
Average standard deviation of split frequencies: 0.011577
320500 -- (-511.830) (-512.096) (-509.511) [-509.521] * (-509.258) [-510.737] (-510.275) (-513.840) -- 0:00:42
321000 -- (-513.990) [-509.554] (-512.780) (-511.999) * (-509.859) [-510.803] (-509.172) (-510.265) -- 0:00:42
321500 -- [-509.555] (-508.548) (-511.612) (-516.211) * (-510.063) (-508.230) [-510.335] (-509.518) -- 0:00:42
322000 -- (-512.503) [-510.961] (-511.077) (-509.487) * (-509.479) [-508.983] (-511.071) (-511.567) -- 0:00:42
322500 -- (-511.966) (-509.177) (-509.247) [-510.580] * (-510.980) (-509.606) (-508.722) [-510.597] -- 0:00:42
323000 -- (-510.145) (-509.642) [-508.344] (-510.394) * (-511.267) (-509.629) (-509.856) [-509.283] -- 0:00:41
323500 -- (-511.089) (-512.571) (-508.675) [-508.967] * (-511.680) [-510.561] (-509.122) (-512.516) -- 0:00:41
324000 -- (-509.179) (-512.266) (-512.129) [-510.260] * (-510.533) (-510.131) [-508.547] (-510.345) -- 0:00:41
324500 -- (-511.868) (-510.004) [-510.055] (-512.240) * (-510.965) (-510.594) [-509.863] (-508.565) -- 0:00:41
325000 -- (-510.447) (-509.162) (-511.273) [-510.040] * (-512.170) (-511.205) (-511.008) [-510.209] -- 0:00:41
Average standard deviation of split frequencies: 0.011483
325500 -- [-509.085] (-508.910) (-509.250) (-514.642) * (-512.554) (-510.783) [-511.979] (-511.468) -- 0:00:41
326000 -- (-512.744) [-510.174] (-510.322) (-508.936) * [-511.075] (-513.751) (-511.392) (-510.216) -- 0:00:41
326500 -- [-515.261] (-509.346) (-512.817) (-509.815) * [-508.306] (-510.728) (-511.670) (-515.365) -- 0:00:41
327000 -- (-514.093) (-509.396) [-508.805] (-511.616) * (-509.581) [-508.543] (-514.504) (-513.628) -- 0:00:41
327500 -- [-510.604] (-508.621) (-512.731) (-512.401) * [-513.981] (-511.215) (-510.989) (-509.615) -- 0:00:41
328000 -- [-511.374] (-510.082) (-513.384) (-512.781) * (-513.858) (-509.618) [-509.461] (-509.626) -- 0:00:40
328500 -- (-510.364) (-511.305) (-510.166) [-509.244] * (-514.258) [-510.049] (-509.970) (-510.350) -- 0:00:40
329000 -- (-512.156) [-510.958] (-510.390) (-510.723) * (-509.078) (-512.331) [-508.334] (-510.004) -- 0:00:40
329500 -- (-508.801) (-510.090) (-509.639) [-510.408] * (-510.750) (-512.325) [-510.512] (-516.751) -- 0:00:40
330000 -- [-509.639] (-509.686) (-510.606) (-509.230) * (-514.237) [-508.845] (-509.543) (-510.889) -- 0:00:40
Average standard deviation of split frequencies: 0.011850
330500 -- (-508.822) (-508.586) [-509.696] (-515.777) * [-511.574] (-511.834) (-508.875) (-513.345) -- 0:00:40
331000 -- (-509.438) (-511.242) (-509.651) [-511.066] * (-511.444) (-510.769) (-514.056) [-511.025] -- 0:00:40
331500 -- [-511.131] (-512.478) (-511.194) (-512.123) * (-513.411) (-509.901) [-509.773] (-509.210) -- 0:00:40
332000 -- [-512.928] (-510.170) (-509.405) (-511.556) * [-512.601] (-511.272) (-509.207) (-514.523) -- 0:00:40
332500 -- (-512.816) [-512.909] (-513.226) (-511.723) * (-511.616) [-509.776] (-509.665) (-510.384) -- 0:00:40
333000 -- (-512.957) (-510.110) (-509.422) [-508.346] * [-513.883] (-511.126) (-509.428) (-510.119) -- 0:00:40
333500 -- (-514.279) (-510.950) (-509.793) [-510.924] * (-509.665) [-511.027] (-510.404) (-510.969) -- 0:00:41
334000 -- (-509.383) [-508.466] (-509.455) (-514.805) * [-512.194] (-511.432) (-510.797) (-510.396) -- 0:00:41
334500 -- (-508.548) (-510.346) [-510.448] (-514.561) * (-510.404) [-508.613] (-510.784) (-511.077) -- 0:00:41
335000 -- (-510.091) [-509.363] (-508.539) (-516.747) * (-510.099) [-509.862] (-509.074) (-511.419) -- 0:00:41
Average standard deviation of split frequencies: 0.010976
335500 -- [-511.560] (-510.272) (-512.243) (-517.366) * (-512.643) (-510.294) (-511.399) [-512.747] -- 0:00:41
336000 -- [-508.850] (-510.252) (-516.160) (-510.267) * [-510.544] (-510.428) (-511.497) (-513.559) -- 0:00:41
336500 -- [-509.018] (-512.662) (-514.392) (-511.331) * [-510.068] (-510.515) (-509.349) (-515.674) -- 0:00:41
337000 -- (-509.315) [-510.491] (-510.990) (-511.232) * (-510.326) [-508.615] (-510.561) (-511.201) -- 0:00:41
337500 -- (-510.412) [-508.633] (-511.926) (-510.220) * (-510.510) [-508.885] (-514.713) (-509.063) -- 0:00:41
338000 -- [-509.766] (-509.088) (-508.519) (-508.287) * [-508.909] (-511.738) (-514.863) (-508.916) -- 0:00:41
338500 -- (-510.697) [-508.852] (-509.070) (-511.554) * (-511.464) [-512.506] (-510.201) (-510.750) -- 0:00:41
339000 -- (-508.925) [-512.967] (-511.624) (-509.184) * (-511.014) (-511.662) [-510.288] (-508.877) -- 0:00:40
339500 -- (-511.239) (-514.924) [-513.986] (-509.634) * (-510.388) [-509.124] (-510.308) (-511.424) -- 0:00:40
340000 -- [-511.457] (-510.225) (-509.901) (-509.782) * (-511.893) (-508.793) [-509.920] (-510.290) -- 0:00:40
Average standard deviation of split frequencies: 0.009686
340500 -- (-510.594) (-511.046) [-510.386] (-514.639) * (-509.067) (-514.434) [-508.595] (-508.802) -- 0:00:40
341000 -- (-512.079) (-511.262) [-510.068] (-508.648) * (-510.278) (-511.805) (-509.915) [-509.470] -- 0:00:40
341500 -- [-508.953] (-511.681) (-516.637) (-509.717) * [-510.308] (-509.023) (-513.348) (-509.729) -- 0:00:40
342000 -- [-511.206] (-512.824) (-509.256) (-510.295) * (-509.774) (-509.492) (-510.798) [-512.590] -- 0:00:40
342500 -- (-514.877) (-511.304) (-508.685) [-511.289] * (-509.364) [-509.822] (-510.147) (-510.085) -- 0:00:40
343000 -- (-513.362) [-509.678] (-508.690) (-508.710) * (-511.759) [-509.129] (-511.268) (-509.263) -- 0:00:40
343500 -- (-515.439) (-508.131) (-509.326) [-511.392] * (-515.461) [-513.464] (-512.112) (-511.863) -- 0:00:40
344000 -- (-510.586) (-509.713) (-509.847) [-512.779] * (-515.733) (-510.429) [-508.906] (-510.861) -- 0:00:40
344500 -- (-509.428) (-510.171) (-509.513) [-510.298] * (-513.947) (-509.201) [-510.778] (-510.132) -- 0:00:39
345000 -- (-512.172) [-510.071] (-511.295) (-511.864) * (-508.475) (-509.010) (-512.722) [-511.291] -- 0:00:39
Average standard deviation of split frequencies: 0.009234
345500 -- (-513.575) (-510.249) [-511.689] (-509.662) * (-508.691) [-511.077] (-509.270) (-514.369) -- 0:00:39
346000 -- (-512.339) [-510.421] (-512.685) (-510.810) * (-510.251) (-515.105) [-508.229] (-509.358) -- 0:00:39
346500 -- (-510.461) (-509.248) (-514.609) [-509.913] * (-511.022) [-511.091] (-508.620) (-510.483) -- 0:00:39
347000 -- [-508.885] (-509.269) (-510.534) (-508.548) * (-508.947) [-509.917] (-510.440) (-518.101) -- 0:00:39
347500 -- (-509.299) [-510.456] (-510.766) (-508.244) * (-512.683) (-510.322) [-509.745] (-511.675) -- 0:00:39
348000 -- [-512.425] (-509.521) (-512.535) (-508.962) * (-513.981) (-510.998) [-510.780] (-510.779) -- 0:00:39
348500 -- (-509.151) [-509.873] (-512.488) (-509.543) * (-511.544) (-513.773) [-508.701] (-510.448) -- 0:00:39
349000 -- (-508.994) [-510.498] (-510.645) (-509.527) * (-512.127) (-512.544) [-511.378] (-509.352) -- 0:00:39
349500 -- (-509.242) (-508.665) (-509.043) [-509.295] * [-509.826] (-509.696) (-511.225) (-510.832) -- 0:00:39
350000 -- (-510.541) (-511.403) [-510.673] (-509.296) * [-511.846] (-510.692) (-510.589) (-511.265) -- 0:00:40
Average standard deviation of split frequencies: 0.008813
350500 -- (-510.473) (-509.953) [-511.142] (-512.819) * (-509.465) (-509.280) [-511.563] (-510.263) -- 0:00:40
351000 -- [-510.886] (-510.065) (-512.259) (-509.642) * [-512.941] (-510.545) (-511.366) (-509.823) -- 0:00:40
351500 -- [-511.069] (-509.239) (-513.438) (-510.343) * [-511.453] (-511.075) (-509.063) (-511.605) -- 0:00:40
352000 -- (-509.244) [-510.166] (-509.218) (-510.723) * (-512.844) [-509.594] (-513.034) (-509.719) -- 0:00:40
352500 -- (-513.094) (-512.559) (-508.273) [-510.369] * (-512.678) (-509.378) [-510.142] (-512.387) -- 0:00:40
353000 -- (-511.135) (-511.339) [-509.035] (-509.907) * (-512.249) (-510.615) (-511.062) [-509.433] -- 0:00:40
353500 -- (-509.172) (-511.358) (-513.125) [-509.997] * (-510.078) [-508.718] (-510.733) (-513.807) -- 0:00:40
354000 -- (-510.056) [-508.622] (-511.810) (-510.803) * (-511.539) (-510.191) (-509.702) [-513.751] -- 0:00:40
354500 -- (-509.947) [-511.992] (-509.900) (-517.805) * (-511.345) (-509.927) (-514.182) [-510.055] -- 0:00:40
355000 -- (-510.376) [-512.542] (-509.833) (-517.936) * [-510.502] (-511.558) (-519.438) (-509.940) -- 0:00:39
Average standard deviation of split frequencies: 0.008901
355500 -- (-511.068) [-509.672] (-512.431) (-510.519) * [-510.915] (-511.349) (-508.465) (-514.582) -- 0:00:39
356000 -- [-510.871] (-513.964) (-513.715) (-509.436) * (-509.852) [-513.395] (-514.609) (-510.042) -- 0:00:39
356500 -- (-509.298) (-511.489) (-511.721) [-509.908] * (-514.381) (-511.955) (-509.237) [-514.005] -- 0:00:39
357000 -- [-510.756] (-509.633) (-510.244) (-510.201) * (-509.347) [-510.794] (-511.687) (-510.618) -- 0:00:39
357500 -- (-509.221) (-512.380) [-508.839] (-509.399) * (-509.772) [-514.543] (-511.255) (-509.783) -- 0:00:39
358000 -- (-513.732) [-513.284] (-510.474) (-509.912) * (-509.732) [-509.143] (-510.601) (-511.059) -- 0:00:39
358500 -- (-513.401) (-509.556) [-514.558] (-512.482) * (-511.102) (-513.579) [-510.301] (-512.865) -- 0:00:39
359000 -- (-515.924) [-510.731] (-512.251) (-514.013) * [-509.230] (-508.742) (-509.517) (-509.767) -- 0:00:39
359500 -- (-510.310) (-512.127) [-512.124] (-517.392) * (-513.217) (-508.754) (-510.847) [-508.613] -- 0:00:39
360000 -- (-511.066) (-510.341) [-509.954] (-512.224) * (-511.439) [-511.754] (-510.370) (-512.451) -- 0:00:39
Average standard deviation of split frequencies: 0.007761
360500 -- (-512.903) (-509.539) [-508.415] (-512.105) * [-509.560] (-511.207) (-511.744) (-509.559) -- 0:00:39
361000 -- [-509.258] (-510.140) (-509.336) (-511.328) * (-509.580) [-509.149] (-509.074) (-508.207) -- 0:00:38
361500 -- (-509.300) (-509.363) (-508.289) [-508.577] * (-509.093) [-512.180] (-509.253) (-508.705) -- 0:00:38
362000 -- (-512.425) (-509.599) (-510.418) [-508.937] * (-508.377) [-513.198] (-509.354) (-510.436) -- 0:00:38
362500 -- (-510.075) (-513.284) [-511.795] (-509.215) * (-509.456) (-509.892) [-509.064] (-512.100) -- 0:00:38
363000 -- (-511.754) [-511.575] (-508.789) (-511.553) * (-509.978) (-512.593) [-509.090] (-512.500) -- 0:00:38
363500 -- (-510.499) (-513.395) [-509.952] (-514.066) * [-510.673] (-509.440) (-512.052) (-512.525) -- 0:00:38
364000 -- (-511.628) (-510.360) [-511.495] (-510.462) * (-511.502) [-509.296] (-513.535) (-512.292) -- 0:00:38
364500 -- (-511.528) (-508.671) [-512.284] (-509.923) * (-512.134) (-510.119) [-509.290] (-511.920) -- 0:00:38
365000 -- (-513.278) [-509.635] (-510.771) (-509.054) * [-508.969] (-515.091) (-511.722) (-510.300) -- 0:00:38
Average standard deviation of split frequencies: 0.008183
365500 -- [-509.410] (-509.606) (-516.634) (-509.511) * (-513.973) (-512.006) (-508.774) [-509.250] -- 0:00:38
366000 -- (-511.226) (-512.169) (-510.093) [-509.493] * (-510.723) (-508.608) [-511.327] (-508.421) -- 0:00:38
366500 -- [-509.843] (-509.770) (-509.680) (-509.135) * (-514.777) [-511.213] (-509.114) (-508.400) -- 0:00:39
367000 -- [-509.613] (-511.718) (-510.789) (-510.735) * (-509.225) (-512.120) (-511.325) [-509.554] -- 0:00:39
367500 -- (-509.525) (-510.064) [-511.133] (-510.928) * (-510.108) (-509.114) [-511.153] (-512.016) -- 0:00:39
368000 -- (-509.625) (-515.030) [-511.093] (-509.747) * (-517.072) (-509.436) (-509.671) [-508.936] -- 0:00:39
368500 -- (-514.193) [-508.956] (-510.899) (-508.488) * (-512.315) [-509.449] (-509.568) (-509.680) -- 0:00:39
369000 -- (-508.802) [-509.928] (-511.867) (-509.296) * [-509.010] (-509.474) (-513.852) (-508.715) -- 0:00:39
369500 -- (-510.473) (-513.180) (-509.156) [-509.458] * (-511.102) (-508.246) [-511.113] (-515.724) -- 0:00:39
370000 -- (-511.016) [-511.456] (-512.251) (-509.216) * (-509.596) (-510.939) [-515.347] (-515.581) -- 0:00:39
Average standard deviation of split frequencies: 0.007233
370500 -- (-512.887) (-510.018) (-511.740) [-510.901] * (-513.728) [-509.963] (-509.561) (-510.777) -- 0:00:39
371000 -- [-510.699] (-509.943) (-510.731) (-511.113) * (-512.183) (-510.122) [-509.742] (-509.329) -- 0:00:38
371500 -- (-511.089) (-512.950) (-508.298) [-511.216] * [-514.752] (-514.762) (-513.762) (-510.355) -- 0:00:38
372000 -- (-509.280) (-511.823) [-509.218] (-511.476) * [-508.879] (-510.954) (-512.016) (-509.619) -- 0:00:38
372500 -- [-511.935] (-510.494) (-510.436) (-509.875) * [-509.137] (-512.619) (-510.742) (-512.030) -- 0:00:38
373000 -- (-513.468) [-517.201] (-518.058) (-512.633) * (-511.293) [-509.066] (-509.671) (-512.557) -- 0:00:38
373500 -- (-509.769) [-511.430] (-512.539) (-508.830) * [-509.440] (-509.861) (-515.445) (-510.399) -- 0:00:38
374000 -- (-508.591) (-515.703) [-511.093] (-508.722) * (-509.415) (-513.763) (-510.800) [-511.061] -- 0:00:38
374500 -- (-509.583) [-508.873] (-515.819) (-508.187) * (-509.956) (-510.943) (-513.538) [-508.955] -- 0:00:38
375000 -- (-509.905) [-510.594] (-517.487) (-510.188) * (-508.612) (-509.762) [-513.167] (-512.035) -- 0:00:38
Average standard deviation of split frequencies: 0.007052
375500 -- (-510.400) (-512.794) (-513.497) [-510.374] * (-509.385) (-515.712) [-510.299] (-512.760) -- 0:00:38
376000 -- [-510.613] (-510.137) (-510.056) (-511.514) * (-508.532) (-510.379) [-510.182] (-512.469) -- 0:00:38
376500 -- (-510.443) (-515.381) (-511.536) [-509.168] * (-509.972) (-511.742) [-510.605] (-512.442) -- 0:00:38
377000 -- [-512.345] (-510.247) (-510.273) (-510.634) * (-508.701) (-509.484) (-514.220) [-508.998] -- 0:00:38
377500 -- (-511.357) (-508.496) (-509.557) [-509.383] * (-511.107) (-511.812) (-508.056) [-508.439] -- 0:00:37
378000 -- (-512.647) [-509.731] (-509.630) (-508.846) * (-513.957) (-510.139) [-510.684] (-508.752) -- 0:00:37
