--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:56:08 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1909/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -584.32          -591.59
2       -584.35          -588.16
--------------------------------------
TOTAL     -584.33          -590.92
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.902444    0.087321    0.373170    1.496193    0.872600   1349.52   1419.59    1.001
r(A<->C){all}   0.166410    0.022252    0.000008    0.467394    0.126188    146.78    147.13    1.000
r(A<->G){all}   0.173541    0.022932    0.000103    0.486675    0.130673    148.75    168.10    1.001
r(A<->T){all}   0.159929    0.020116    0.000015    0.447352    0.121189    228.61    256.86    1.001
r(C<->G){all}   0.171668    0.020605    0.000145    0.462179    0.134398    150.95    175.14    1.000
r(C<->T){all}   0.166236    0.019283    0.000057    0.446715    0.127252    111.80    168.73    1.000
r(G<->T){all}   0.162217    0.018945    0.000008    0.451252    0.125645     75.74    120.55    1.002
pi(A){all}      0.207577    0.000373    0.170134    0.246935    0.207146   1264.80   1348.30    1.000
pi(C){all}      0.248465    0.000424    0.208130    0.288527    0.247540   1186.57   1255.88    1.000
pi(G){all}      0.330404    0.000511    0.288920    0.377016    0.330343    928.46   1192.65    1.002
pi(T){all}      0.213553    0.000402    0.175119    0.251457    0.213099   1188.33   1189.75    1.000
alpha{1,2}      0.411753    0.226594    0.000269    1.410952    0.243729   1115.08   1130.49    1.000
alpha{3}        0.472470    0.271632    0.000145    1.562550    0.292935   1143.32   1190.90    1.000
pinvar{all}     0.996261    0.000021    0.987903    0.999996    0.997642   1149.54   1248.36    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-559.333184
Model 2: PositiveSelection	-559.333146
Model 0: one-ratio	-559.333169
Model 7: beta	-559.333175
Model 8: beta&w>1	-559.333167


Model 0 vs 1	2.999999992425728E-5

Model 2 vs 1	7.599999980811845E-5

Model 8 vs 7	1.5999999959603883E-5
>C1
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C2
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C3
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C4
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C5
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C6
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=142 

C1              MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C2              MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C3              MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C4              MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C5              MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C6              MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
                **************************************************

C1              GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C2              GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C3              GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C4              GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C5              GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C6              GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
                **************************************************

C1              VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C2              VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C3              VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C4              VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C5              VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C6              VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
                ******************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [4260]--->[4260]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.465 Mb, Max= 30.674 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C2              MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C3              MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C4              MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C5              MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C6              MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
                **************************************************

C1              GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C2              GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C3              GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C4              GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C5              GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C6              GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
                **************************************************

C1              VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C2              VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C3              VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C4              VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C5              VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C6              VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
                ******************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
C2              ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
C3              ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
C4              ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
C5              ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
C6              ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
                **************************************************

C1              AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
C2              AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
C3              AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
C4              AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
C5              AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
C6              AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
                **************************************************

C1              CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
C2              CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
C3              CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
C4              CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
C5              CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
C6              CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
                **************************************************

C1              GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
C2              GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
C3              GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
C4              GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
C5              GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
C6              GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
                **************************************************

C1              CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
C2              CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
C3              CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
C4              CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
C5              CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
C6              CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
                **************************************************

C1              ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
C2              ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
C3              ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
C4              ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
C5              ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
C6              ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
                **************************************************

C1              GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
C2              GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
C3              GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
C4              GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
C5              GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
C6              GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
                **************************************************

C1              GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
C2              GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
C3              GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
C4              GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
C5              GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
C6              GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
                **************************************************

C1              GGGCTATCGCTTCAGCGAAACTGGCG
C2              GGGCTATCGCTTCAGCGAAACTGGCG
C3              GGGCTATCGCTTCAGCGAAACTGGCG
C4              GGGCTATCGCTTCAGCGAAACTGGCG
C5              GGGCTATCGCTTCAGCGAAACTGGCG
C6              GGGCTATCGCTTCAGCGAAACTGGCG
                **************************