378500 -- (-509.707) (-512.027) (-511.471) [-515.772] * [-512.204] (-511.436) (-509.483) (-509.683) -- 0:00:37
379000 -- (-510.256) (-509.841) (-511.979) [-509.335] * [-508.382] (-510.320) (-512.329) (-510.131) -- 0:00:37
379500 -- (-508.562) (-509.934) (-511.742) [-508.961] * [-508.094] (-509.871) (-510.899) (-508.928) -- 0:00:37
380000 -- [-509.977] (-509.432) (-510.159) (-511.016) * (-508.629) (-510.947) (-510.320) [-509.343] -- 0:00:37
Average standard deviation of split frequencies: 0.007649
380500 -- (-509.479) (-513.151) [-508.419] (-510.596) * [-510.995] (-509.427) (-512.305) (-509.102) -- 0:00:37
381000 -- [-508.854] (-510.600) (-508.971) (-511.746) * (-510.577) (-509.023) [-512.768] (-514.180) -- 0:00:37
381500 -- (-511.976) (-508.649) (-510.826) [-510.856] * (-510.802) [-510.922] (-508.988) (-514.507) -- 0:00:37
382000 -- [-509.687] (-511.624) (-509.664) (-510.547) * [-509.090] (-510.128) (-510.356) (-514.007) -- 0:00:37
382500 -- (-510.728) [-512.326] (-508.345) (-510.138) * (-510.076) (-511.181) [-511.204] (-515.919) -- 0:00:37
383000 -- (-508.422) (-510.750) (-509.199) [-509.243] * (-509.206) (-511.988) [-509.066] (-513.115) -- 0:00:38
383500 -- (-513.441) [-510.729] (-509.965) (-513.260) * (-510.734) (-510.516) (-510.147) [-508.581] -- 0:00:38
384000 -- (-509.370) (-508.792) (-510.284) [-510.860] * (-511.971) (-510.511) [-510.009] (-511.303) -- 0:00:38
384500 -- (-509.022) (-509.390) [-511.750] (-517.462) * (-514.827) [-510.051] (-510.300) (-512.005) -- 0:00:38
385000 -- (-509.241) [-509.538] (-509.496) (-508.690) * (-511.520) [-511.533] (-515.496) (-510.147) -- 0:00:38
Average standard deviation of split frequencies: 0.008477
385500 -- (-511.462) (-514.136) [-511.228] (-510.769) * (-511.696) (-510.415) (-510.249) [-508.803] -- 0:00:38
386000 -- (-508.501) (-514.042) (-509.952) [-511.044] * (-510.415) [-508.571] (-509.342) (-510.749) -- 0:00:38
386500 -- (-509.637) (-514.132) [-510.302] (-509.694) * [-511.507] (-510.638) (-509.638) (-511.389) -- 0:00:38
387000 -- (-509.865) (-511.139) [-512.013] (-510.626) * (-509.868) [-509.964] (-511.434) (-508.327) -- 0:00:38
387500 -- (-511.510) (-508.977) (-511.206) [-510.015] * (-509.541) (-511.595) (-511.280) [-509.033] -- 0:00:37
388000 -- (-515.724) [-509.111] (-512.155) (-510.089) * (-510.100) [-509.525] (-509.983) (-511.708) -- 0:00:37
388500 -- [-510.815] (-511.831) (-509.464) (-511.069) * [-516.964] (-511.136) (-512.458) (-511.438) -- 0:00:37
389000 -- [-509.034] (-509.547) (-509.785) (-511.032) * (-511.921) [-512.542] (-511.491) (-510.521) -- 0:00:37
389500 -- (-509.108) [-514.128] (-512.303) (-508.764) * (-515.142) (-513.678) (-511.060) [-509.967] -- 0:00:37
390000 -- (-510.160) [-511.938] (-512.454) (-512.842) * (-510.399) [-511.644] (-513.542) (-508.882) -- 0:00:37
Average standard deviation of split frequencies: 0.008205
390500 -- (-509.160) [-509.707] (-511.003) (-511.432) * [-509.359] (-512.608) (-512.939) (-511.254) -- 0:00:37
391000 -- (-510.516) [-512.339] (-510.177) (-513.278) * (-508.784) (-511.940) [-513.506] (-512.579) -- 0:00:37
391500 -- (-511.778) (-510.340) [-510.140] (-512.272) * (-512.841) [-515.244] (-517.569) (-510.765) -- 0:00:37
392000 -- (-510.566) [-508.642] (-513.475) (-510.222) * [-510.198] (-512.517) (-515.611) (-512.512) -- 0:00:37
392500 -- (-513.488) (-511.634) [-509.054] (-515.726) * (-511.529) (-510.366) (-510.472) [-512.707] -- 0:00:37
393000 -- (-512.138) (-509.385) [-509.711] (-508.500) * [-508.708] (-511.804) (-510.397) (-510.107) -- 0:00:37
393500 -- (-510.369) (-516.619) (-508.902) [-509.585] * (-510.766) (-511.644) (-509.424) [-508.808] -- 0:00:36
394000 -- (-509.499) (-513.194) (-513.938) [-508.744] * (-513.319) (-511.652) [-508.408] (-512.305) -- 0:00:36
394500 -- (-509.901) (-511.258) [-509.916] (-510.959) * (-510.570) (-510.106) (-508.883) [-509.417] -- 0:00:36
395000 -- (-510.743) (-509.396) [-510.594] (-511.942) * (-511.171) [-508.252] (-513.403) (-510.133) -- 0:00:36
Average standard deviation of split frequencies: 0.008556
395500 -- (-510.597) [-509.500] (-513.075) (-509.036) * [-509.601] (-511.981) (-511.929) (-509.535) -- 0:00:36
396000 -- [-513.261] (-509.011) (-513.340) (-508.720) * (-509.571) (-511.307) [-509.686] (-509.237) -- 0:00:36
396500 -- (-510.464) (-510.980) (-514.500) [-508.797] * [-508.590] (-512.993) (-511.015) (-509.690) -- 0:00:36
397000 -- (-514.402) [-509.412] (-509.518) (-511.147) * (-508.900) (-512.310) [-509.156] (-509.919) -- 0:00:36
397500 -- (-508.997) (-508.995) (-509.109) [-508.587] * (-511.030) (-512.100) (-511.807) [-512.112] -- 0:00:36
398000 -- (-510.913) [-510.191] (-512.880) (-511.638) * (-511.392) (-509.654) (-511.324) [-510.630] -- 0:00:36
398500 -- (-510.329) (-509.261) [-511.735] (-510.259) * [-513.328] (-508.250) (-510.299) (-513.254) -- 0:00:36
399000 -- (-509.852) [-509.499] (-510.809) (-510.768) * (-512.864) [-511.468] (-509.927) (-508.847) -- 0:00:36
399500 -- [-509.669] (-511.860) (-511.312) (-510.076) * [-508.238] (-510.645) (-511.432) (-509.108) -- 0:00:37
400000 -- (-510.010) (-510.437) (-514.777) [-509.839] * (-513.907) [-509.734] (-510.364) (-508.329) -- 0:00:37
Average standard deviation of split frequencies: 0.008393
400500 -- [-510.775] (-508.665) (-511.564) (-508.205) * (-511.062) (-510.292) (-510.694) [-508.619] -- 0:00:37
401000 -- (-509.613) (-509.048) (-510.188) [-509.378] * (-510.303) (-510.933) [-509.594] (-510.569) -- 0:00:37
401500 -- (-509.098) [-512.330] (-511.801) (-511.374) * [-509.070] (-508.932) (-508.551) (-510.767) -- 0:00:37
402000 -- (-511.783) [-510.687] (-512.479) (-511.350) * [-509.158] (-511.286) (-508.650) (-514.683) -- 0:00:37
402500 -- (-510.528) [-512.044] (-513.737) (-509.560) * (-509.642) [-512.576] (-509.772) (-509.146) -- 0:00:37
403000 -- (-508.939) [-508.315] (-511.514) (-513.395) * (-512.100) [-508.728] (-509.660) (-511.647) -- 0:00:37
403500 -- [-509.396] (-513.357) (-509.940) (-510.694) * (-512.207) [-512.089] (-509.005) (-509.411) -- 0:00:36
404000 -- (-509.107) (-511.327) [-509.417] (-511.618) * (-511.390) (-510.419) [-510.579] (-509.610) -- 0:00:36
404500 -- (-512.706) (-509.065) [-509.706] (-509.711) * (-508.541) (-514.000) (-509.546) [-509.534] -- 0:00:36
405000 -- (-512.117) (-510.002) [-508.647] (-508.563) * (-508.175) [-511.211] (-513.941) (-513.365) -- 0:00:36
Average standard deviation of split frequencies: 0.008273
405500 -- (-511.695) [-514.037] (-511.618) (-509.860) * (-508.604) (-509.448) [-511.199] (-510.309) -- 0:00:36
406000 -- (-512.840) (-509.915) (-516.155) [-508.826] * (-515.513) (-511.007) (-508.725) [-510.344] -- 0:00:36
406500 -- (-508.439) (-511.164) (-512.968) [-509.935] * (-509.758) (-513.025) [-508.818] (-512.841) -- 0:00:36
407000 -- (-511.006) (-512.240) [-510.706] (-511.960) * [-509.248] (-512.939) (-509.469) (-513.070) -- 0:00:36
407500 -- (-509.578) [-512.525] (-510.704) (-510.360) * (-510.064) [-509.534] (-510.629) (-511.011) -- 0:00:36
408000 -- [-511.344] (-510.301) (-512.517) (-510.147) * [-510.935] (-509.913) (-511.944) (-511.623) -- 0:00:36
408500 -- (-510.299) [-510.645] (-508.266) (-513.680) * (-512.725) (-509.070) [-511.793] (-512.516) -- 0:00:36
409000 -- (-509.893) [-509.999] (-514.019) (-509.296) * (-509.958) (-508.450) [-508.448] (-512.652) -- 0:00:36
409500 -- [-510.545] (-509.700) (-514.558) (-511.167) * [-509.656] (-509.214) (-508.362) (-513.421) -- 0:00:36
410000 -- (-509.424) (-509.648) (-509.944) [-511.392] * [-508.599] (-511.551) (-510.115) (-513.134) -- 0:00:35
Average standard deviation of split frequencies: 0.007653
410500 -- (-509.612) (-510.337) (-510.087) [-509.170] * [-508.822] (-509.921) (-510.579) (-511.899) -- 0:00:35
411000 -- (-508.402) (-512.357) [-508.920] (-514.708) * (-508.023) [-510.160] (-509.159) (-516.274) -- 0:00:35
411500 -- (-508.949) (-511.669) (-511.924) [-509.811] * (-512.897) (-509.374) [-509.156] (-511.491) -- 0:00:35
412000 -- (-508.875) (-508.412) [-509.860] (-509.390) * [-509.130] (-509.427) (-514.418) (-512.314) -- 0:00:35
412500 -- [-508.653] (-508.496) (-512.937) (-509.401) * (-509.182) (-511.329) (-511.949) [-512.236] -- 0:00:35
413000 -- (-509.153) (-510.145) (-510.745) [-510.665] * (-508.720) (-509.932) (-512.320) [-508.874] -- 0:00:35
413500 -- (-508.846) (-509.454) (-508.920) [-510.844] * (-514.309) (-509.169) (-512.314) [-509.152] -- 0:00:35
414000 -- (-509.723) [-510.275] (-509.259) (-510.861) * (-510.653) (-513.374) [-514.395] (-508.615) -- 0:00:35
414500 -- (-510.645) [-509.213] (-510.276) (-511.498) * (-509.053) [-516.034] (-510.222) (-509.448) -- 0:00:35
415000 -- (-509.623) (-509.701) [-509.604] (-511.496) * [-508.618] (-508.387) (-509.935) (-509.257) -- 0:00:35
Average standard deviation of split frequencies: 0.008074
415500 -- [-509.038] (-512.527) (-509.512) (-509.997) * [-508.930] (-509.695) (-509.060) (-509.800) -- 0:00:35
416000 -- (-508.870) (-510.621) [-511.207] (-511.763) * [-510.911] (-508.614) (-508.793) (-513.974) -- 0:00:36
416500 -- (-509.563) (-509.790) [-509.556] (-513.593) * (-509.547) (-508.229) (-509.345) [-510.582] -- 0:00:36
417000 -- (-509.434) (-510.530) [-512.411] (-512.542) * (-510.713) (-509.058) [-510.909] (-511.044) -- 0:00:36
417500 -- (-511.157) (-508.950) (-511.629) [-509.346] * [-508.848] (-508.705) (-511.303) (-512.427) -- 0:00:36
418000 -- (-509.148) (-510.427) (-509.831) [-509.436] * [-509.047] (-511.818) (-511.638) (-509.180) -- 0:00:36
418500 -- (-508.715) (-511.525) [-508.700] (-510.707) * (-510.421) (-512.030) [-509.355] (-509.698) -- 0:00:36
419000 -- (-510.002) (-513.046) [-509.813] (-509.690) * (-510.039) (-510.616) (-509.766) [-508.875] -- 0:00:36
419500 -- (-513.038) [-510.694] (-513.517) (-510.039) * [-509.234] (-510.125) (-511.661) (-510.406) -- 0:00:35
420000 -- (-513.449) (-510.394) [-511.384] (-509.515) * (-509.205) [-510.746] (-510.040) (-513.335) -- 0:00:35
Average standard deviation of split frequencies: 0.007144
420500 -- (-508.601) (-509.304) (-510.593) [-510.510] * (-508.251) [-510.455] (-509.232) (-508.899) -- 0:00:35
421000 -- [-513.825] (-508.682) (-510.086) (-511.592) * (-513.754) (-509.783) [-508.962] (-509.371) -- 0:00:35
421500 -- (-510.002) (-508.912) (-509.527) [-512.642] * (-509.541) [-509.417] (-510.473) (-511.484) -- 0:00:35
422000 -- (-509.815) (-510.637) [-510.556] (-511.040) * (-515.134) (-511.042) (-511.821) [-510.160] -- 0:00:35
422500 -- (-509.662) (-510.340) (-509.407) [-510.033] * (-515.210) [-511.161] (-509.960) (-510.665) -- 0:00:35
423000 -- [-512.257] (-514.408) (-513.456) (-508.469) * [-511.709] (-515.074) (-509.193) (-509.215) -- 0:00:35
423500 -- [-508.673] (-508.513) (-511.095) (-513.162) * [-509.373] (-516.208) (-508.739) (-509.737) -- 0:00:35
424000 -- [-510.178] (-512.496) (-513.592) (-517.731) * (-509.733) [-511.690] (-509.616) (-511.931) -- 0:00:35
424500 -- [-509.829] (-514.288) (-514.499) (-510.319) * (-509.913) [-510.518] (-517.532) (-509.314) -- 0:00:35
425000 -- (-511.236) (-510.558) (-511.173) [-511.259] * (-514.361) (-508.557) (-510.938) [-508.503] -- 0:00:35
Average standard deviation of split frequencies: 0.006847
425500 -- (-509.874) (-513.281) [-510.007] (-509.095) * (-509.179) (-512.218) [-509.324] (-508.747) -- 0:00:35
426000 -- (-510.436) (-509.989) (-511.687) [-511.167] * (-513.410) (-512.683) [-509.307] (-509.658) -- 0:00:35
426500 -- [-509.135] (-510.730) (-512.110) (-509.030) * [-510.356] (-511.842) (-509.066) (-510.198) -- 0:00:34
427000 -- (-512.864) (-508.594) (-509.136) [-510.134] * (-513.632) (-509.913) [-510.005] (-509.723) -- 0:00:34
427500 -- [-510.422] (-508.977) (-515.529) (-512.547) * (-509.467) (-512.100) [-512.444] (-512.276) -- 0:00:34
428000 -- (-509.605) (-509.889) [-509.981] (-510.638) * (-509.724) (-509.498) (-509.926) [-512.496] -- 0:00:34
428500 -- (-511.174) (-509.833) [-509.065] (-508.850) * (-509.723) (-512.174) [-509.579] (-508.671) -- 0:00:34
429000 -- (-510.734) (-511.451) (-509.385) [-514.066] * (-512.033) (-511.331) (-508.826) [-508.585] -- 0:00:34
429500 -- (-509.678) (-513.754) (-511.795) [-509.903] * [-512.254] (-512.125) (-509.546) (-511.901) -- 0:00:34
430000 -- (-508.701) (-510.774) (-511.523) [-512.683] * (-514.831) [-510.486] (-514.083) (-510.377) -- 0:00:34
Average standard deviation of split frequencies: 0.006910
430500 -- (-509.112) [-509.201] (-511.312) (-510.835) * (-510.481) (-509.279) (-511.122) [-512.764] -- 0:00:34
431000 -- [-511.476] (-510.644) (-509.592) (-509.194) * [-509.610] (-511.362) (-510.442) (-516.417) -- 0:00:34
431500 -- (-515.774) (-508.606) [-512.186] (-516.423) * (-509.016) [-510.627] (-510.079) (-510.733) -- 0:00:35
432000 -- (-512.305) (-511.401) [-512.270] (-512.559) * (-509.254) [-512.675] (-509.499) (-510.463) -- 0:00:35
432500 -- [-509.247] (-509.017) (-509.975) (-509.391) * [-511.565] (-511.994) (-510.607) (-509.978) -- 0:00:35
433000 -- (-509.175) (-509.692) (-510.901) [-511.417] * (-516.831) (-513.729) (-515.691) [-510.485] -- 0:00:35
433500 -- (-509.189) [-511.354] (-510.063) (-512.654) * (-511.998) (-510.295) (-511.630) [-509.262] -- 0:00:35
434000 -- (-512.825) (-509.817) [-512.458] (-510.989) * (-509.795) (-510.310) [-510.319] (-510.329) -- 0:00:35
434500 -- [-515.959] (-511.623) (-510.364) (-511.570) * (-513.266) (-511.733) (-508.488) [-508.823] -- 0:00:35
435000 -- [-509.062] (-510.596) (-511.332) (-511.066) * (-509.243) (-509.479) (-510.829) [-508.620] -- 0:00:35
Average standard deviation of split frequencies: 0.007433
435500 -- (-508.959) (-514.407) [-508.746] (-509.465) * [-509.590] (-508.598) (-509.845) (-508.687) -- 0:00:34
436000 -- [-510.092] (-510.834) (-513.685) (-509.339) * (-511.567) (-511.992) [-512.759] (-509.551) -- 0:00:34