>C1
ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
GGGCTATCGCTTCAGCGAAACTGGCG
>C2
ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
GGGCTATCGCTTCAGCGAAACTGGCG
>C3
ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
GGGCTATCGCTTCAGCGAAACTGGCG
>C4
ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
GGGCTATCGCTTCAGCGAAACTGGCG
>C5
ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
GGGCTATCGCTTCAGCGAAACTGGCG
>C6
ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
GGGCTATCGCTTCAGCGAAACTGGCG
>C1
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C2
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C3
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C4
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C5
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C6
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 426 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579859682
      Setting output file names to "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1464351786
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5105244773
      Seed = 1145501786
      Swapseed = 1579859682
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -953.408421 -- -24.965149
         Chain 2 -- -953.408421 -- -24.965149
         Chain 3 -- -953.408366 -- -24.965149
         Chain 4 -- -953.408276 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -953.408366 -- -24.965149
         Chain 2 -- -953.408421 -- -24.965149
         Chain 3 -- -953.408276 -- -24.965149
         Chain 4 -- -953.408421 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-953.408] (-953.408) (-953.408) (-953.408) * [-953.408] (-953.408) (-953.408) (-953.408) 
        500 -- (-591.268) (-598.573) [-595.875] (-591.217) * (-606.485) [-596.150] (-593.646) (-590.852) -- 0:00:00
       1000 -- (-589.213) (-598.304) [-598.479] (-593.787) * (-597.930) [-593.470] (-595.348) (-602.786) -- 0:00:00
       1500 -- (-595.755) (-595.816) (-588.457) [-599.542] * (-601.195) (-591.323) (-586.567) [-596.297] -- 0:00:00
       2000 -- (-591.078) (-594.048) (-592.039) [-593.795] * (-602.351) [-589.306] (-597.421) (-591.388) -- 0:00:00
       2500 -- (-594.882) (-592.667) [-596.576] (-599.103) * (-598.577) [-594.071] (-594.142) (-605.884) -- 0:00:00
       3000 -- (-594.050) [-589.947] (-592.204) (-594.671) * [-591.337] (-592.805) (-598.598) (-593.969) -- 0:00:00
       3500 -- (-597.219) (-596.964) (-592.708) [-596.195] * (-591.070) (-598.407) [-593.139] (-597.750) -- 0:00:00
       4000 -- (-592.037) [-594.514] (-593.431) (-602.667) * [-590.086] (-595.337) (-600.651) (-590.707) -- 0:00:00
       4500 -- [-589.775] (-592.833) (-600.873) (-593.209) * (-592.970) [-597.808] (-598.989) (-592.221) -- 0:00:00
       5000 -- [-598.368] (-591.102) (-600.610) (-602.182) * (-593.556) [-590.004] (-597.605) (-596.563) -- 0:00:00

      Average standard deviation of split frequencies: 0.088815

       5500 -- (-599.933) [-591.874] (-604.842) (-594.305) * [-599.299] (-596.556) (-593.001) (-601.195) -- 0:00:00
       6000 -- (-604.055) [-600.922] (-596.518) (-593.099) * (-597.001) (-597.933) [-592.510] (-590.047) -- 0:00:00
       6500 -- [-600.789] (-594.743) (-605.483) (-594.982) * (-592.242) (-607.407) [-590.068] (-586.517) -- 0:00:00
       7000 -- (-592.766) [-597.214] (-594.799) (-593.701) * [-596.897] (-594.259) (-595.247) (-595.183) -- 0:00:00
       7500 -- [-595.730] (-603.791) (-598.985) (-596.130) * [-593.609] (-584.266) (-593.218) (-595.946) -- 0:00:00
       8000 -- [-591.604] (-590.762) (-601.367) (-596.668) * [-589.133] (-583.262) (-589.674) (-597.428) -- 0:00:00
       8500 -- (-598.534) (-595.275) [-586.431] (-590.804) * [-590.803] (-591.161) (-591.397) (-597.436) -- 0:00:00
       9000 -- (-594.501) (-604.157) (-586.648) [-595.461] * [-593.480] (-587.281) (-596.434) (-589.755) -- 0:00:00
       9500 -- (-588.221) [-591.000] (-583.534) (-595.263) * [-594.008] (-585.574) (-596.292) (-593.087) -- 0:00:00
      10000 -- (-586.372) (-592.659) (-584.183) [-595.135] * [-593.171] (-583.626) (-593.282) (-593.325) -- 0:00:00