436500 -- (-514.127) (-510.244) (-509.939) [-515.496] * (-510.608) (-511.931) [-509.941] (-509.325) -- 0:00:34
437000 -- [-509.430] (-512.772) (-508.913) (-510.069) * (-510.694) (-510.907) (-510.385) [-511.781] -- 0:00:34
437500 -- (-509.335) (-514.319) (-510.222) [-510.262] * (-510.815) [-510.194] (-512.415) (-508.483) -- 0:00:34
438000 -- (-508.727) [-512.725] (-509.519) (-510.485) * (-510.348) (-510.371) (-508.861) [-509.197] -- 0:00:34
438500 -- [-512.067] (-511.506) (-511.121) (-510.002) * (-510.224) [-510.158] (-509.303) (-510.314) -- 0:00:34
439000 -- (-511.128) (-511.287) [-513.438] (-508.745) * (-510.582) [-508.731] (-510.972) (-514.346) -- 0:00:34
439500 -- [-512.979] (-510.618) (-508.584) (-510.826) * (-509.810) (-511.771) [-513.072] (-509.907) -- 0:00:34
440000 -- (-515.055) (-510.251) (-512.172) [-509.367] * (-511.654) (-511.208) (-510.038) [-511.787] -- 0:00:34
Average standard deviation of split frequencies: 0.007823
440500 -- (-511.617) [-511.260] (-509.839) (-509.443) * (-509.906) (-511.341) [-510.600] (-513.764) -- 0:00:34
441000 -- [-511.536] (-515.409) (-516.678) (-508.699) * (-509.909) (-511.322) [-508.500] (-511.722) -- 0:00:34
441500 -- (-509.585) [-508.467] (-511.258) (-513.690) * (-511.686) (-509.276) [-508.195] (-513.804) -- 0:00:34
442000 -- [-509.513] (-508.495) (-512.144) (-510.148) * (-512.369) (-513.815) [-509.376] (-510.914) -- 0:00:34
442500 -- (-516.183) (-510.935) (-509.519) [-510.993] * (-508.367) (-509.068) [-509.727] (-511.689) -- 0:00:34
443000 -- (-509.844) [-511.232] (-509.405) (-510.687) * (-511.083) (-508.928) (-510.134) [-509.639] -- 0:00:33
443500 -- (-510.517) [-509.234] (-511.963) (-510.876) * (-509.752) (-510.150) [-511.071] (-510.961) -- 0:00:33
444000 -- [-508.951] (-508.211) (-508.516) (-512.391) * [-510.179] (-511.354) (-509.464) (-508.444) -- 0:00:33
444500 -- (-509.474) (-522.164) (-509.692) [-508.360] * (-511.594) (-512.048) (-511.792) [-510.575] -- 0:00:33
445000 -- [-511.140] (-511.707) (-513.048) (-514.761) * [-510.764] (-509.138) (-521.559) (-510.266) -- 0:00:33
Average standard deviation of split frequencies: 0.009513
445500 -- (-509.638) [-511.096] (-509.461) (-512.457) * (-511.308) (-510.140) (-517.580) [-510.497] -- 0:00:33
446000 -- (-508.979) (-511.093) [-509.608] (-509.159) * [-509.625] (-512.837) (-514.787) (-508.325) -- 0:00:33
446500 -- [-509.603] (-510.671) (-511.603) (-508.757) * (-508.166) (-511.631) (-514.976) [-510.895] -- 0:00:34
447000 -- (-509.284) (-508.885) (-508.514) [-511.440] * (-510.270) [-509.082] (-511.212) (-509.316) -- 0:00:34
447500 -- (-509.478) (-508.841) (-509.050) [-508.586] * [-511.725] (-513.577) (-510.154) (-510.460) -- 0:00:34
448000 -- (-509.554) (-509.079) (-512.286) [-509.479] * (-510.992) (-510.286) (-509.413) [-510.147] -- 0:00:34
448500 -- [-509.040] (-509.494) (-510.387) (-509.167) * (-509.511) (-511.331) (-509.531) [-508.418] -- 0:00:34
449000 -- [-509.908] (-510.337) (-512.005) (-511.897) * [-509.847] (-513.046) (-510.034) (-510.879) -- 0:00:34
449500 -- (-508.926) (-511.081) [-509.960] (-511.222) * (-509.957) (-508.631) [-509.780] (-509.762) -- 0:00:34
450000 -- (-510.029) (-510.653) [-508.994] (-513.801) * (-509.287) (-509.592) [-510.021] (-511.173) -- 0:00:34
Average standard deviation of split frequencies: 0.009022
450500 -- (-517.346) [-511.755] (-510.032) (-510.625) * (-508.569) (-511.349) [-511.683] (-510.426) -- 0:00:34
451000 -- (-510.597) [-509.257] (-511.382) (-508.978) * [-508.409] (-515.033) (-513.191) (-512.112) -- 0:00:34
451500 -- (-517.058) [-509.495] (-510.989) (-510.487) * (-513.609) (-511.253) (-509.274) [-508.629] -- 0:00:34
452000 -- [-510.497] (-509.904) (-510.977) (-513.939) * (-511.630) (-510.904) (-510.216) [-508.687] -- 0:00:33
452500 -- [-508.799] (-513.834) (-509.873) (-513.497) * [-509.957] (-509.805) (-509.711) (-508.826) -- 0:00:33
453000 -- (-510.961) (-510.962) [-511.045] (-509.306) * (-512.620) (-508.919) [-511.249] (-509.170) -- 0:00:33
453500 -- [-508.906] (-510.984) (-508.309) (-511.274) * (-512.018) (-510.218) [-512.554] (-509.091) -- 0:00:33
454000 -- (-510.708) (-511.004) [-512.636] (-512.077) * (-511.947) (-508.398) (-511.410) [-510.392] -- 0:00:33
454500 -- [-511.427] (-509.933) (-510.939) (-508.898) * (-516.005) (-511.667) (-513.267) [-512.660] -- 0:00:33
455000 -- (-510.289) (-510.277) (-511.920) [-510.253] * (-513.631) (-509.864) (-510.209) [-509.113] -- 0:00:33
Average standard deviation of split frequencies: 0.008593
455500 -- (-511.300) (-510.681) (-511.346) [-510.693] * (-510.508) (-509.851) (-511.896) [-513.671] -- 0:00:33
456000 -- (-510.926) (-510.020) [-511.968] (-512.043) * (-509.139) (-511.807) [-512.504] (-514.283) -- 0:00:33
456500 -- (-508.584) (-511.941) [-509.290] (-511.361) * (-512.233) (-510.160) [-508.411] (-512.186) -- 0:00:33
457000 -- (-510.598) (-510.385) (-511.690) [-508.346] * (-511.840) (-518.474) (-509.412) [-511.957] -- 0:00:33
457500 -- (-510.380) [-510.902] (-514.862) (-514.459) * (-510.525) (-513.853) [-511.486] (-517.050) -- 0:00:33
458000 -- [-509.849] (-509.555) (-514.960) (-511.471) * (-510.104) (-511.170) (-510.969) [-509.863] -- 0:00:33
458500 -- (-511.709) [-510.683] (-512.664) (-512.692) * (-511.191) (-509.402) (-510.989) [-509.915] -- 0:00:33
459000 -- (-510.372) [-509.103] (-509.450) (-514.822) * (-515.433) (-512.356) [-511.526] (-509.120) -- 0:00:33
459500 -- (-514.335) [-514.592] (-510.929) (-509.555) * (-514.621) (-515.336) [-510.891] (-514.073) -- 0:00:32
460000 -- (-509.428) (-513.724) [-509.504] (-510.324) * (-512.475) (-513.400) [-512.502] (-509.418) -- 0:00:32
Average standard deviation of split frequencies: 0.008378
460500 -- (-509.271) [-512.121] (-510.046) (-510.094) * (-509.912) [-509.144] (-509.645) (-508.457) -- 0:00:32
461000 -- (-508.742) (-511.018) [-510.138] (-509.801) * [-513.276] (-513.011) (-509.456) (-509.209) -- 0:00:32
461500 -- (-509.579) [-511.598] (-511.226) (-510.810) * (-513.610) [-511.474] (-515.137) (-515.061) -- 0:00:32
462000 -- [-510.682] (-510.511) (-510.460) (-510.080) * (-511.303) [-511.060] (-512.633) (-511.555) -- 0:00:32
462500 -- (-510.404) (-513.061) [-511.048] (-511.698) * (-509.319) [-511.727] (-511.747) (-513.187) -- 0:00:32
463000 -- (-516.150) [-511.255] (-513.462) (-509.684) * [-510.175] (-513.279) (-513.653) (-512.957) -- 0:00:33
463500 -- [-511.496] (-515.335) (-510.900) (-508.275) * [-510.347] (-510.137) (-515.032) (-514.810) -- 0:00:33
464000 -- (-509.905) [-514.073] (-508.809) (-509.667) * (-510.529) (-508.674) [-511.270] (-510.126) -- 0:00:33
464500 -- (-508.880) [-510.437] (-508.852) (-511.808) * [-513.384] (-508.738) (-510.220) (-509.779) -- 0:00:33
465000 -- (-509.093) (-510.808) [-508.750] (-510.737) * (-515.012) (-508.652) [-508.958] (-509.875) -- 0:00:33
Average standard deviation of split frequencies: 0.008093
465500 -- [-509.230] (-514.135) (-508.906) (-509.484) * (-513.778) [-509.949] (-514.234) (-511.557) -- 0:00:33
466000 -- [-509.545] (-511.823) (-510.811) (-510.164) * (-509.535) [-510.026] (-512.715) (-517.153) -- 0:00:33
466500 -- [-508.988] (-515.613) (-510.616) (-508.357) * (-508.814) [-511.476] (-513.061) (-510.713) -- 0:00:33
467000 -- [-509.636] (-517.877) (-509.426) (-511.061) * (-511.127) (-511.313) (-510.741) [-511.840] -- 0:00:33
467500 -- (-509.765) (-510.361) (-509.115) [-511.151] * (-513.495) [-509.511] (-510.305) (-513.400) -- 0:00:33
468000 -- (-510.685) [-508.733] (-512.350) (-510.090) * (-515.078) (-509.921) (-510.247) [-509.626] -- 0:00:32
468500 -- (-512.276) [-509.348] (-512.445) (-510.120) * (-513.677) (-510.222) [-512.467] (-512.783) -- 0:00:32
469000 -- (-510.463) [-511.434] (-512.876) (-509.353) * (-512.338) [-508.530] (-510.815) (-510.025) -- 0:00:32
469500 -- (-509.825) [-510.122] (-513.878) (-511.795) * (-510.922) (-511.810) [-511.625] (-508.874) -- 0:00:32
470000 -- (-508.613) [-510.641] (-511.384) (-510.742) * (-511.834) (-510.435) [-510.671] (-514.603) -- 0:00:32
Average standard deviation of split frequencies: 0.007950
470500 -- (-511.097) (-508.814) (-510.209) [-508.373] * (-513.174) [-509.543] (-510.210) (-509.828) -- 0:00:32
471000 -- (-510.620) (-509.710) (-508.907) [-509.479] * (-512.427) [-510.133] (-509.795) (-512.966) -- 0:00:32
471500 -- [-510.128] (-508.992) (-511.600) (-509.550) * [-508.438] (-512.709) (-511.724) (-510.378) -- 0:00:32
472000 -- (-516.900) [-508.620] (-513.164) (-510.006) * (-511.100) [-510.384] (-510.489) (-510.717) -- 0:00:32
472500 -- [-511.467] (-509.263) (-512.379) (-509.911) * (-510.013) (-508.266) (-510.763) [-509.081] -- 0:00:32
473000 -- (-511.313) (-512.962) [-509.543] (-511.651) * (-510.790) [-508.740] (-511.902) (-509.161) -- 0:00:32
473500 -- (-514.323) [-512.407] (-509.951) (-516.600) * [-509.044] (-508.971) (-511.444) (-509.155) -- 0:00:32
474000 -- (-513.698) (-510.624) [-509.516] (-512.192) * [-509.692] (-511.170) (-517.024) (-510.254) -- 0:00:32
474500 -- (-512.116) (-510.678) (-508.135) [-509.652] * (-511.906) (-510.312) (-508.368) [-510.327] -- 0:00:32
475000 -- [-509.374] (-512.242) (-508.556) (-509.013) * (-509.947) (-513.177) (-509.626) [-509.110] -- 0:00:32
Average standard deviation of split frequencies: 0.007489
475500 -- (-509.501) (-514.303) (-508.888) [-509.828] * (-509.120) (-511.043) (-516.014) [-510.462] -- 0:00:31
476000 -- (-511.003) (-510.674) [-509.525] (-510.488) * [-512.947] (-510.267) (-511.546) (-512.681) -- 0:00:31
476500 -- [-508.714] (-510.860) (-510.144) (-510.749) * (-510.444) (-508.335) (-511.716) [-512.041] -- 0:00:31
477000 -- [-510.286] (-516.836) (-510.591) (-510.458) * [-509.441] (-510.604) (-510.944) (-513.461) -- 0:00:31
477500 -- (-510.226) (-513.652) (-510.820) [-509.444] * (-508.573) (-511.144) (-509.936) [-509.921] -- 0:00:31
478000 -- (-513.167) (-510.413) (-513.338) [-511.424] * (-511.460) (-509.278) (-510.763) [-512.751] -- 0:00:31
478500 -- (-509.568) (-510.237) [-509.811] (-510.185) * (-513.983) (-516.824) [-509.748] (-512.339) -- 0:00:31
479000 -- (-513.276) [-512.105] (-509.180) (-509.176) * (-512.841) [-509.504] (-511.109) (-510.781) -- 0:00:31
479500 -- (-509.346) [-509.727] (-509.475) (-508.579) * [-508.997] (-509.205) (-509.973) (-512.759) -- 0:00:32
480000 -- (-510.224) (-512.271) [-511.814] (-508.296) * (-511.812) [-509.324] (-509.475) (-508.683) -- 0:00:32
Average standard deviation of split frequencies: 0.007662
480500 -- (-509.754) (-514.746) [-511.362] (-508.465) * (-511.987) (-518.959) (-509.357) [-508.539] -- 0:00:32
481000 -- (-510.300) (-511.429) (-510.741) [-510.962] * [-508.966] (-509.267) (-512.013) (-510.612) -- 0:00:32
481500 -- (-512.542) (-508.657) (-510.382) [-512.582] * [-510.703] (-509.391) (-516.368) (-510.301) -- 0:00:32
482000 -- [-509.921] (-510.031) (-510.987) (-509.399) * (-509.826) (-512.118) (-510.106) [-512.275] -- 0:00:32
482500 -- [-509.631] (-508.328) (-512.176) (-511.969) * [-509.829] (-509.846) (-510.218) (-510.317) -- 0:00:32
483000 -- (-508.726) [-509.459] (-513.109) (-512.504) * (-512.836) [-513.511] (-512.766) (-510.399) -- 0:00:32
483500 -- (-508.862) (-508.682) [-509.369] (-512.581) * (-511.773) (-512.272) (-514.763) [-510.772] -- 0:00:32
484000 -- (-508.751) (-509.052) (-509.649) [-510.120] * (-509.587) (-512.513) [-512.629] (-511.439) -- 0:00:31
484500 -- (-512.816) (-511.560) [-508.752] (-511.906) * (-508.220) [-511.607] (-509.026) (-509.973) -- 0:00:31
485000 -- (-512.194) (-508.537) [-508.274] (-512.027) * (-511.714) (-513.866) [-509.688] (-510.610) -- 0:00:31
Average standard deviation of split frequencies: 0.007638
485500 -- (-514.476) (-508.751) (-508.544) [-513.614] * [-510.170] (-511.029) (-509.905) (-510.782) -- 0:00:31
486000 -- (-510.599) (-510.090) (-508.931) [-509.691] * [-510.963] (-514.114) (-508.441) (-513.632) -- 0:00:31
486500 -- [-510.094] (-512.000) (-510.046) (-512.747) * (-509.165) (-510.457) [-513.312] (-512.737) -- 0:00:31
487000 -- (-508.872) (-512.567) (-509.927) [-509.576] * (-509.375) (-512.723) [-509.843] (-509.780) -- 0:00:31
487500 -- (-508.519) (-515.199) [-511.047] (-511.708) * [-510.889] (-510.749) (-512.028) (-508.496) -- 0:00:31
488000 -- (-510.088) (-512.584) [-510.971] (-509.271) * (-509.499) [-510.759] (-510.007) (-510.205) -- 0:00:31
488500 -- (-508.870) [-511.696] (-509.238) (-510.187) * (-510.189) (-511.641) [-509.351] (-510.459) -- 0:00:31
489000 -- [-512.243] (-510.275) (-509.222) (-509.941) * [-511.209] (-508.579) (-510.649) (-511.255) -- 0:00:31
489500 -- (-514.563) (-510.742) (-509.144) [-509.019] * (-513.005) (-508.835) [-509.127] (-511.195) -- 0:00:31
490000 -- (-511.742) (-510.367) [-509.222] (-509.409) * (-509.251) (-513.892) (-508.927) [-510.739] -- 0:00:31
Average standard deviation of split frequencies: 0.007506
490500 -- (-516.856) (-517.441) (-511.547) [-508.814] * (-510.068) (-510.081) [-510.560] (-509.442) -- 0:00:31
491000 -- (-509.513) [-510.394] (-509.520) (-509.171) * (-509.624) [-515.423] (-512.536) (-512.227) -- 0:00:31
491500 -- [-512.953] (-509.733) (-511.409) (-509.107) * (-509.605) [-509.184] (-508.303) (-509.084) -- 0:00:31
492000 -- [-509.660] (-511.259) (-509.750) (-509.988) * [-510.287] (-510.168) (-509.798) (-510.488) -- 0:00:30
492500 -- (-513.910) (-517.417) (-509.061) [-508.758] * (-510.533) (-514.309) (-512.841) [-511.804] -- 0:00:30
493000 -- (-508.221) (-513.210) (-510.441) [-509.189] * [-509.463] (-510.956) (-510.296) (-508.989) -- 0:00:30
493500 -- (-510.797) [-511.816] (-511.159) (-511.118) * (-510.211) [-513.073] (-511.222) (-512.932) -- 0:00:30
494000 -- (-513.410) [-512.900] (-510.464) (-512.812) * (-509.015) (-509.088) (-511.272) [-509.104] -- 0:00:30
494500 -- (-511.307) (-509.888) (-511.091) [-510.750] * [-510.773] (-510.288) (-516.030) (-508.608) -- 0:00:30
495000 -- (-509.173) [-510.468] (-509.493) (-509.850) * [-513.492] (-513.769) (-511.182) (-511.655) -- 0:00:30
Average standard deviation of split frequencies: 0.007544
495500 -- [-513.832] (-514.972) (-508.408) (-511.397) * (-510.914) [-508.515] (-512.185) (-514.696) -- 0:00:30
496000 -- (-515.417) (-509.234) [-509.816] (-511.640) * (-509.578) [-511.387] (-510.879) (-510.970) -- 0:00:31
496500 -- (-511.260) [-508.726] (-512.020) (-512.520) * (-510.831) (-510.669) [-510.323] (-512.051) -- 0:00:31
497000 -- [-509.733] (-508.816) (-510.371) (-511.640) * (-509.951) [-512.414] (-510.108) (-511.141) -- 0:00:31
497500 -- (-511.764) (-515.502) (-509.587) [-512.182] * (-509.376) (-510.513) [-510.537] (-508.438) -- 0:00:31
498000 -- (-508.954) (-511.184) (-510.461) [-509.727] * [-511.160] (-509.625) (-509.183) (-511.539) -- 0:00:31
498500 -- (-508.929) (-511.509) [-515.272] (-509.686) * [-510.250] (-511.248) (-509.483) (-510.338) -- 0:00:31
499000 -- [-510.624] (-513.863) (-511.017) (-508.092) * [-511.452] (-512.183) (-510.401) (-510.941) -- 0:00:31
499500 -- (-510.817) [-512.245] (-514.482) (-508.548) * (-510.721) (-511.693) (-508.642) [-508.991] -- 0:00:31
500000 -- [-514.067] (-513.224) (-510.114) (-508.534) * [-510.540] (-512.136) (-509.527) (-508.982) -- 0:00:31
Average standard deviation of split frequencies: 0.008003
500500 -- (-508.830) (-513.789) [-509.859] (-511.001) * [-509.995] (-511.669) (-508.526) (-509.269) -- 0:00:30
501000 -- [-510.641] (-511.526) (-512.112) (-510.153) * (-508.316) (-513.431) [-509.638] (-511.199) -- 0:00:30
501500 -- (-510.279) (-511.127) [-509.911] (-509.869) * (-513.574) [-510.863] (-511.769) (-513.069) -- 0:00:30
502000 -- (-514.339) (-508.600) (-510.618) [-509.452] * (-511.513) (-512.275) [-509.802] (-510.229) -- 0:00:30
502500 -- (-508.735) (-510.492) [-509.521] (-512.696) * (-512.471) (-509.559) [-511.367] (-510.242) -- 0:00:30
503000 -- (-511.743) [-511.915] (-509.706) (-510.871) * [-510.390] (-509.965) (-510.192) (-508.275) -- 0:00:30
503500 -- (-510.245) [-508.573] (-510.370) (-508.727) * (-510.232) [-510.270] (-510.263) (-513.119) -- 0:00:30
504000 -- (-509.258) (-509.302) [-509.112] (-512.132) * (-510.884) [-510.963] (-509.849) (-510.041) -- 0:00:30
504500 -- (-509.512) (-512.905) (-509.170) [-510.384] * (-509.819) (-510.918) (-510.029) [-508.933] -- 0:00:30
505000 -- (-512.328) [-509.842] (-509.689) (-509.904) * (-511.971) [-509.235] (-510.111) (-511.956) -- 0:00:30
Average standard deviation of split frequencies: 0.007511
505500 -- (-509.792) (-508.768) (-514.452) [-511.776] * (-509.466) (-510.643) (-509.817) [-508.666] -- 0:00:30
506000 -- (-515.870) [-512.382] (-509.829) (-513.301) * [-508.343] (-510.873) (-511.871) (-510.411) -- 0:00:30
506500 -- (-513.002) (-513.479) (-509.594) [-513.264] * (-510.165) [-509.237] (-509.495) (-509.187) -- 0:00:30
507000 -- (-511.730) [-510.114] (-511.190) (-509.733) * [-511.052] (-509.656) (-509.942) (-510.785) -- 0:00:30
507500 -- (-509.521) (-514.840) (-509.636) [-508.892] * (-508.980) (-508.672) (-509.958) [-509.690] -- 0:00:30
508000 -- (-512.543) (-509.844) [-511.480] (-509.778) * (-513.547) (-508.666) [-512.130] (-514.250) -- 0:00:30
508500 -- (-510.818) [-508.613] (-510.190) (-512.372) * (-508.972) [-510.809] (-508.696) (-511.527) -- 0:00:29
509000 -- [-509.963] (-513.049) (-511.354) (-509.126) * (-508.943) (-508.588) (-510.997) [-512.748] -- 0:00:29
509500 -- (-513.440) (-511.228) [-510.546] (-508.414) * [-512.263] (-509.901) (-515.257) (-511.636) -- 0:00:29
510000 -- (-512.820) (-509.677) (-512.023) [-508.631] * (-512.516) (-509.556) [-511.170] (-509.882) -- 0:00:29
Average standard deviation of split frequencies: 0.007327
510500 -- (-508.907) (-508.689) [-509.489] (-510.572) * (-509.691) (-514.186) (-508.646) [-508.464] -- 0:00:29
511000 -- (-509.610) (-515.578) [-510.653] (-513.094) * [-510.594] (-513.542) (-510.197) (-516.935) -- 0:00:29
511500 -- (-510.890) (-509.651) [-510.449] (-510.478) * (-512.195) (-509.574) [-512.061] (-512.571) -- 0:00:29
512000 -- [-512.134] (-512.197) (-508.694) (-510.145) * [-510.657] (-508.627) (-508.455) (-510.129) -- 0:00:29
512500 -- [-513.928] (-511.232) (-510.507) (-509.524) * [-510.743] (-511.955) (-508.843) (-509.106) -- 0:00:30
513000 -- [-508.459] (-508.762) (-511.966) (-515.129) * (-511.377) [-508.921] (-510.245) (-510.091) -- 0:00:30
513500 -- (-509.378) [-508.976] (-510.057) (-509.901) * (-510.568) [-510.264] (-511.535) (-510.240) -- 0:00:30
514000 -- (-509.577) [-509.471] (-508.927) (-512.497) * (-512.630) (-512.294) [-509.398] (-510.482) -- 0:00:30
514500 -- (-508.536) (-513.102) [-511.212] (-508.754) * (-514.280) (-512.942) [-510.724] (-518.365) -- 0:00:30
515000 -- (-508.786) (-508.374) (-509.003) [-508.706] * (-516.088) [-509.577] (-510.035) (-509.972) -- 0:00:30
Average standard deviation of split frequencies: 0.007594
515500 -- [-508.857] (-510.476) (-512.312) (-509.736) * (-517.202) [-509.701] (-513.913) (-509.143) -- 0:00:30
516000 -- [-510.686] (-509.796) (-513.064) (-508.732) * (-513.280) (-509.112) (-511.660) [-510.749] -- 0:00:30
516500 -- (-508.925) [-511.744] (-509.822) (-509.896) * (-512.080) (-508.557) (-511.094) [-513.390] -- 0:00:29
517000 -- [-508.205] (-508.548) (-509.770) (-510.517) * (-510.058) (-510.179) [-509.100] (-510.262) -- 0:00:29
517500 -- (-509.547) (-508.406) (-513.205) [-509.302] * (-512.512) (-509.302) (-509.212) [-510.245] -- 0:00:29
518000 -- (-510.940) [-510.417] (-509.905) (-508.669) * (-509.613) (-511.113) [-510.683] (-511.435) -- 0:00:29
518500 -- [-509.649] (-510.554) (-512.957) (-517.740) * (-509.012) (-509.512) [-509.764] (-517.590) -- 0:00:29
519000 -- (-509.152) (-511.212) (-509.450) [-511.029] * [-509.086] (-511.905) (-510.252) (-508.590) -- 0:00:29
519500 -- (-511.116) (-514.490) (-508.579) [-513.911] * [-508.541] (-508.470) (-516.459) (-511.265) -- 0:00:29
520000 -- (-510.306) (-513.169) (-508.543) [-509.796] * (-508.692) (-508.450) [-509.582] (-508.925) -- 0:00:29
Average standard deviation of split frequencies: 0.007866
520500 -- [-510.270] (-511.832) (-510.147) (-510.713) * (-510.470) (-510.703) (-511.850) [-513.134] -- 0:00:29
521000 -- (-510.899) (-512.895) (-511.342) [-509.694] * [-514.675] (-510.364) (-510.628) (-509.294) -- 0:00:29
521500 -- (-510.420) (-510.943) (-509.662) [-510.545] * (-512.885) [-509.176] (-511.228) (-508.841) -- 0:00:29
522000 -- (-512.164) (-514.950) (-509.306) [-509.618] * [-513.701] (-516.181) (-510.643) (-510.160) -- 0:00:29
522500 -- (-509.444) [-512.770] (-509.369) (-511.732) * (-512.776) (-514.655) [-509.123] (-508.622) -- 0:00:29
523000 -- (-509.375) [-510.082] (-510.230) (-508.248) * (-514.656) (-510.403) (-513.918) [-510.312] -- 0:00:29
523500 -- (-511.834) (-509.802) [-509.301] (-508.539) * [-511.329] (-508.721) (-509.886) (-509.021) -- 0:00:29
524000 -- (-513.202) (-511.615) [-509.880] (-510.343) * (-510.205) (-509.153) [-510.742] (-512.914) -- 0:00:29
524500 -- (-512.812) (-510.475) [-512.780] (-510.240) * (-509.116) (-509.243) [-510.094] (-508.755) -- 0:00:29
525000 -- (-511.147) (-515.327) (-511.184) [-509.178] * (-508.972) (-509.321) [-509.590] (-508.741) -- 0:00:28
Average standard deviation of split frequencies: 0.007562
525500 -- (-511.415) (-510.483) (-510.507) [-509.471] * (-509.745) (-510.148) (-511.904) [-509.772] -- 0:00:28
526000 -- (-512.281) (-511.718) (-512.975) [-509.153] * (-516.050) (-516.137) (-508.899) [-512.715] -- 0:00:28
526500 -- [-510.167] (-509.466) (-508.529) (-509.733) * [-508.938] (-509.824) (-512.388) (-509.692) -- 0:00:28
527000 -- [-512.553] (-510.131) (-508.715) (-510.111) * (-514.381) (-510.730) [-509.772] (-509.652) -- 0:00:28
527500 -- [-509.674] (-509.696) (-511.798) (-510.990) * (-510.967) (-517.046) [-509.433] (-509.896) -- 0:00:28
528000 -- (-508.563) [-509.160] (-509.429) (-509.645) * (-511.281) (-509.065) [-508.965] (-508.842) -- 0:00:28
528500 -- (-512.523) (-514.422) (-510.681) [-509.080] * [-510.772] (-509.587) (-511.611) (-512.070) -- 0:00:28
529000 -- (-510.620) (-509.528) [-511.067] (-509.188) * [-513.011] (-512.757) (-510.669) (-511.049) -- 0:00:28
529500 -- (-509.666) (-514.348) (-510.889) [-509.772] * (-512.993) [-511.742] (-514.147) (-509.856) -- 0:00:29
530000 -- [-515.388] (-508.481) (-508.739) (-512.441) * (-512.872) (-511.359) [-510.486] (-509.750) -- 0:00:29
Average standard deviation of split frequencies: 0.008050
530500 -- (-509.809) [-508.486] (-509.119) (-513.359) * (-509.044) (-509.033) [-508.637] (-511.423) -- 0:00:29
531000 -- [-509.089] (-511.109) (-509.749) (-512.345) * (-512.170) [-511.981] (-511.929) (-511.152) -- 0:00:29
531500 -- (-510.532) [-509.151] (-509.892) (-509.209) * (-511.551) (-510.179) [-514.051] (-511.409) -- 0:00:29
532000 -- [-511.202] (-509.766) (-511.869) (-509.257) * [-512.794] (-516.177) (-515.538) (-508.775) -- 0:00:29
532500 -- (-516.854) (-510.215) (-512.055) [-509.308] * [-511.708] (-511.381) (-510.684) (-513.228) -- 0:00:28
533000 -- (-509.677) (-510.657) [-508.553] (-508.708) * [-508.928] (-511.475) (-509.596) (-509.805) -- 0:00:28
533500 -- (-509.303) (-509.635) (-508.577) [-509.425] * [-510.494] (-513.918) (-512.455) (-509.844) -- 0:00:28
534000 -- (-509.125) (-512.278) [-516.445] (-509.434) * (-508.497) (-514.227) [-510.871] (-511.514) -- 0:00:28
534500 -- [-510.441] (-510.237) (-511.137) (-509.915) * (-510.180) [-510.861] (-510.622) (-508.932) -- 0:00:28
535000 -- [-509.930] (-509.985) (-509.587) (-512.892) * (-515.541) [-512.014] (-509.162) (-509.544) -- 0:00:28
Average standard deviation of split frequencies: 0.008355
535500 -- (-508.280) [-511.785] (-510.620) (-510.069) * (-510.063) (-511.803) (-511.414) [-509.167] -- 0:00:28
536000 -- (-509.554) (-512.486) [-510.309] (-514.449) * (-509.817) (-512.784) [-513.850] (-511.518) -- 0:00:28
536500 -- [-510.600] (-509.336) (-509.750) (-516.363) * (-513.411) (-511.421) [-510.011] (-512.911) -- 0:00:28
537000 -- (-510.699) (-511.719) (-513.063) [-513.757] * (-509.522) [-516.660] (-510.566) (-508.793) -- 0:00:28
537500 -- (-511.610) [-510.511] (-513.064) (-508.763) * (-508.814) (-509.016) [-510.922] (-508.889) -- 0:00:28
538000 -- (-511.986) (-512.106) (-512.778) [-511.420] * (-511.166) (-510.561) (-509.375) [-508.369] -- 0:00:28
538500 -- (-510.948) (-513.241) [-511.231] (-510.085) * (-508.887) (-510.401) [-508.661] (-509.207) -- 0:00:28
539000 -- (-516.697) [-509.646] (-508.800) (-509.074) * (-512.256) (-509.287) (-509.030) [-510.020] -- 0:00:28
539500 -- (-510.770) [-510.562] (-511.893) (-508.774) * (-513.312) (-512.288) (-511.825) [-511.448] -- 0:00:28
540000 -- (-511.090) [-509.350] (-508.253) (-508.243) * (-511.443) (-509.867) (-510.047) [-511.725] -- 0:00:28
Average standard deviation of split frequencies: 0.007738
540500 -- (-513.739) [-511.362] (-508.391) (-508.538) * (-508.626) (-509.300) [-511.095] (-508.622) -- 0:00:28
541000 -- (-511.570) (-510.625) (-510.052) [-509.597] * (-511.567) (-509.933) [-511.338] (-512.277) -- 0:00:27
541500 -- (-512.791) (-509.718) (-508.629) [-509.217] * (-508.886) (-510.139) (-512.709) [-509.436] -- 0:00:27
542000 -- (-510.167) (-515.588) (-508.974) [-509.331] * (-511.273) (-514.019) (-511.006) [-511.356] -- 0:00:27
542500 -- (-510.318) (-509.717) [-509.454] (-511.894) * (-510.206) (-516.203) (-509.762) [-514.327] -- 0:00:27
543000 -- (-508.694) (-512.028) (-509.575) [-509.112] * (-510.932) (-515.784) [-508.880] (-511.019) -- 0:00:27
543500 -- (-510.047) (-509.737) (-508.468) [-509.786] * (-509.714) (-509.357) (-510.258) [-509.105] -- 0:00:27
544000 -- (-511.260) (-511.537) [-511.626] (-510.217) * (-511.264) (-510.620) [-512.630] (-508.951) -- 0:00:27
544500 -- (-509.603) (-509.130) [-508.604] (-510.754) * (-511.924) (-510.429) (-514.386) [-508.678] -- 0:00:27
545000 -- (-510.638) [-509.404] (-511.749) (-510.492) * [-513.114] (-515.527) (-514.022) (-511.126) -- 0:00:27
Average standard deviation of split frequencies: 0.007177
545500 -- (-511.065) [-509.947] (-512.978) (-508.761) * (-510.674) [-513.021] (-512.260) (-510.601) -- 0:00:27
546000 -- (-509.213) (-512.999) [-509.114] (-509.868) * (-514.159) [-511.431] (-510.244) (-509.389) -- 0:00:28
546500 -- (-511.488) (-509.851) [-509.398] (-511.075) * (-512.558) [-509.963] (-509.823) (-509.985) -- 0:00:28
547000 -- (-511.801) (-511.098) [-509.388] (-511.367) * (-510.092) (-508.830) [-510.245] (-511.534) -- 0:00:28
547500 -- (-510.864) [-508.600] (-510.600) (-512.438) * (-511.584) [-513.958] (-517.912) (-511.081) -- 0:00:28
548000 -- (-513.327) (-513.030) (-510.109) [-511.484] * [-510.133] (-513.887) (-510.747) (-509.121) -- 0:00:28
548500 -- (-508.367) [-514.075] (-511.930) (-513.189) * (-512.954) (-513.426) (-510.122) [-510.837] -- 0:00:27
549000 -- (-508.390) (-513.003) [-511.675] (-510.353) * (-510.409) (-516.102) (-512.380) [-509.821] -- 0:00:27
549500 -- (-509.544) (-511.217) (-508.984) [-510.202] * (-511.750) (-508.367) [-512.548] (-509.555) -- 0:00:27
550000 -- (-509.761) (-510.273) (-508.864) [-509.345] * (-515.132) (-509.290) (-508.473) [-513.597] -- 0:00:27
Average standard deviation of split frequencies: 0.008240
550500 -- [-509.651] (-509.113) (-509.734) (-510.845) * (-513.888) [-512.039] (-510.757) (-509.545) -- 0:00:27
551000 -- (-510.816) (-509.676) [-512.190] (-508.331) * (-514.022) (-515.682) [-509.971] (-509.824) -- 0:00:27
551500 -- [-509.049] (-514.102) (-510.942) (-509.562) * (-513.539) (-509.877) (-508.349) [-509.052] -- 0:00:27
552000 -- (-515.662) (-512.524) (-512.879) [-509.224] * (-510.035) (-511.929) [-508.378] (-508.699) -- 0:00:27