      Average standard deviation of split frequencies: 0.079550

      10500 -- (-585.389) [-590.456] (-590.135) (-603.113) * (-594.574) (-583.075) (-597.011) [-589.586] -- 0:00:00
      11000 -- (-584.143) (-593.172) (-587.206) [-592.278] * [-591.694] (-585.821) (-589.938) (-595.964) -- 0:00:00
      11500 -- [-584.240] (-591.028) (-586.724) (-596.219) * (-601.141) (-584.391) [-590.761] (-597.307) -- 0:00:00
      12000 -- [-583.743] (-596.467) (-585.149) (-600.672) * [-590.418] (-585.118) (-594.525) (-590.579) -- 0:00:00
      12500 -- (-583.349) [-594.470] (-584.959) (-591.167) * (-596.461) [-584.750] (-591.456) (-599.000) -- 0:00:00
      13000 -- (-583.808) [-586.484] (-584.489) (-592.107) * (-589.239) [-584.764] (-596.337) (-593.311) -- 0:00:00
      13500 -- (-585.787) (-591.043) [-589.286] (-594.094) * (-597.017) [-583.878] (-586.910) (-595.287) -- 0:00:00
      14000 -- (-585.321) (-589.949) (-585.431) [-592.479] * (-593.167) [-583.189] (-596.054) (-590.859) -- 0:01:10
      14500 -- (-583.762) [-588.770] (-582.817) (-590.206) * (-592.433) (-583.530) (-595.254) [-590.946] -- 0:01:07
      15000 -- (-585.532) [-594.030] (-587.329) (-591.251) * (-591.467) (-585.756) [-593.588] (-594.958) -- 0:01:05

      Average standard deviation of split frequencies: 0.066291

      15500 -- (-585.446) [-588.744] (-587.111) (-591.144) * (-591.700) (-584.896) [-598.833] (-593.477) -- 0:01:03
      16000 -- (-585.383) [-597.807] (-587.627) (-597.563) * (-598.223) (-584.665) [-592.437] (-595.168) -- 0:01:01
      16500 -- (-588.501) [-592.433] (-590.338) (-587.922) * [-591.456] (-586.895) (-591.293) (-594.407) -- 0:00:59
      17000 -- [-585.980] (-593.382) (-585.749) (-596.450) * (-590.058) [-586.229] (-594.257) (-589.640) -- 0:00:57
      17500 -- (-584.227) (-597.213) [-583.618] (-589.686) * (-588.896) (-585.437) [-591.943] (-591.428) -- 0:00:56
      18000 -- [-586.975] (-593.062) (-585.114) (-594.183) * (-597.564) (-585.661) (-593.253) [-590.997] -- 0:00:54
      18500 -- (-584.413) [-590.484] (-584.367) (-591.876) * (-595.912) (-593.521) (-594.113) [-590.580] -- 0:00:53
      19000 -- (-586.976) [-593.653] (-583.664) (-595.369) * (-587.715) (-587.717) [-590.837] (-596.151) -- 0:00:51
      19500 -- (-587.547) (-589.836) [-585.363] (-592.429) * (-590.116) (-587.383) [-594.411] (-594.258) -- 0:00:50
      20000 -- (-584.754) (-601.441) (-584.558) [-598.202] * (-595.477) (-591.298) (-594.454) [-590.759] -- 0:00:49

      Average standard deviation of split frequencies: 0.050689

      20500 -- [-586.109] (-590.020) (-583.768) (-593.888) * (-591.867) [-586.711] (-594.078) (-599.260) -- 0:00:47
      21000 -- [-584.642] (-599.092) (-584.324) (-595.247) * [-594.085] (-585.984) (-604.454) (-596.608) -- 0:00:46
      21500 -- (-583.370) (-600.819) [-584.480] (-599.987) * (-588.921) (-584.259) (-601.844) [-596.504] -- 0:00:45
      22000 -- (-585.715) [-593.917] (-586.331) (-599.683) * [-599.125] (-584.612) (-597.990) (-599.472) -- 0:00:44
      22500 -- [-588.051] (-597.474) (-583.024) (-594.009) * (-591.675) [-583.298] (-589.742) (-589.631) -- 0:00:43
      23000 -- (-582.948) (-594.469) [-583.982] (-589.611) * [-594.963] (-584.917) (-592.931) (-587.577) -- 0:00:42
      23500 -- [-588.143] (-596.564) (-585.181) (-595.379) * (-602.213) (-584.788) (-591.455) [-586.236] -- 0:00:41
      24000 -- (-586.994) [-592.383] (-587.559) (-594.431) * (-599.866) (-586.393) [-593.799] (-589.298) -- 0:00:40
      24500 -- [-585.000] (-593.824) (-584.175) (-600.362) * (-596.168) [-584.362] (-592.727) (-584.639) -- 0:00:39
      25000 -- (-586.166) (-595.254) (-584.549) [-591.095] * (-587.932) [-586.180] (-590.613) (-585.700) -- 0:00:39