552500 -- (-509.334) [-508.485] (-516.486) (-509.952) * (-508.595) (-511.903) (-508.892) [-509.942] -- 0:00:27
553000 -- (-510.767) [-509.529] (-512.028) (-509.261) * (-512.378) (-510.598) (-510.278) [-509.293] -- 0:00:27
553500 -- (-512.687) (-509.538) [-511.574] (-511.331) * (-510.527) (-509.786) [-511.220] (-508.896) -- 0:00:27
554000 -- (-508.408) (-508.999) [-509.127] (-511.352) * [-512.626] (-509.101) (-511.588) (-512.917) -- 0:00:27
554500 -- (-515.440) (-510.275) [-508.307] (-510.279) * [-519.734] (-512.338) (-512.656) (-512.566) -- 0:00:27
555000 -- (-511.169) [-509.928] (-509.663) (-511.322) * (-513.885) [-510.682] (-509.205) (-516.312) -- 0:00:27
Average standard deviation of split frequencies: 0.009725
555500 -- (-509.294) (-509.962) [-508.683] (-511.908) * (-510.224) [-512.908] (-509.093) (-511.865) -- 0:00:27
556000 -- (-509.926) (-509.205) (-509.392) [-511.279] * (-511.180) (-513.442) (-510.285) [-511.089] -- 0:00:27
556500 -- (-508.616) (-511.935) (-509.435) [-511.077] * (-511.139) (-509.964) [-509.103] (-510.978) -- 0:00:27
557000 -- (-508.957) (-511.050) (-509.493) [-509.219] * (-511.052) (-508.903) [-512.508] (-513.067) -- 0:00:27
557500 -- (-509.359) (-510.033) [-509.306] (-511.511) * (-515.633) (-514.229) (-510.412) [-510.046] -- 0:00:26
558000 -- (-509.188) (-513.564) (-511.513) [-510.543] * [-510.757] (-510.021) (-513.345) (-510.854) -- 0:00:26
558500 -- (-519.672) (-510.954) [-508.862] (-510.121) * (-513.567) [-510.447] (-510.748) (-512.784) -- 0:00:26
559000 -- (-511.500) (-509.819) [-511.667] (-508.271) * (-508.759) (-510.121) [-508.643] (-508.637) -- 0:00:26
559500 -- (-510.485) (-514.137) [-512.117] (-508.906) * (-510.380) (-510.834) [-512.360] (-514.483) -- 0:00:26
560000 -- (-509.298) (-510.434) [-511.188] (-513.405) * [-510.321] (-511.063) (-512.261) (-515.145) -- 0:00:26
Average standard deviation of split frequencies: 0.009001
560500 -- [-508.970] (-510.848) (-509.868) (-510.878) * [-511.828] (-509.756) (-510.383) (-517.155) -- 0:00:26
561000 -- (-509.285) (-511.760) (-514.244) [-509.916] * [-509.302] (-511.125) (-510.969) (-509.681) -- 0:00:26
561500 -- (-512.517) (-519.485) (-512.983) [-511.110] * [-511.041] (-508.959) (-508.484) (-509.434) -- 0:00:26
562000 -- (-509.670) (-513.339) (-511.330) [-510.339] * (-509.859) (-512.705) (-508.993) [-508.926] -- 0:00:27
562500 -- (-510.100) (-509.548) (-512.148) [-510.860] * (-510.937) (-511.523) [-510.294] (-511.962) -- 0:00:27
563000 -- (-514.111) (-508.891) (-510.430) [-510.783] * [-509.336] (-511.855) (-509.053) (-510.433) -- 0:00:27
563500 -- (-513.915) (-509.838) [-509.669] (-512.602) * (-510.215) (-510.815) [-509.223] (-509.987) -- 0:00:27
564000 -- (-512.102) [-510.303] (-512.177) (-512.852) * [-509.694] (-510.776) (-509.915) (-510.398) -- 0:00:27
564500 -- (-518.001) [-513.686] (-511.121) (-511.130) * (-510.137) (-510.087) (-510.397) [-513.285] -- 0:00:27
565000 -- (-510.334) [-513.771] (-516.932) (-512.046) * (-510.447) (-509.086) (-512.335) [-513.289] -- 0:00:26
Average standard deviation of split frequencies: 0.009266
565500 -- (-511.127) (-513.025) (-510.728) [-514.058] * (-509.988) (-509.811) [-509.595] (-511.355) -- 0:00:26
566000 -- (-511.700) [-509.981] (-509.609) (-513.447) * (-509.176) (-510.632) [-511.707] (-513.104) -- 0:00:26
566500 -- (-511.996) [-510.819] (-508.804) (-511.194) * (-509.082) [-510.591] (-508.570) (-511.273) -- 0:00:26
567000 -- (-513.570) (-509.871) (-509.227) [-509.631] * [-508.441] (-508.848) (-508.533) (-510.767) -- 0:00:26
567500 -- (-511.112) [-508.421] (-520.137) (-510.133) * (-510.243) [-509.456] (-510.174) (-509.954) -- 0:00:26
568000 -- (-513.630) (-508.909) (-518.538) [-511.031] * (-510.447) (-510.594) (-512.503) [-509.678] -- 0:00:26
568500 -- (-510.913) [-514.332] (-513.610) (-509.254) * (-511.226) (-511.914) (-509.990) [-510.409] -- 0:00:26
569000 -- [-511.621] (-508.924) (-511.848) (-512.226) * [-510.627] (-512.446) (-509.775) (-511.177) -- 0:00:26
569500 -- [-509.645] (-509.076) (-510.447) (-510.639) * (-511.856) [-509.783] (-513.858) (-510.712) -- 0:00:26
570000 -- (-512.160) [-510.843] (-508.811) (-510.665) * (-510.674) [-510.052] (-513.314) (-510.550) -- 0:00:26
Average standard deviation of split frequencies: 0.009087
570500 -- (-510.698) [-510.343] (-511.063) (-513.544) * (-509.653) (-509.909) (-513.154) [-513.416] -- 0:00:26
571000 -- [-511.399] (-512.595) (-513.891) (-512.785) * [-511.639] (-509.466) (-509.169) (-512.596) -- 0:00:26
571500 -- (-513.409) [-508.751] (-511.531) (-513.187) * (-514.438) (-510.042) [-512.798] (-513.624) -- 0:00:26
572000 -- (-508.912) [-508.308] (-510.802) (-513.354) * (-509.864) [-509.276] (-510.833) (-509.931) -- 0:00:26
572500 -- (-511.769) (-510.814) [-510.390] (-509.622) * (-520.887) (-509.325) [-512.592] (-515.405) -- 0:00:26
573000 -- [-509.094] (-514.538) (-511.961) (-512.975) * [-512.802] (-510.747) (-513.375) (-511.377) -- 0:00:26
573500 -- (-511.441) (-511.193) (-512.693) [-513.188] * (-512.453) [-511.909] (-509.834) (-509.247) -- 0:00:26
574000 -- (-509.470) [-510.195] (-510.085) (-511.481) * (-508.817) (-508.742) (-510.611) [-509.503] -- 0:00:25
574500 -- [-511.865] (-509.738) (-511.658) (-511.163) * (-511.673) (-510.738) (-510.939) [-511.515] -- 0:00:25
575000 -- (-510.366) [-513.418] (-509.768) (-511.990) * (-511.021) [-509.124] (-510.093) (-508.924) -- 0:00:25
Average standard deviation of split frequencies: 0.008906
575500 -- [-511.632] (-509.339) (-508.902) (-512.681) * (-509.036) (-511.831) (-509.971) [-509.164] -- 0:00:25
576000 -- (-511.643) (-512.455) (-509.962) [-509.550] * [-508.037] (-509.386) (-509.481) (-511.323) -- 0:00:25
576500 -- [-509.762] (-516.100) (-510.559) (-512.330) * [-508.358] (-509.882) (-512.120) (-510.160) -- 0:00:25
577000 -- (-509.151) (-513.437) [-509.758] (-513.795) * (-509.074) (-512.648) [-511.581] (-510.431) -- 0:00:25
577500 -- (-512.908) [-511.887] (-510.774) (-511.947) * [-510.908] (-509.568) (-513.055) (-510.850) -- 0:00:25
578000 -- (-511.091) [-509.756] (-510.196) (-513.166) * (-508.557) (-509.625) [-510.133] (-513.700) -- 0:00:26
578500 -- [-509.162] (-513.240) (-512.856) (-513.299) * (-510.875) (-509.066) (-510.196) [-512.620] -- 0:00:26
579000 -- [-509.322] (-514.663) (-514.959) (-513.796) * (-511.457) (-509.032) [-509.855] (-514.559) -- 0:00:26
579500 -- (-511.695) [-511.265] (-510.701) (-515.451) * [-509.220] (-508.847) (-511.129) (-508.823) -- 0:00:26
580000 -- (-512.061) (-511.291) [-508.491] (-511.535) * [-511.115] (-513.338) (-510.573) (-512.146) -- 0:00:26
Average standard deviation of split frequencies: 0.008548
580500 -- (-509.976) (-510.726) [-511.355] (-512.590) * (-510.728) (-511.247) [-510.038] (-511.769) -- 0:00:26
581000 -- (-509.580) (-516.652) (-512.961) [-510.517] * (-513.437) (-509.460) [-508.163] (-511.483) -- 0:00:25
581500 -- [-509.486] (-510.387) (-511.542) (-510.375) * (-508.327) (-509.354) (-514.010) [-509.968] -- 0:00:25
582000 -- (-508.314) (-512.200) (-511.375) [-508.802] * (-508.571) (-510.248) [-510.176] (-510.223) -- 0:00:25
582500 -- (-510.409) (-511.565) (-512.372) [-509.773] * [-508.813] (-510.495) (-508.523) (-509.261) -- 0:00:25
583000 -- [-513.419] (-511.873) (-509.243) (-509.239) * (-508.958) (-521.816) [-511.495] (-509.159) -- 0:00:25
583500 -- (-515.568) [-512.763] (-508.873) (-508.214) * (-508.983) (-514.604) (-509.972) [-508.551] -- 0:00:25
584000 -- (-513.474) (-510.783) [-508.730] (-508.906) * [-510.927] (-512.643) (-509.444) (-510.576) -- 0:00:25
584500 -- (-510.745) (-511.736) [-512.542] (-510.855) * (-511.193) (-510.894) [-509.467] (-513.079) -- 0:00:25
585000 -- (-511.879) (-511.925) [-509.726] (-509.286) * (-511.450) (-508.180) (-512.034) [-510.060] -- 0:00:25
Average standard deviation of split frequencies: 0.008707
585500 -- [-510.101] (-509.952) (-509.638) (-509.099) * (-509.463) [-512.790] (-513.539) (-511.586) -- 0:00:25
586000 -- [-510.830] (-510.820) (-513.392) (-510.438) * [-510.205] (-513.031) (-509.331) (-510.943) -- 0:00:25
586500 -- (-508.821) (-511.111) (-514.186) [-514.420] * [-509.094] (-512.230) (-513.915) (-511.516) -- 0:00:25
587000 -- (-509.660) (-514.055) [-512.916] (-512.654) * (-512.153) (-514.963) [-509.434] (-512.325) -- 0:00:25
587500 -- (-510.137) (-509.881) [-509.486] (-509.802) * (-508.793) (-515.334) (-511.802) [-508.858] -- 0:00:25
588000 -- (-509.847) (-513.318) (-510.517) [-508.726] * [-508.569] (-515.711) (-510.753) (-509.987) -- 0:00:25
588500 -- (-513.297) (-509.986) (-511.554) [-511.250] * (-508.617) (-513.143) [-509.008] (-513.462) -- 0:00:25
589000 -- (-510.809) [-513.612] (-509.664) (-513.497) * (-513.432) (-510.727) [-508.898] (-512.273) -- 0:00:25
589500 -- [-510.111] (-513.751) (-508.391) (-511.198) * (-509.095) [-509.983] (-509.152) (-513.258) -- 0:00:25
590000 -- [-511.625] (-510.598) (-510.459) (-509.246) * (-518.267) (-510.414) (-512.368) [-516.850] -- 0:00:25
Average standard deviation of split frequencies: 0.008497
590500 -- (-509.535) (-512.528) (-508.878) [-510.465] * (-511.730) [-512.323] (-511.529) (-509.881) -- 0:00:24
591000 -- [-509.651] (-513.309) (-511.964) (-508.544) * (-515.289) (-515.155) [-510.259] (-510.572) -- 0:00:24
591500 -- [-509.748] (-512.181) (-512.425) (-508.689) * [-513.063] (-510.192) (-509.639) (-510.277) -- 0:00:24
592000 -- (-509.702) (-513.465) [-508.393] (-509.524) * [-511.641] (-511.147) (-510.559) (-513.210) -- 0:00:24
592500 -- (-509.713) (-513.460) (-510.378) [-508.777] * [-509.796] (-510.735) (-509.813) (-514.763) -- 0:00:24
593000 -- [-508.864] (-510.919) (-509.211) (-508.775) * (-512.331) [-510.403] (-509.419) (-509.789) -- 0:00:24
593500 -- (-512.321) (-509.858) (-511.544) [-509.016] * (-511.300) (-514.354) (-513.295) [-512.174] -- 0:00:24
594000 -- [-510.453] (-511.317) (-510.976) (-511.865) * (-509.898) (-509.963) (-513.895) [-511.525] -- 0:00:25
594500 -- (-510.477) (-510.850) (-511.049) [-512.011] * (-511.913) (-509.495) (-509.477) [-511.607] -- 0:00:25
595000 -- (-514.231) (-509.170) [-512.977] (-512.979) * [-510.085] (-509.436) (-510.171) (-512.395) -- 0:00:25
Average standard deviation of split frequencies: 0.008282
595500 -- (-510.098) [-510.110] (-514.581) (-509.694) * [-509.947] (-509.189) (-510.344) (-508.138) -- 0:00:25
596000 -- (-513.528) [-509.895] (-509.870) (-508.419) * (-508.775) [-508.948] (-509.249) (-508.931) -- 0:00:25
596500 -- (-510.632) (-509.579) [-509.726] (-511.884) * (-509.203) (-512.194) [-511.318] (-511.887) -- 0:00:25
597000 -- (-510.334) (-514.009) [-508.974] (-510.755) * (-508.663) (-509.634) [-509.063] (-515.232) -- 0:00:24
597500 -- (-508.774) (-511.437) [-510.963] (-511.391) * [-511.650] (-509.188) (-509.364) (-509.887) -- 0:00:24
598000 -- (-512.707) (-510.085) (-512.018) [-508.094] * [-512.913] (-510.055) (-512.696) (-512.003) -- 0:00:24
598500 -- (-510.852) [-512.022] (-515.088) (-508.411) * [-512.360] (-511.266) (-511.664) (-509.943) -- 0:00:24
599000 -- (-509.667) [-508.471] (-515.677) (-509.986) * (-510.081) (-510.057) (-511.394) [-511.542] -- 0:00:24
599500 -- (-509.585) [-512.280] (-510.047) (-510.541) * [-509.812] (-509.867) (-514.429) (-510.938) -- 0:00:24
600000 -- [-510.536] (-510.354) (-508.541) (-513.663) * (-509.523) [-510.180] (-511.667) (-510.823) -- 0:00:24
Average standard deviation of split frequencies: 0.007750
600500 -- (-514.364) (-515.051) [-509.741] (-512.630) * (-509.088) (-511.436) (-509.640) [-515.255] -- 0:00:24
601000 -- (-514.572) [-513.215] (-511.344) (-510.504) * (-510.803) [-509.343] (-510.421) (-510.096) -- 0:00:24
601500 -- (-511.777) (-509.612) [-509.713] (-509.638) * (-510.153) (-510.557) [-510.603] (-510.545) -- 0:00:24
602000 -- (-513.668) (-513.062) (-510.071) [-508.349] * [-512.849] (-510.633) (-510.642) (-510.659) -- 0:00:24
602500 -- [-514.503] (-510.716) (-511.277) (-510.790) * (-512.451) (-508.688) (-509.725) [-510.224] -- 0:00:24
603000 -- (-510.771) (-509.226) [-508.848] (-509.810) * (-510.036) (-508.953) (-510.420) [-511.917] -- 0:00:24
603500 -- (-510.628) [-509.212] (-510.418) (-509.973) * (-511.497) (-508.510) (-509.322) [-509.514] -- 0:00:24
604000 -- (-509.573) (-508.927) [-509.063] (-510.325) * (-511.740) (-509.479) [-514.183] (-509.437) -- 0:00:24
604500 -- (-513.114) (-509.716) [-510.545] (-510.622) * (-514.866) (-510.472) (-510.120) [-509.277] -- 0:00:24
605000 -- [-510.650] (-509.758) (-510.159) (-510.351) * (-508.966) (-508.389) [-509.452] (-514.136) -- 0:00:24
Average standard deviation of split frequencies: 0.007584
605500 -- (-525.819) (-512.599) (-509.433) [-509.311] * (-509.056) [-510.276] (-509.083) (-510.178) -- 0:00:24
606000 -- (-513.514) (-509.848) [-508.854] (-509.637) * [-510.211] (-510.628) (-510.657) (-513.484) -- 0:00:24
606500 -- [-512.255] (-511.694) (-510.460) (-509.127) * (-512.548) [-509.150] (-509.953) (-514.993) -- 0:00:24
607000 -- (-513.248) (-512.029) (-512.229) [-509.485] * (-512.261) [-510.011] (-510.702) (-513.972) -- 0:00:23
607500 -- [-508.018] (-509.226) (-516.986) (-511.959) * (-508.498) [-509.841] (-514.377) (-514.368) -- 0:00:23
608000 -- (-510.486) [-509.776] (-512.229) (-511.241) * (-511.233) (-511.346) [-512.033] (-511.659) -- 0:00:23
608500 -- (-510.775) (-509.523) [-510.464] (-513.765) * (-519.522) (-510.232) [-508.941] (-511.700) -- 0:00:23
609000 -- (-512.042) (-509.724) (-509.326) [-508.232] * (-520.691) [-510.456] (-510.952) (-509.352) -- 0:00:23
609500 -- [-510.812] (-510.183) (-509.972) (-508.280) * (-509.037) [-510.634] (-513.789) (-509.507) -- 0:00:23
610000 -- (-511.994) [-509.794] (-509.771) (-509.373) * (-508.761) (-509.537) [-510.807] (-509.209) -- 0:00:23
Average standard deviation of split frequencies: 0.007044