      Average standard deviation of split frequencies: 0.037086

      25500 -- (-583.131) (-598.896) [-583.288] (-589.787) * (-596.860) [-585.047] (-593.024) (-585.116) -- 0:00:38
      26000 -- [-586.662] (-604.062) (-583.116) (-605.289) * (-593.882) [-586.340] (-610.422) (-585.043) -- 0:00:37
      26500 -- [-585.837] (-599.272) (-584.126) (-599.641) * [-591.850] (-584.209) (-597.595) (-583.149) -- 0:00:36
      27000 -- [-587.734] (-595.336) (-584.026) (-593.938) * [-593.681] (-584.109) (-610.594) (-588.556) -- 0:00:36
      27500 -- [-583.686] (-593.594) (-583.537) (-600.425) * [-591.979] (-586.489) (-595.594) (-583.571) -- 0:00:35
      28000 -- (-584.339) (-590.618) [-585.272] (-594.284) * (-594.908) (-589.930) (-586.931) [-586.788] -- 0:00:34
      28500 -- [-587.707] (-598.444) (-585.804) (-592.941) * [-590.343] (-585.118) (-583.812) (-583.603) -- 0:00:34
      29000 -- (-587.497) (-595.929) [-584.712] (-597.437) * (-604.764) (-584.679) [-583.648] (-587.671) -- 0:00:33
      29500 -- (-584.048) (-598.621) [-583.550] (-595.735) * (-594.591) [-584.495] (-584.094) (-586.867) -- 0:00:32
      30000 -- (-584.559) (-588.472) [-585.129] (-596.036) * (-593.921) (-584.948) (-586.762) [-585.374] -- 0:00:32

      Average standard deviation of split frequencies: 0.033818

      30500 -- [-584.569] (-584.826) (-585.472) (-596.070) * (-594.634) [-585.031] (-588.777) (-585.429) -- 0:01:03
      31000 -- (-585.376) [-583.601] (-584.361) (-599.993) * [-591.383] (-585.825) (-589.461) (-586.794) -- 0:01:02
      31500 -- [-583.514] (-588.146) (-584.800) (-604.060) * (-590.094) [-585.299] (-584.896) (-584.290) -- 0:01:01
      32000 -- (-589.276) [-586.559] (-586.397) (-595.934) * (-592.671) [-583.943] (-589.026) (-586.120) -- 0:01:00
      32500 -- (-588.406) [-586.263] (-584.256) (-592.183) * (-590.878) [-583.908] (-586.530) (-584.992) -- 0:00:59
      33000 -- [-586.159] (-584.518) (-584.860) (-583.877) * (-601.890) (-584.520) (-583.619) [-589.339] -- 0:00:58
      33500 -- [-586.124] (-584.994) (-583.725) (-586.833) * (-588.980) (-582.938) [-583.704] (-586.489) -- 0:00:57
      34000 -- (-584.000) (-583.587) [-586.491] (-583.916) * (-599.092) (-584.243) (-585.606) [-585.153] -- 0:00:56
      34500 -- (-587.286) (-586.249) [-585.573] (-584.491) * (-595.056) (-584.127) [-585.537] (-585.345) -- 0:00:55
      35000 -- (-583.535) (-586.304) [-585.084] (-584.126) * (-596.778) [-586.884] (-586.748) (-587.212) -- 0:00:55