610500 -- [-514.894] (-509.773) (-514.892) (-512.494) * (-511.440) (-514.745) [-508.505] (-511.271) -- 0:00:24
611000 -- (-510.918) (-508.800) (-513.086) [-510.260] * [-508.326] (-509.005) (-509.914) (-516.853) -- 0:00:24
611500 -- [-509.910] (-516.635) (-512.567) (-510.352) * (-510.651) (-509.720) [-510.343] (-519.072) -- 0:00:24
612000 -- (-508.662) (-511.648) (-512.697) [-509.101] * (-513.312) (-510.836) [-509.349] (-515.686) -- 0:00:24
612500 -- (-511.111) (-509.722) (-511.979) [-510.006] * (-511.400) [-511.112] (-509.653) (-511.703) -- 0:00:24
613000 -- [-509.637] (-512.451) (-510.467) (-512.621) * (-508.396) [-509.770] (-511.733) (-509.865) -- 0:00:23
613500 -- [-509.999] (-508.861) (-509.999) (-513.273) * (-508.528) (-512.107) (-511.010) [-510.316] -- 0:00:23
614000 -- (-513.569) (-508.864) [-514.310] (-512.989) * [-509.963] (-511.741) (-517.313) (-509.867) -- 0:00:23
614500 -- [-511.518] (-509.033) (-512.678) (-509.923) * [-509.452] (-510.643) (-511.166) (-511.678) -- 0:00:23
615000 -- (-513.329) (-511.444) [-511.925] (-508.626) * (-512.061) (-510.580) (-510.600) [-510.500] -- 0:00:23
Average standard deviation of split frequencies: 0.006792
615500 -- (-511.272) [-510.408] (-510.031) (-512.226) * (-516.834) (-511.464) [-510.025] (-510.453) -- 0:00:23
616000 -- (-509.608) (-508.487) (-508.473) [-511.034] * (-508.216) [-511.061] (-508.621) (-508.780) -- 0:00:23
616500 -- (-508.958) [-511.981] (-509.486) (-512.309) * (-508.290) [-508.948] (-510.161) (-509.833) -- 0:00:23
617000 -- (-510.315) (-512.976) [-509.747] (-510.675) * [-508.435] (-508.859) (-512.297) (-514.222) -- 0:00:23
617500 -- (-509.333) [-511.503] (-510.151) (-517.039) * (-509.124) [-508.857] (-509.741) (-509.046) -- 0:00:23
618000 -- (-509.472) [-510.830] (-509.793) (-510.452) * (-512.030) (-512.772) [-508.249] (-509.909) -- 0:00:23
618500 -- (-509.548) [-510.655] (-511.178) (-510.217) * (-515.240) [-514.602] (-510.605) (-510.914) -- 0:00:23
619000 -- (-508.714) (-510.493) (-510.118) [-512.308] * (-513.549) (-511.887) [-510.289] (-510.293) -- 0:00:23
619500 -- (-510.129) (-509.374) [-511.394] (-513.735) * (-512.011) (-510.395) (-509.986) [-510.234] -- 0:00:23
620000 -- (-509.150) (-512.115) (-512.470) [-510.825] * (-510.722) (-509.995) (-511.727) [-511.759] -- 0:00:23
Average standard deviation of split frequencies: 0.006503
620500 -- (-513.406) [-511.986] (-513.649) (-511.594) * [-508.969] (-511.366) (-513.007) (-509.231) -- 0:00:23
621000 -- (-512.645) [-508.984] (-509.529) (-508.040) * [-511.536] (-509.642) (-511.918) (-510.290) -- 0:00:23
621500 -- (-509.737) (-510.535) (-510.079) [-508.386] * (-511.111) (-513.918) [-510.089] (-510.684) -- 0:00:23
622000 -- (-512.765) (-513.881) [-509.327] (-509.663) * [-510.685] (-512.150) (-510.590) (-513.406) -- 0:00:23
622500 -- [-511.610] (-512.534) (-510.358) (-510.071) * (-512.882) (-512.788) (-510.498) [-510.148] -- 0:00:23
623000 -- (-513.486) [-510.602] (-509.440) (-509.305) * (-510.587) (-513.667) (-511.761) [-509.962] -- 0:00:22
623500 -- (-510.641) (-509.842) [-510.815] (-509.763) * (-509.102) (-510.247) (-511.114) [-511.385] -- 0:00:22
624000 -- (-508.701) (-511.107) (-508.610) [-508.634] * (-510.092) (-511.913) [-510.518] (-511.083) -- 0:00:22
624500 -- (-509.961) (-511.509) [-511.010] (-513.068) * (-511.534) (-513.281) [-510.715] (-509.966) -- 0:00:22
625000 -- [-511.412] (-511.870) (-509.881) (-512.278) * (-510.142) (-508.462) [-508.446] (-509.604) -- 0:00:22
Average standard deviation of split frequencies: 0.006730
625500 -- (-509.386) [-511.124] (-509.733) (-511.117) * (-510.252) [-509.830] (-510.895) (-513.037) -- 0:00:22
626000 -- (-510.001) [-509.116] (-509.226) (-512.768) * (-512.163) (-510.668) [-510.957] (-512.795) -- 0:00:22
626500 -- [-511.298] (-509.721) (-510.918) (-508.759) * (-509.839) [-511.168] (-509.944) (-509.563) -- 0:00:22
627000 -- (-510.597) [-509.014] (-510.216) (-513.353) * (-509.047) (-513.624) [-510.429] (-509.905) -- 0:00:23
627500 -- (-509.618) [-511.838] (-509.587) (-513.166) * [-509.698] (-517.133) (-510.855) (-509.095) -- 0:00:23
628000 -- (-509.426) (-511.601) [-510.395] (-509.152) * (-508.875) [-510.856] (-513.798) (-509.368) -- 0:00:23
628500 -- (-510.851) [-510.383] (-509.695) (-512.933) * (-510.673) [-511.184] (-513.904) (-509.309) -- 0:00:23
629000 -- [-510.016] (-509.302) (-510.385) (-509.318) * (-508.596) (-511.083) [-508.930] (-515.543) -- 0:00:23
629500 -- (-508.371) [-509.528] (-512.997) (-511.284) * (-509.259) [-511.350] (-510.229) (-510.958) -- 0:00:22
630000 -- (-515.419) (-509.411) [-511.772] (-515.837) * (-509.108) (-512.855) (-513.407) [-509.336] -- 0:00:22
Average standard deviation of split frequencies: 0.007241
630500 -- (-512.451) [-509.540] (-513.370) (-508.990) * (-511.997) (-510.162) [-512.807] (-509.918) -- 0:00:22
631000 -- [-509.745] (-510.155) (-517.156) (-509.453) * [-510.730] (-513.725) (-510.996) (-512.406) -- 0:00:22
631500 -- (-515.219) (-515.012) [-515.614] (-508.442) * (-510.100) (-509.419) (-510.618) [-510.891] -- 0:00:22
632000 -- (-509.658) (-510.658) (-511.575) [-509.236] * (-513.110) [-509.623] (-512.620) (-512.127) -- 0:00:22
632500 -- (-508.821) [-508.721] (-509.234) (-511.592) * (-511.582) (-511.917) (-517.658) [-508.761] -- 0:00:22
633000 -- (-514.316) (-510.787) (-511.487) [-511.179] * (-508.251) (-512.380) (-513.646) [-509.544] -- 0:00:22
633500 -- (-515.335) [-508.721] (-511.009) (-511.924) * (-509.435) (-509.773) [-509.787] (-510.972) -- 0:00:22
634000 -- (-510.787) [-509.172] (-513.892) (-512.768) * [-509.041] (-509.756) (-509.937) (-512.271) -- 0:00:22
634500 -- (-512.168) (-509.983) [-509.638] (-511.042) * [-509.489] (-512.353) (-512.383) (-517.824) -- 0:00:22
635000 -- [-511.642] (-509.300) (-510.805) (-510.085) * (-509.623) (-511.297) [-509.186] (-514.643) -- 0:00:22
Average standard deviation of split frequencies: 0.007273
635500 -- [-512.226] (-511.548) (-513.065) (-510.643) * (-509.669) (-509.895) (-508.904) [-508.935] -- 0:00:22
636000 -- [-509.467] (-509.836) (-512.336) (-509.569) * (-509.934) [-509.418] (-511.002) (-509.206) -- 0:00:22
636500 -- [-510.034] (-510.021) (-510.073) (-511.486) * (-514.359) (-509.547) [-508.892] (-510.025) -- 0:00:22
637000 -- [-515.379] (-512.850) (-516.378) (-510.565) * (-510.952) [-510.162] (-508.829) (-516.131) -- 0:00:22
637500 -- [-509.766] (-509.548) (-512.807) (-514.534) * (-510.243) (-509.943) (-509.751) [-508.741] -- 0:00:22
638000 -- [-509.786] (-509.452) (-511.114) (-512.061) * [-512.780] (-510.633) (-508.921) (-512.965) -- 0:00:22
638500 -- [-509.862] (-509.810) (-511.331) (-510.939) * (-509.870) (-510.490) [-510.128] (-509.536) -- 0:00:22
639000 -- [-511.269] (-511.032) (-512.881) (-513.717) * (-513.084) [-509.775] (-510.411) (-508.603) -- 0:00:22
639500 -- (-510.397) (-511.601) [-510.162] (-512.050) * [-516.417] (-509.594) (-510.562) (-509.217) -- 0:00:21
640000 -- (-509.653) [-508.528] (-508.326) (-509.326) * (-510.598) [-509.017] (-514.320) (-511.027) -- 0:00:21
Average standard deviation of split frequencies: 0.007450
640500 -- (-508.813) (-510.216) [-513.535] (-510.827) * (-511.492) (-508.805) (-516.310) [-510.612] -- 0:00:21
641000 -- (-515.227) [-510.025] (-510.288) (-512.618) * (-511.168) [-509.547] (-511.390) (-509.889) -- 0:00:21
641500 -- (-510.454) (-508.141) (-512.182) [-512.725] * [-510.472] (-511.210) (-511.776) (-512.461) -- 0:00:21
642000 -- (-509.269) [-510.012] (-512.736) (-510.873) * (-509.158) (-511.281) (-513.822) [-511.013] -- 0:00:21
642500 -- [-509.513] (-509.764) (-511.895) (-509.975) * (-509.193) (-508.751) [-513.402] (-512.379) -- 0:00:21
643000 -- [-509.448] (-509.454) (-509.092) (-509.522) * [-508.969] (-508.515) (-509.113) (-509.021) -- 0:00:21
643500 -- (-510.299) (-511.252) (-510.867) [-508.592] * [-509.811] (-509.052) (-510.297) (-511.059) -- 0:00:21
644000 -- (-511.922) (-511.036) (-508.605) [-509.241] * (-509.727) (-515.014) (-510.825) [-509.236] -- 0:00:22
644500 -- (-511.579) (-510.621) (-513.351) [-509.274] * (-510.364) (-512.158) (-509.966) [-511.679] -- 0:00:22
645000 -- (-515.177) (-511.302) [-509.044] (-509.345) * (-512.695) [-509.260] (-515.435) (-519.932) -- 0:00:22
Average standard deviation of split frequencies: 0.007069
645500 -- (-510.893) [-510.051] (-510.094) (-508.786) * (-513.726) (-509.371) (-511.227) [-511.847] -- 0:00:21
646000 -- (-509.053) (-514.309) (-516.498) [-509.349] * (-514.052) (-508.562) [-511.841] (-509.091) -- 0:00:21
646500 -- (-509.370) [-511.341] (-511.146) (-510.292) * (-510.093) (-511.442) [-512.334] (-509.514) -- 0:00:21
647000 -- (-513.601) (-509.351) [-509.374] (-510.124) * (-509.096) (-512.110) [-511.106] (-513.101) -- 0:00:21
647500 -- (-510.426) (-509.090) (-509.380) [-509.052] * (-511.833) [-510.228] (-510.447) (-512.094) -- 0:00:21
648000 -- (-511.171) (-509.897) (-509.071) [-508.479] * (-510.229) [-511.669] (-510.668) (-510.006) -- 0:00:21
648500 -- (-509.266) [-511.008] (-511.779) (-509.607) * (-509.236) (-513.033) (-510.225) [-512.558] -- 0:00:21
649000 -- [-509.177] (-512.045) (-515.980) (-509.423) * (-509.977) (-509.529) (-508.229) [-510.189] -- 0:00:21
649500 -- [-510.272] (-510.637) (-511.680) (-508.883) * (-508.964) (-510.484) [-510.093] (-510.374) -- 0:00:21
650000 -- (-509.582) [-512.595] (-512.727) (-511.390) * [-509.862] (-513.611) (-509.489) (-511.522) -- 0:00:21
Average standard deviation of split frequencies: 0.007200
650500 -- (-510.767) (-510.575) [-510.742] (-510.051) * (-510.740) [-511.040] (-512.467) (-509.067) -- 0:00:21
651000 -- (-516.151) (-510.982) (-508.716) [-511.210] * (-511.940) (-509.124) [-511.815] (-508.825) -- 0:00:21
651500 -- [-511.116] (-509.063) (-510.458) (-508.741) * (-512.225) (-512.728) (-510.578) [-508.782] -- 0:00:21
652000 -- (-511.109) (-508.299) [-513.162] (-509.922) * (-509.960) [-511.694] (-509.794) (-508.463) -- 0:00:21
652500 -- [-509.873] (-508.517) (-510.942) (-512.355) * (-509.833) (-511.886) [-509.103] (-510.832) -- 0:00:21
653000 -- [-516.100] (-513.082) (-509.586) (-511.745) * (-509.371) (-511.335) [-508.906] (-509.714) -- 0:00:21
653500 -- [-510.886] (-510.962) (-511.389) (-512.437) * (-511.713) (-511.518) [-512.138] (-511.619) -- 0:00:21
654000 -- (-514.891) (-511.580) [-515.255] (-511.731) * (-510.436) [-511.022] (-517.178) (-511.055) -- 0:00:21
654500 -- [-513.931] (-510.017) (-510.320) (-509.885) * (-509.960) (-509.980) (-515.364) [-510.597] -- 0:00:21
655000 -- (-515.542) (-516.488) [-509.018] (-512.192) * [-511.270] (-510.085) (-512.658) (-514.578) -- 0:00:21
Average standard deviation of split frequencies: 0.006333
655500 -- (-511.424) (-512.187) [-508.363] (-511.083) * (-511.199) (-510.419) [-508.918] (-509.273) -- 0:00:21
656000 -- [-511.318] (-510.866) (-510.111) (-508.970) * [-510.468] (-512.246) (-509.403) (-511.062) -- 0:00:20
656500 -- [-510.133] (-510.379) (-511.132) (-511.138) * (-509.462) [-510.725] (-508.801) (-512.088) -- 0:00:20
657000 -- (-511.567) [-510.130] (-513.916) (-509.020) * (-509.370) (-509.099) (-508.971) [-512.126] -- 0:00:20
657500 -- (-511.383) (-513.363) (-508.668) [-515.834] * (-511.236) [-512.541] (-510.486) (-511.047) -- 0:00:20
658000 -- (-512.578) [-516.764] (-510.837) (-509.277) * (-509.392) [-509.022] (-509.688) (-510.040) -- 0:00:20
658500 -- (-512.002) (-512.950) (-519.008) [-509.298] * (-509.225) (-510.223) (-510.469) [-509.729] -- 0:00:20
659000 -- (-510.673) [-509.437] (-511.575) (-508.229) * (-513.992) (-510.962) (-513.342) [-510.267] -- 0:00:20
659500 -- (-511.778) (-511.383) (-514.426) [-512.469] * [-510.774] (-509.410) (-511.755) (-509.600) -- 0:00:20
660000 -- (-511.063) (-512.849) [-512.232] (-509.411) * (-512.658) (-513.425) [-511.625] (-510.979) -- 0:00:20
Average standard deviation of split frequencies: 0.006154
660500 -- (-515.127) (-508.845) (-515.410) [-510.860] * (-509.526) (-511.736) [-512.248] (-509.429) -- 0:00:21
661000 -- [-510.014] (-510.375) (-513.819) (-511.278) * (-509.932) (-512.034) (-514.636) [-513.088] -- 0:00:21
661500 -- (-510.729) [-511.874] (-509.372) (-509.645) * (-512.096) [-512.018] (-513.037) (-510.960) -- 0:00:20
662000 -- [-509.692] (-509.217) (-509.166) (-509.719) * [-510.536] (-510.451) (-512.338) (-508.994) -- 0:00:20
662500 -- [-508.883] (-511.377) (-511.185) (-510.094) * [-510.507] (-511.076) (-512.073) (-509.369) -- 0:00:20
663000 -- (-508.688) (-511.577) [-513.830] (-512.088) * (-512.302) (-508.762) [-512.080] (-509.162) -- 0:00:20
663500 -- (-509.582) (-511.063) (-513.245) [-512.030] * (-509.771) (-512.407) [-508.946] (-514.797) -- 0:00:20
664000 -- (-515.434) (-511.878) (-508.795) [-509.532] * (-511.757) [-508.557] (-513.503) (-514.854) -- 0:00:20
664500 -- [-509.734] (-508.662) (-511.530) (-511.296) * (-509.630) (-511.229) [-510.649] (-509.991) -- 0:00:20
665000 -- [-510.146] (-509.835) (-509.007) (-509.341) * [-508.801] (-509.123) (-515.494) (-515.018) -- 0:00:20
Average standard deviation of split frequencies: 0.005486
665500 -- (-508.646) (-510.033) [-508.670] (-511.869) * (-509.230) (-510.179) [-509.955] (-510.295) -- 0:00:20
666000 -- (-510.359) (-510.108) (-512.410) [-510.015] * (-510.069) (-510.756) [-508.610] (-508.254) -- 0:00:20
666500 -- (-511.022) (-515.237) (-510.545) [-509.683] * (-509.916) [-511.382] (-508.683) (-509.132) -- 0:00:20
667000 -- (-513.838) [-509.569] (-510.486) (-513.329) * [-509.397] (-511.777) (-510.622) (-509.434) -- 0:00:20
667500 -- [-514.587] (-512.584) (-511.976) (-513.928) * [-512.648] (-508.910) (-511.616) (-510.699) -- 0:00:20
668000 -- (-512.299) (-510.606) (-512.200) [-512.255] * (-509.577) (-509.632) [-509.572] (-510.464) -- 0:00:20
668500 -- (-508.819) (-509.235) (-509.707) [-511.913] * (-509.107) (-510.040) [-511.916] (-513.511) -- 0:00:20
669000 -- (-510.915) (-510.678) (-509.217) [-510.561] * [-509.538] (-508.709) (-511.119) (-516.915) -- 0:00:20
669500 -- (-509.119) (-509.134) (-509.083) [-509.157] * (-511.182) (-510.147) [-510.570] (-508.354) -- 0:00:20
670000 -- [-510.071] (-511.801) (-508.555) (-518.042) * (-508.173) [-509.016] (-510.110) (-510.517) -- 0:00:20
Average standard deviation of split frequencies: 0.005535
670500 -- (-510.878) [-513.069] (-512.100) (-510.462) * [-509.607] (-517.396) (-515.858) (-512.514) -- 0:00:20
671000 -- [-510.294] (-511.080) (-509.360) (-511.032) * (-509.029) (-513.112) [-509.167] (-513.586) -- 0:00:20
671500 -- (-510.368) (-510.872) [-508.279] (-509.047) * (-511.465) [-510.703] (-511.725) (-511.440) -- 0:00:20
672000 -- (-509.632) (-509.100) (-509.448) [-509.965] * [-509.175] (-514.081) (-510.841) (-509.638) -- 0:00:20
672500 -- (-510.445) (-509.525) (-509.356) [-509.393] * [-511.460] (-510.237) (-512.008) (-510.348) -- 0:00:19
673000 -- (-508.937) (-510.464) [-509.221] (-512.077) * (-508.151) (-510.415) [-509.536] (-510.665) -- 0:00:19
673500 -- (-508.302) (-514.902) [-509.426] (-510.076) * [-509.393] (-511.462) (-509.609) (-513.152) -- 0:00:19
674000 -- (-512.690) [-510.618] (-509.431) (-509.014) * (-513.111) (-513.107) [-509.405] (-510.674) -- 0:00:19
674500 -- (-510.968) (-514.632) (-508.716) [-510.408] * (-509.175) [-513.252] (-512.334) (-510.394) -- 0:00:19
675000 -- [-511.484] (-512.824) (-509.784) (-511.539) * (-516.518) (-511.602) (-509.056) [-508.737] -- 0:00:19
Average standard deviation of split frequencies: 0.005710
675500 -- (-510.623) (-512.406) [-511.236] (-513.675) * [-513.957] (-509.585) (-510.233) (-509.092) -- 0:00:19
676000 -- (-509.695) (-512.960) (-508.632) [-511.455] * (-511.799) (-512.055) [-511.336] (-515.172) -- 0:00:19
676500 -- (-511.050) (-508.576) [-511.831] (-510.906) * (-512.240) (-512.002) (-512.145) [-509.966] -- 0:00:19
677000 -- (-510.469) [-508.583] (-512.080) (-515.299) * (-512.781) [-510.761] (-519.327) (-511.412) -- 0:00:19
677500 -- (-509.264) (-509.900) [-513.317] (-509.119) * (-510.666) (-510.564) (-512.729) [-511.508] -- 0:00:19
678000 -- (-511.649) (-511.622) [-510.411] (-509.487) * (-510.538) [-509.644] (-508.980) (-511.541) -- 0:00:19
678500 -- [-514.166] (-511.753) (-511.075) (-511.129) * (-511.213) (-510.832) [-511.862] (-509.647) -- 0:00:19
679000 -- (-510.085) (-512.968) [-516.063] (-510.156) * (-511.161) (-511.936) (-512.399) [-510.815] -- 0:00:19
679500 -- (-511.165) (-509.483) [-510.527] (-508.712) * (-510.469) (-508.616) [-512.009] (-508.344) -- 0:00:19
680000 -- (-509.476) [-510.762] (-510.908) (-508.981) * (-509.871) (-514.977) [-510.969] (-509.128) -- 0:00:19
Average standard deviation of split frequencies: 0.005973
680500 -- (-510.302) (-512.133) (-511.434) [-509.521] * (-510.179) [-509.169] (-512.329) (-512.855) -- 0:00:19
681000 -- (-510.204) [-508.681] (-509.425) (-513.203) * (-508.765) (-510.985) [-511.508] (-512.313) -- 0:00:19
681500 -- (-512.495) [-518.830] (-508.210) (-517.185) * (-510.056) (-509.447) (-509.800) [-512.829] -- 0:00:19
682000 -- [-513.231] (-521.698) (-510.009) (-515.236) * (-509.768) [-510.029] (-510.126) (-515.488) -- 0:00:19
682500 -- (-510.861) (-520.670) [-510.132] (-511.289) * (-511.679) (-510.651) (-510.846) [-515.989] -- 0:00:19
683000 -- (-509.736) (-509.602) (-511.516) [-511.928] * (-515.278) [-514.122] (-509.999) (-510.274) -- 0:00:19
683500 -- [-510.318] (-508.428) (-510.318) (-512.821) * (-512.553) [-512.919] (-511.293) (-511.025) -- 0:00:19
684000 -- (-508.968) (-510.548) [-510.616] (-509.600) * [-510.780] (-508.833) (-513.047) (-512.857) -- 0:00:19
684500 -- (-510.730) [-509.709] (-510.199) (-509.611) * (-512.575) (-509.614) (-509.642) [-514.795] -- 0:00:19
685000 -- [-512.238] (-509.359) (-511.566) (-511.587) * (-513.025) (-511.111) [-511.169] (-509.561) -- 0:00:19
Average standard deviation of split frequencies: 0.005712
685500 -- (-512.265) (-515.367) (-509.696) [-509.435] * (-514.118) (-512.225) (-509.998) [-511.136] -- 0:00:19
686000 -- (-510.657) (-513.923) (-509.815) [-510.984] * (-510.704) [-512.279] (-514.210) (-511.561) -- 0:00:19
686500 -- [-510.917] (-514.953) (-512.517) (-509.941) * (-510.787) [-511.205] (-510.485) (-508.605) -- 0:00:19
687000 -- (-510.866) (-508.272) (-509.858) [-510.469] * [-510.264] (-512.933) (-512.138) (-518.606) -- 0:00:19
687500 -- (-511.142) (-509.392) [-509.178] (-508.429) * [-509.622] (-510.909) (-514.730) (-510.650) -- 0:00:19
688000 -- [-508.762] (-510.095) (-509.700) (-508.877) * (-510.413) (-512.999) (-508.810) [-509.483] -- 0:00:19
688500 -- (-509.048) [-510.828] (-510.905) (-510.464) * (-512.177) (-518.530) (-511.669) [-509.378] -- 0:00:19
689000 -- (-510.054) (-513.289) [-509.668] (-515.899) * (-512.931) (-513.733) [-511.019] (-510.229) -- 0:00:18
689500 -- [-510.646] (-515.771) (-508.386) (-509.600) * (-509.883) [-512.333] (-509.718) (-511.856) -- 0:00:18
690000 -- (-509.084) [-509.296] (-509.078) (-512.053) * (-510.253) (-509.362) [-511.496] (-516.152) -- 0:00:18
Average standard deviation of split frequencies: 0.005162
690500 -- [-509.558] (-511.246) (-511.888) (-511.694) * (-510.445) [-508.429] (-511.397) (-509.971) -- 0:00:18
691000 -- (-515.761) (-512.332) [-510.499] (-512.431) * (-515.900) (-508.196) [-510.694] (-509.581) -- 0:00:18
691500 -- (-509.833) [-510.559] (-508.904) (-514.273) * (-510.256) (-509.262) [-512.118] (-508.098) -- 0:00:18
692000 -- [-509.028] (-511.059) (-511.575) (-512.690) * [-508.164] (-509.838) (-510.350) (-508.593) -- 0:00:18
692500 -- (-513.717) [-510.552] (-513.519) (-509.575) * (-509.864) (-509.854) (-512.887) [-512.808] -- 0:00:18
693000 -- (-509.506) (-509.481) (-513.031) [-510.750] * [-508.749] (-509.485) (-509.697) (-515.535) -- 0:00:18
693500 -- (-511.275) (-509.623) [-508.550] (-508.927) * (-512.343) [-510.855] (-513.199) (-510.422) -- 0:00:18
694000 -- [-511.158] (-510.992) (-510.080) (-509.874) * [-509.547] (-512.545) (-511.350) (-511.647) -- 0:00:18
694500 -- (-512.073) (-512.671) [-509.263] (-511.444) * [-508.385] (-511.174) (-511.168) (-513.057) -- 0:00:18
695000 -- (-511.606) [-511.444] (-512.489) (-509.032) * (-511.475) [-508.805] (-510.195) (-509.183) -- 0:00:18
Average standard deviation of split frequencies: 0.005164
695500 -- (-511.546) (-511.284) (-509.113) [-508.969] * [-509.638] (-515.627) (-508.993) (-510.410) -- 0:00:18
696000 -- (-508.741) [-512.634] (-512.012) (-508.269) * (-509.212) (-509.043) [-509.091] (-510.649) -- 0:00:18
696500 -- (-510.427) (-512.339) (-510.792) [-508.478] * (-510.064) (-509.677) [-510.307] (-510.622) -- 0:00:18
697000 -- [-510.190] (-512.161) (-510.173) (-511.861) * (-508.333) (-513.345) (-513.494) [-508.780] -- 0:00:18
697500 -- (-509.678) (-513.975) (-509.929) [-508.616] * (-512.309) (-509.262) (-509.604) [-513.453] -- 0:00:18
698000 -- (-509.568) (-509.736) (-510.690) [-509.056] * (-509.538) [-511.151] (-511.215) (-508.383) -- 0:00:18
698500 -- (-511.859) [-509.298] (-513.576) (-511.152) * (-509.208) (-513.080) (-508.973) [-509.490] -- 0:00:18
699000 -- (-510.193) [-509.207] (-512.391) (-513.543) * [-510.510] (-510.680) (-510.121) (-512.985) -- 0:00:18
699500 -- (-511.437) [-509.519] (-509.876) (-510.595) * (-511.349) [-509.149] (-511.712) (-512.871) -- 0:00:18
700000 -- (-513.959) (-509.807) [-510.495] (-511.674) * (-510.309) (-511.542) [-511.185] (-510.045) -- 0:00:18
Average standard deviation of split frequencies: 0.005298
700500 -- (-512.939) (-510.675) [-509.046] (-508.326) * [-509.327] (-509.937) (-515.557) (-511.064) -- 0:00:18
701000 -- [-511.746] (-508.116) (-510.122) (-512.383) * (-510.617) (-509.899) [-510.552] (-510.738) -- 0:00:18
701500 -- (-508.623) [-509.705] (-511.122) (-512.076) * [-510.982] (-508.754) (-510.219) (-510.976) -- 0:00:18
702000 -- [-511.482] (-510.088) (-510.553) (-510.286) * (-509.565) [-509.309] (-510.989) (-509.261) -- 0:00:18
702500 -- (-511.840) [-511.687] (-508.919) (-509.513) * (-509.442) [-511.173] (-511.022) (-510.380) -- 0:00:18
703000 -- (-510.700) [-514.527] (-508.569) (-509.519) * (-511.324) [-508.946] (-510.403) (-510.507) -- 0:00:18
703500 -- (-510.735) (-515.763) [-511.807] (-509.118) * (-509.134) (-510.316) (-512.242) [-508.316] -- 0:00:18
704000 -- (-509.236) (-512.118) [-508.915] (-511.478) * (-510.016) (-511.834) (-513.528) [-509.253] -- 0:00:18
704500 -- (-511.929) [-511.208] (-509.107) (-512.370) * (-511.720) (-510.052) (-512.809) [-508.725] -- 0:00:18
705000 -- (-508.843) [-509.942] (-509.091) (-510.196) * (-516.215) (-513.693) [-509.518] (-509.359) -- 0:00:17
Average standard deviation of split frequencies: 0.005509
705500 -- (-510.994) (-509.551) [-509.810] (-510.116) * [-509.661] (-509.243) (-509.939) (-510.665) -- 0:00:17
706000 -- [-511.833] (-513.108) (-509.517) (-510.088) * (-513.192) [-511.982] (-511.066) (-510.405) -- 0:00:17
706500 -- (-510.278) (-508.456) [-508.812] (-509.875) * (-510.105) (-509.045) (-511.969) [-511.905] -- 0:00:17
707000 -- (-509.762) (-511.563) (-519.684) [-510.400] * (-510.343) [-508.816] (-511.257) (-508.642) -- 0:00:17
707500 -- (-511.449) [-510.004] (-510.284) (-508.594) * (-510.151) [-510.911] (-513.049) (-512.256) -- 0:00:17
708000 -- (-510.451) (-510.191) [-509.509] (-513.663) * (-512.930) [-510.680] (-509.781) (-510.461) -- 0:00:17
708500 -- [-508.957] (-511.363) (-510.969) (-509.981) * (-509.813) (-512.293) (-511.576) [-509.919] -- 0:00:17
709000 -- [-510.003] (-509.348) (-510.674) (-512.085) * [-508.965] (-511.048) (-511.918) (-509.986) -- 0:00:17
709500 -- [-515.005] (-509.944) (-509.802) (-509.986) * (-509.627) (-511.453) (-510.220) [-510.460] -- 0:00:17
710000 -- (-511.440) [-509.541] (-508.631) (-508.480) * (-509.834) (-511.357) [-513.918] (-513.713) -- 0:00:17
Average standard deviation of split frequencies: 0.005390
710500 -- (-508.748) [-509.581] (-508.679) (-508.661) * [-509.271] (-513.208) (-509.483) (-511.627) -- 0:00:17
711000 -- (-508.920) (-511.492) (-509.924) [-510.181] * (-509.314) (-512.027) [-509.466] (-512.594) -- 0:00:17
711500 -- (-510.833) (-510.914) (-511.389) [-510.010] * [-508.721] (-510.251) (-512.631) (-513.392) -- 0:00:17
712000 -- (-511.351) (-508.593) [-511.563] (-508.808) * [-508.776] (-510.518) (-513.247) (-510.928) -- 0:00:17
712500 -- (-508.899) [-513.356] (-509.869) (-514.391) * [-508.557] (-512.063) (-512.547) (-510.233) -- 0:00:17
713000 -- (-510.302) (-512.656) [-509.797] (-508.611) * [-508.626] (-511.702) (-510.447) (-514.246) -- 0:00:17
713500 -- (-510.583) (-512.503) [-511.581] (-511.170) * [-509.820] (-510.250) (-509.719) (-511.371) -- 0:00:17
714000 -- (-509.043) (-514.639) (-513.335) [-511.514] * [-512.446] (-509.368) (-509.211) (-509.026) -- 0:00:17
714500 -- (-510.108) [-510.432] (-510.285) (-512.134) * (-509.912) (-509.098) (-510.501) [-510.648] -- 0:00:17
715000 -- (-508.576) (-509.404) (-509.588) [-509.281] * (-509.864) (-508.741) (-512.705) [-510.721] -- 0:00:17
Average standard deviation of split frequencies: 0.005802
715500 -- (-511.268) [-511.177] (-511.220) (-509.787) * (-509.712) [-511.997] (-512.722) (-510.389) -- 0:00:17
716000 -- [-514.751] (-510.470) (-511.007) (-509.597) * (-509.324) (-509.053) [-510.658] (-510.003) -- 0:00:17
716500 -- [-510.544] (-510.593) (-512.824) (-509.843) * [-509.397] (-510.518) (-513.272) (-510.023) -- 0:00:17
717000 -- (-511.249) (-512.941) [-511.097] (-511.156) * (-509.075) (-509.356) [-514.069] (-509.606) -- 0:00:17
717500 -- (-515.232) (-509.513) (-509.586) [-511.963] * (-509.965) (-508.648) [-512.080] (-510.207) -- 0:00:17
718000 -- [-510.367] (-512.775) (-511.006) (-512.196) * (-510.326) (-508.607) (-511.218) [-516.239] -- 0:00:17
718500 -- (-508.709) (-514.934) [-509.655] (-510.388) * [-509.529] (-512.110) (-511.423) (-515.878) -- 0:00:17
719000 -- (-511.384) (-510.194) (-510.008) [-510.705] * (-509.598) (-509.951) [-512.068] (-512.836) -- 0:00:17
719500 -- (-510.739) (-511.856) (-513.824) [-512.572] * (-509.444) (-510.328) [-509.899] (-510.592) -- 0:00:17
720000 -- (-509.853) [-509.916] (-508.916) (-510.981) * (-509.931) [-509.047] (-511.544) (-508.908) -- 0:00:17
Average standard deviation of split frequencies: 0.005764
720500 -- (-508.766) [-510.167] (-510.811) (-511.779) * (-508.739) (-508.875) [-508.383] (-514.136) -- 0:00:17
721000 -- [-510.898] (-510.890) (-508.768) (-511.724) * (-510.056) (-510.662) [-510.868] (-509.990) -- 0:00:17
721500 -- (-514.936) (-508.777) (-509.311) [-510.623] * (-511.211) (-509.104) (-509.982) [-509.634] -- 0:00:16
722000 -- [-511.657] (-510.609) (-509.258) (-509.293) * [-508.962] (-509.677) (-513.187) (-512.178) -- 0:00:16
722500 -- (-509.878) (-509.046) (-508.204) [-508.444] * (-510.859) (-509.272) (-512.447) [-512.306] -- 0:00:16
723000 -- (-510.057) (-512.232) [-510.826] (-508.966) * (-510.086) (-511.680) (-512.116) [-513.572] -- 0:00:16
723500 -- (-511.381) (-515.635) (-509.737) [-508.496] * (-509.741) [-509.831] (-513.523) (-511.197) -- 0:00:16
724000 -- (-510.465) [-510.768] (-509.487) (-511.874) * (-511.980) (-511.841) [-512.277] (-511.826) -- 0:00:16
724500 -- (-510.408) [-509.606] (-513.612) (-510.398) * (-509.932) [-510.480] (-509.680) (-508.968) -- 0:00:16
725000 -- (-512.761) [-511.476] (-513.251) (-513.139) * (-510.830) [-508.952] (-508.671) (-509.185) -- 0:00:16
Average standard deviation of split frequencies: 0.005966
725500 -- [-511.534] (-517.068) (-513.086) (-511.447) * [-510.858] (-509.094) (-509.435) (-509.122) -- 0:00:16
726000 -- [-512.379] (-511.053) (-512.334) (-511.578) * (-509.478) [-511.645] (-511.319) (-514.199) -- 0:00:16
726500 -- (-508.811) [-509.072] (-508.699) (-512.025) * [-509.606] (-509.658) (-512.544) (-516.314) -- 0:00:16