      Average standard deviation of split frequencies: 0.038037

      35500 -- (-585.757) (-589.828) (-591.614) [-586.178] * (-606.139) (-586.062) [-584.670] (-584.759) -- 0:00:54
      36000 -- (-584.201) (-584.221) (-584.261) [-585.209] * (-602.770) (-585.063) (-583.425) [-583.276] -- 0:00:53
      36500 -- (-586.380) [-584.035] (-584.160) (-583.488) * [-590.966] (-584.458) (-584.093) (-584.289) -- 0:00:52
      37000 -- (-588.005) (-588.062) [-584.404] (-584.446) * (-602.724) (-590.850) [-585.622] (-585.113) -- 0:00:52
      37500 -- (-593.560) (-585.751) [-584.252] (-585.140) * (-596.226) (-590.909) (-583.209) [-584.041] -- 0:00:51
      38000 -- [-586.307] (-584.941) (-583.538) (-587.843) * (-592.564) [-584.370] (-584.973) (-584.360) -- 0:00:50
      38500 -- (-589.429) [-586.474] (-583.597) (-585.223) * (-594.070) (-585.140) [-584.052] (-584.044) -- 0:00:49
      39000 -- (-587.533) (-587.844) [-586.165] (-585.375) * [-600.483] (-584.569) (-587.131) (-585.157) -- 0:00:49
      39500 -- (-583.026) [-584.470] (-586.771) (-590.601) * [-596.975] (-586.862) (-584.654) (-583.600) -- 0:00:48
      40000 -- (-585.939) (-584.084) [-590.507] (-587.153) * (-592.373) (-584.280) [-585.319] (-584.366) -- 0:00:48

      Average standard deviation of split frequencies: 0.035996

      40500 -- (-587.673) [-582.897] (-583.770) (-586.307) * (-593.523) (-589.816) (-585.392) [-583.507] -- 0:00:47
      41000 -- (-583.186) (-583.848) [-584.130] (-583.283) * [-589.793] (-585.624) (-584.522) (-590.535) -- 0:00:46
      41500 -- [-585.044] (-586.498) (-585.724) (-583.501) * (-588.614) (-583.855) [-583.957] (-586.457) -- 0:00:46
      42000 -- (-584.619) [-585.683] (-582.706) (-584.671) * (-599.293) (-584.940) (-585.747) [-586.481] -- 0:00:45
      42500 -- [-584.596] (-587.046) (-583.740) (-583.613) * (-591.994) (-583.535) (-587.076) [-584.388] -- 0:00:45
      43000 -- (-585.375) (-588.488) [-584.806] (-583.863) * (-592.742) (-585.065) (-587.215) [-584.939] -- 0:00:44
      43500 -- (-587.025) (-584.116) [-584.811] (-591.270) * [-594.794] (-586.751) (-590.459) (-586.100) -- 0:00:43
      44000 -- (-583.187) (-586.683) [-586.801] (-587.077) * (-594.958) (-586.157) (-587.271) [-584.284] -- 0:00:43
      44500 -- (-583.186) [-586.248] (-587.757) (-585.266) * (-594.053) (-584.183) [-585.716] (-583.328) -- 0:00:42
      45000 -- [-585.605] (-584.786) (-584.734) (-585.279) * (-593.113) (-584.899) (-588.497) [-583.106] -- 0:00:42

      Average standard deviation of split frequencies: 0.038663

      45500 -- (-582.901) (-584.284) [-586.348] (-585.325) * (-596.519) [-584.321] (-588.956) (-584.118) -- 0:00:41
      46000 -- (-583.429) (-582.901) [-589.218] (-585.022) * (-594.873) [-584.683] (-585.364) (-582.775) -- 0:00:41
      46500 -- [-583.519] (-583.323) (-588.304) (-585.304) * (-589.102) [-585.981] (-585.814) (-584.118) -- 0:01:01
      47000 -- (-584.550) [-583.132] (-584.967) (-584.853) * [-600.016] (-586.729) (-587.675) (-584.628) -- 0:01:00
      47500 -- (-584.854) [-585.393] (-584.497) (-586.288) * (-597.979) (-584.198) [-584.558] (-585.221) -- 0:01:00
      48000 -- [-584.926] (-584.482) (-583.036) (-584.552) * [-593.652] (-584.019) (-584.241) (-585.844) -- 0:00:59
      48500 -- (-584.714) (-583.894) [-584.056] (-584.413) * [-592.620] (-585.769) (-584.944) (-584.612) -- 0:00:58
      49000 -- (-584.899) [-584.088] (-586.675) (-584.080) * (-597.059) [-583.794] (-585.305) (-584.271) -- 0:00:58
      49500 -- [-584.068] (-586.451) (-587.247) (-584.165) * [-596.673] (-586.876) (-583.905) (-586.491) -- 0:00:57
      50000 -- (-584.305) [-584.490] (-585.686) (-584.967) * (-600.047) (-584.231) [-584.558] (-587.396) -- 0:00:57