727000 -- (-511.079) (-508.944) [-510.667] (-508.983) * (-508.597) [-510.939] (-509.971) (-510.674) -- 0:00:16
727500 -- (-511.709) (-508.955) [-511.023] (-510.942) * (-512.720) [-508.587] (-510.707) (-510.690) -- 0:00:16
728000 -- (-509.311) (-508.189) (-512.873) [-508.948] * [-511.746] (-508.855) (-511.302) (-511.290) -- 0:00:16
728500 -- (-509.020) (-508.559) (-511.475) [-509.396] * (-514.253) [-513.547] (-511.750) (-511.026) -- 0:00:16
729000 -- [-509.441] (-511.012) (-513.860) (-513.278) * (-511.487) [-510.909] (-508.171) (-512.982) -- 0:00:16
729500 -- (-508.635) (-511.140) (-512.954) [-510.387] * (-508.414) (-514.972) (-511.692) [-511.039] -- 0:00:16
730000 -- (-509.574) (-510.938) (-510.030) [-509.904] * (-512.453) (-510.721) [-508.766] (-512.299) -- 0:00:16
Average standard deviation of split frequencies: 0.006250
730500 -- (-508.947) (-509.058) (-510.989) [-509.765] * (-513.448) (-509.519) (-510.889) [-509.568] -- 0:00:16
731000 -- (-509.009) (-509.631) [-510.382] (-510.399) * [-511.415] (-509.674) (-512.111) (-512.602) -- 0:00:16
731500 -- (-511.138) (-511.413) [-508.844] (-509.409) * (-511.580) (-510.032) (-513.781) [-508.896] -- 0:00:16
732000 -- [-513.607] (-512.513) (-510.090) (-509.915) * (-508.476) (-510.849) [-510.661] (-511.081) -- 0:00:16
732500 -- (-510.506) (-512.939) [-511.790] (-509.267) * (-510.299) [-511.010] (-509.598) (-508.718) -- 0:00:16
733000 -- (-510.254) (-508.813) [-509.944] (-512.324) * (-508.710) (-510.000) [-510.967] (-510.800) -- 0:00:16
733500 -- (-512.825) (-510.433) [-510.337] (-509.710) * (-509.328) (-509.154) (-508.319) [-508.253] -- 0:00:16
734000 -- (-510.652) (-508.972) (-510.709) [-509.119] * [-508.954] (-508.652) (-513.447) (-509.202) -- 0:00:16
734500 -- [-511.401] (-512.720) (-510.518) (-511.310) * (-509.304) (-509.142) [-510.624] (-509.995) -- 0:00:16
735000 -- (-508.766) (-514.902) [-509.297] (-509.642) * [-510.053] (-509.505) (-513.070) (-512.442) -- 0:00:16
Average standard deviation of split frequencies: 0.005925
735500 -- (-510.638) (-513.549) [-509.514] (-511.390) * (-510.674) [-508.576] (-513.513) (-512.580) -- 0:00:16
736000 -- [-510.442] (-513.607) (-508.977) (-511.773) * [-513.254] (-513.917) (-511.509) (-510.895) -- 0:00:16
736500 -- (-509.883) (-510.840) (-509.382) [-511.134] * [-510.164] (-511.618) (-511.410) (-510.664) -- 0:00:16
737000 -- (-509.751) [-509.226] (-512.172) (-508.392) * (-512.027) [-509.029] (-509.471) (-512.347) -- 0:00:16
737500 -- (-511.027) [-510.322] (-511.492) (-508.467) * (-511.470) (-508.831) [-511.730] (-514.743) -- 0:00:16
738000 -- (-511.110) [-513.100] (-508.807) (-512.648) * [-509.768] (-509.809) (-510.168) (-510.503) -- 0:00:15
738500 -- (-512.161) (-509.158) (-510.935) [-514.085] * [-511.100] (-509.003) (-509.836) (-514.011) -- 0:00:15
739000 -- (-509.090) [-509.724] (-511.946) (-510.541) * [-513.603] (-509.490) (-510.251) (-511.079) -- 0:00:15
739500 -- (-510.897) (-509.233) (-509.716) [-511.510] * (-512.155) [-509.524] (-509.340) (-511.478) -- 0:00:15
740000 -- [-511.659] (-510.339) (-510.826) (-512.865) * (-510.661) [-513.117] (-511.927) (-512.638) -- 0:00:15
Average standard deviation of split frequencies: 0.006086
740500 -- (-514.307) [-510.160] (-515.158) (-512.437) * (-509.272) [-511.071] (-510.812) (-513.448) -- 0:00:15
741000 -- (-509.867) (-511.938) (-510.561) [-511.012] * (-511.300) (-511.534) [-509.492] (-509.549) -- 0:00:15
741500 -- (-509.971) (-511.846) [-508.657] (-509.344) * (-510.220) [-509.405] (-509.724) (-511.327) -- 0:00:15
742000 -- [-509.067] (-509.473) (-514.189) (-509.085) * [-510.056] (-509.708) (-510.527) (-510.675) -- 0:00:15
742500 -- (-510.817) [-510.152] (-515.425) (-509.152) * (-509.767) (-509.452) (-509.388) [-509.609] -- 0:00:15
743000 -- (-512.492) [-508.409] (-510.566) (-508.981) * (-510.879) [-509.887] (-508.503) (-511.606) -- 0:00:15
743500 -- (-512.767) (-510.452) (-510.070) [-513.459] * (-510.107) (-510.174) (-509.918) [-511.618] -- 0:00:15
744000 -- (-512.720) [-511.294] (-509.035) (-509.625) * (-512.177) [-512.361] (-513.610) (-510.590) -- 0:00:15
744500 -- [-508.312] (-509.126) (-511.660) (-509.189) * (-510.803) (-511.537) (-510.848) [-511.355] -- 0:00:15
745000 -- [-509.983] (-509.284) (-509.515) (-510.211) * (-510.443) (-510.749) [-508.729] (-508.783) -- 0:00:15
Average standard deviation of split frequencies: 0.006043
745500 -- (-512.412) [-516.151] (-509.967) (-510.614) * (-510.290) (-513.244) [-511.440] (-511.352) -- 0:00:15
746000 -- (-512.835) [-510.875] (-510.175) (-510.538) * (-511.174) (-512.056) (-510.167) [-509.850] -- 0:00:15
746500 -- (-509.841) (-509.846) [-510.541] (-513.267) * (-510.257) [-509.272] (-509.418) (-512.234) -- 0:00:15
747000 -- (-509.370) [-512.352] (-509.603) (-509.339) * [-511.829] (-509.267) (-511.695) (-510.779) -- 0:00:15
747500 -- [-511.887] (-512.444) (-513.569) (-509.035) * (-512.270) (-511.888) [-511.018] (-514.378) -- 0:00:15
748000 -- (-511.215) (-511.398) [-508.857] (-509.137) * [-512.391] (-510.652) (-511.842) (-514.022) -- 0:00:15
748500 -- (-509.376) [-509.843] (-510.191) (-510.045) * (-514.624) (-508.558) [-511.047] (-509.883) -- 0:00:15
749000 -- (-512.794) [-509.358] (-510.184) (-513.628) * (-514.451) (-509.363) (-515.771) [-510.032] -- 0:00:15
749500 -- (-511.087) (-512.006) [-509.679] (-512.344) * [-510.112] (-508.616) (-510.437) (-509.258) -- 0:00:15
750000 -- (-508.439) [-509.987] (-512.142) (-515.302) * (-509.216) [-509.767] (-510.592) (-514.912) -- 0:00:15
Average standard deviation of split frequencies: 0.006162
750500 -- (-508.814) (-510.317) [-512.610] (-512.410) * [-509.095] (-510.143) (-510.571) (-511.775) -- 0:00:15
751000 -- (-509.431) (-510.624) (-510.497) [-508.313] * (-508.909) (-515.583) [-509.246] (-514.202) -- 0:00:15
751500 -- (-509.612) (-512.630) [-509.727] (-510.736) * (-509.842) (-509.085) [-510.363] (-511.666) -- 0:00:15
752000 -- (-513.018) (-510.015) [-510.861] (-511.580) * (-508.929) (-509.676) (-509.186) [-511.812] -- 0:00:15
752500 -- [-509.279] (-510.357) (-510.497) (-508.617) * (-511.178) [-511.143] (-511.613) (-510.474) -- 0:00:15
753000 -- (-511.371) [-510.113] (-512.133) (-508.783) * (-511.876) (-509.098) (-510.884) [-509.344] -- 0:00:15
753500 -- (-509.508) (-510.746) (-510.961) [-512.092] * (-509.356) (-511.632) (-510.306) [-508.556] -- 0:00:15
754000 -- [-509.693] (-508.466) (-512.992) (-513.990) * (-509.676) (-510.000) [-510.386] (-510.052) -- 0:00:15
754500 -- (-508.520) [-511.094] (-511.193) (-509.863) * [-510.004] (-511.696) (-510.670) (-510.790) -- 0:00:14
755000 -- (-510.509) (-511.303) [-509.853] (-509.242) * (-509.210) [-510.471] (-509.004) (-508.940) -- 0:00:14
Average standard deviation of split frequencies: 0.005487
755500 -- (-514.145) (-510.142) (-512.481) [-508.842] * (-509.629) (-508.796) [-510.672] (-511.457) -- 0:00:14
756000 -- (-511.376) [-513.466] (-510.855) (-508.919) * (-510.044) (-514.161) (-511.119) [-513.295] -- 0:00:14
756500 -- (-510.079) (-512.249) [-509.516] (-510.891) * (-512.142) [-510.342] (-509.570) (-511.572) -- 0:00:14
757000 -- [-509.396] (-513.312) (-512.151) (-510.727) * [-514.306] (-508.884) (-510.070) (-509.100) -- 0:00:14
757500 -- (-511.689) (-509.722) (-510.403) [-513.073] * (-513.549) (-511.136) [-509.718] (-509.943) -- 0:00:14
758000 -- (-509.833) [-509.791] (-510.293) (-509.058) * [-511.617] (-509.957) (-512.368) (-513.990) -- 0:00:14
758500 -- (-513.749) (-510.274) [-508.662] (-508.671) * (-512.430) (-508.375) [-509.644] (-516.076) -- 0:00:14
759000 -- (-509.356) (-512.351) [-508.617] (-508.751) * (-509.182) (-511.319) (-510.861) [-509.291] -- 0:00:14
759500 -- (-509.516) (-510.203) [-509.545] (-511.054) * (-509.773) (-511.163) (-512.433) [-511.252] -- 0:00:14
760000 -- (-511.379) (-509.048) [-511.080] (-509.738) * [-508.731] (-509.690) (-509.132) (-510.842) -- 0:00:14
Average standard deviation of split frequencies: 0.005371
760500 -- (-508.801) (-512.141) (-511.867) [-508.920] * (-510.110) [-509.085] (-514.040) (-509.399) -- 0:00:14
761000 -- (-508.109) [-510.605] (-508.808) (-510.805) * (-510.859) (-508.727) [-512.159] (-510.562) -- 0:00:14
761500 -- (-510.811) [-510.844] (-513.931) (-509.369) * (-512.240) (-508.626) (-512.594) [-508.790] -- 0:00:14
762000 -- (-510.535) [-510.022] (-511.686) (-509.658) * (-511.821) (-511.446) [-510.019] (-511.297) -- 0:00:14
762500 -- (-508.723) (-510.115) (-511.251) [-510.485] * (-514.207) (-510.027) [-509.189] (-508.813) -- 0:00:14
763000 -- (-516.176) (-511.260) (-510.585) [-512.035] * (-510.106) [-510.109] (-511.770) (-512.124) -- 0:00:14
763500 -- (-509.718) [-508.375] (-510.183) (-510.615) * (-511.339) (-509.077) [-512.766] (-511.165) -- 0:00:14
764000 -- [-510.001] (-508.288) (-511.620) (-511.373) * (-509.809) [-509.628] (-516.985) (-511.864) -- 0:00:14
764500 -- [-513.550] (-511.731) (-513.966) (-510.744) * (-509.639) [-510.527] (-508.770) (-509.528) -- 0:00:14
765000 -- [-511.198] (-510.484) (-512.259) (-509.907) * (-509.600) [-509.632] (-509.134) (-509.774) -- 0:00:14
Average standard deviation of split frequencies: 0.005046
765500 -- (-509.121) [-509.319] (-511.270) (-511.214) * [-509.722] (-508.740) (-509.825) (-508.476) -- 0:00:14
766000 -- [-508.922] (-510.269) (-512.401) (-513.332) * [-510.216] (-509.478) (-511.567) (-510.515) -- 0:00:14
766500 -- (-510.487) (-508.762) (-510.744) [-513.762] * [-510.745] (-508.543) (-513.078) (-508.713) -- 0:00:14
767000 -- (-509.495) [-509.410] (-511.584) (-516.237) * (-510.288) (-508.311) (-510.197) [-508.946] -- 0:00:14
767500 -- (-511.459) (-509.693) (-511.883) [-510.188] * (-510.684) [-511.689] (-515.352) (-509.157) -- 0:00:14
768000 -- (-512.491) (-508.756) (-509.067) [-510.209] * [-508.148] (-515.103) (-513.739) (-509.771) -- 0:00:14
768500 -- (-511.073) (-512.815) [-509.858] (-508.989) * (-511.559) [-512.513] (-516.076) (-509.162) -- 0:00:14
769000 -- [-510.157] (-512.240) (-511.045) (-511.252) * (-510.187) (-510.216) (-511.840) [-508.893] -- 0:00:14
769500 -- (-508.645) (-511.149) (-511.987) [-510.409] * (-509.809) (-510.367) [-515.731] (-509.888) -- 0:00:14
770000 -- (-509.600) (-508.920) [-510.874] (-510.741) * (-509.813) [-509.385] (-511.818) (-509.915) -- 0:00:14
Average standard deviation of split frequencies: 0.005220
770500 -- (-509.931) (-511.131) [-513.785] (-509.296) * [-509.992] (-509.046) (-509.743) (-508.884) -- 0:00:13
771000 -- (-510.468) (-511.450) (-511.315) [-512.904] * [-510.253] (-511.877) (-509.916) (-510.026) -- 0:00:13
771500 -- (-510.187) (-512.842) [-510.479] (-513.193) * (-508.779) (-512.690) (-509.104) [-508.185] -- 0:00:13
772000 -- (-509.880) [-509.524] (-509.013) (-509.158) * (-509.869) (-510.745) [-510.727] (-509.107) -- 0:00:13
772500 -- (-509.588) (-510.685) [-513.147] (-510.157) * (-509.982) (-509.390) (-508.117) [-510.311] -- 0:00:13
773000 -- [-511.572] (-510.777) (-514.229) (-510.413) * [-509.674] (-511.114) (-509.058) (-510.046) -- 0:00:13
773500 -- (-510.809) (-515.745) [-509.772] (-511.287) * (-510.147) [-508.814] (-509.756) (-509.178) -- 0:00:13
774000 -- [-512.209] (-511.876) (-511.117) (-510.042) * (-510.610) (-512.799) (-511.345) [-509.256] -- 0:00:13
774500 -- (-511.752) (-509.636) (-512.857) [-509.033] * (-511.214) [-508.639] (-508.347) (-508.701) -- 0:00:13
775000 -- (-510.163) (-510.559) (-512.051) [-510.896] * (-510.765) [-508.949] (-509.395) (-515.180) -- 0:00:13
Average standard deviation of split frequencies: 0.005589
775500 -- (-509.035) [-511.689] (-514.029) (-512.778) * (-511.548) (-510.039) (-510.272) [-509.990] -- 0:00:13
776000 -- [-510.077] (-511.147) (-513.338) (-510.006) * (-513.758) [-510.233] (-510.584) (-509.192) -- 0:00:13
776500 -- (-510.723) (-511.304) [-508.556] (-509.952) * [-510.850] (-512.082) (-511.579) (-510.695) -- 0:00:13
777000 -- (-514.309) [-511.179] (-508.190) (-514.825) * (-511.550) [-509.153] (-509.943) (-508.605) -- 0:00:13
777500 -- (-508.903) (-509.638) [-508.199] (-508.987) * (-511.747) [-511.208] (-508.027) (-508.300) -- 0:00:13
778000 -- (-510.356) (-512.703) (-512.668) [-509.913] * (-510.478) [-514.195] (-509.393) (-509.293) -- 0:00:13
778500 -- [-509.655] (-518.226) (-511.187) (-514.008) * (-509.977) (-512.563) (-518.498) [-511.679] -- 0:00:13
779000 -- (-510.182) (-512.672) (-515.098) [-511.616] * [-508.613] (-510.642) (-511.496) (-511.478) -- 0:00:13
779500 -- (-510.348) (-513.638) (-512.322) [-508.453] * (-510.726) [-510.558] (-514.921) (-511.249) -- 0:00:13
780000 -- (-510.218) (-510.973) (-509.349) [-511.070] * [-514.583] (-510.558) (-513.490) (-510.908) -- 0:00:13
Average standard deviation of split frequencies: 0.006038
780500 -- (-509.871) (-510.052) (-508.797) [-510.161] * [-509.724] (-508.926) (-513.213) (-509.383) -- 0:00:13
781000 -- (-508.335) [-512.158] (-510.833) (-511.566) * [-514.559] (-510.903) (-511.187) (-509.146) -- 0:00:13
781500 -- [-508.246] (-512.145) (-512.411) (-513.113) * (-511.011) (-511.163) (-511.532) [-511.366] -- 0:00:13
782000 -- (-509.113) (-508.800) [-509.048] (-508.934) * (-511.107) [-510.162] (-510.264) (-510.835) -- 0:00:13
782500 -- (-511.853) (-512.457) (-511.181) [-509.604] * (-509.145) [-509.417] (-510.721) (-514.009) -- 0:00:13
783000 -- (-509.648) (-508.741) (-512.705) [-510.991] * (-508.671) (-508.398) [-512.476] (-509.861) -- 0:00:13
783500 -- [-512.548] (-508.289) (-512.126) (-508.997) * [-509.517] (-509.289) (-511.851) (-512.242) -- 0:00:13
784000 -- (-510.792) (-508.295) (-513.985) [-510.179] * (-512.492) [-510.457] (-510.718) (-512.051) -- 0:00:13
784500 -- (-510.860) (-511.853) (-511.424) [-510.245] * (-509.627) (-509.439) [-512.844] (-510.780) -- 0:00:13
785000 -- (-509.795) (-510.610) (-508.527) 