      Average standard deviation of split frequencies: 0.037659

      50500 -- [-584.416] (-584.806) (-583.738) (-585.374) * (-617.156) (-584.677) (-584.466) [-588.242] -- 0:00:56
      51000 -- (-583.509) (-584.410) (-584.188) [-584.285] * (-604.109) [-584.716] (-583.102) (-587.828) -- 0:00:55
      51500 -- (-585.170) (-586.735) (-584.668) [-586.841] * (-600.267) [-585.678] (-586.734) (-586.118) -- 0:00:55
      52000 -- [-588.005] (-589.166) (-584.628) (-583.555) * (-596.648) (-584.534) (-583.536) [-585.276] -- 0:00:54
      52500 -- (-585.908) (-585.237) (-586.277) [-585.194] * (-584.181) [-583.309] (-584.838) (-586.932) -- 0:00:54
      53000 -- [-585.550] (-589.952) (-584.768) (-584.483) * (-586.628) (-584.933) (-588.759) [-587.589] -- 0:00:53
      53500 -- (-583.790) (-586.347) (-585.073) [-583.432] * (-584.424) [-587.822] (-589.908) (-584.987) -- 0:00:53
      54000 -- [-583.391] (-586.584) (-584.002) (-583.956) * [-583.868] (-583.720) (-586.329) (-586.504) -- 0:00:52
      54500 -- (-583.914) (-585.382) [-584.464] (-585.763) * (-583.790) (-583.528) (-589.128) [-584.569] -- 0:00:52
      55000 -- (-588.397) (-588.222) [-584.572] (-585.497) * [-587.521] (-585.196) (-587.071) (-586.702) -- 0:00:51

      Average standard deviation of split frequencies: 0.034054

      55500 -- (-585.751) [-586.233] (-585.869) (-583.762) * (-584.834) [-583.527] (-586.009) (-585.567) -- 0:00:51
      56000 -- [-585.300] (-585.487) (-587.431) (-586.981) * (-584.774) (-584.447) [-583.625] (-586.414) -- 0:00:50
      56500 -- [-583.688] (-587.276) (-584.733) (-585.131) * (-585.253) (-583.319) (-586.267) [-584.168] -- 0:00:50
      57000 -- (-586.106) [-585.004] (-585.157) (-584.227) * (-587.811) [-588.061] (-584.405) (-584.959) -- 0:00:49
      57500 -- (-585.613) [-584.684] (-584.210) (-584.540) * (-585.905) (-584.302) (-585.308) [-584.263] -- 0:00:49
      58000 -- [-587.878] (-586.238) (-586.973) (-584.832) * [-583.290] (-583.903) (-583.753) (-585.867) -- 0:00:48
      58500 -- (-586.480) (-585.480) (-587.856) [-584.212] * (-589.149) (-584.598) (-585.068) [-585.009] -- 0:00:48
      59000 -- (-584.628) [-586.844] (-589.402) (-586.662) * [-586.011] (-584.465) (-584.694) (-585.300) -- 0:00:47
      59500 -- (-584.554) [-583.754] (-589.718) (-586.044) * (-586.118) [-583.599] (-584.061) (-587.478) -- 0:00:47
      60000 -- (-589.064) [-585.721] (-587.782) (-584.521) * (-590.008) (-584.985) [-586.073] (-586.559) -- 0:00:47

      Average standard deviation of split frequencies: 0.031452

      60500 -- (-586.338) [-586.864] (-585.031) (-584.072) * (-584.371) [-585.330] (-584.585) (-588.060) -- 0:00:46
      61000 -- [-585.036] (-586.014) (-584.473) (-585.578) * [-586.547] (-583.204) (-585.591) (-586.434) -- 0:00:46
      61500 -- (-585.796) (-584.782) [-583.068] (-584.726) * (-585.407) [-587.598] (-584.960) (-587.484) -- 0:00:45
      62000 -- (-587.167) (-584.557) (-582.847) [-589.826] * [-585.779] (-588.553) (-585.730) (-582.720) -- 0:00:45
      62500 -- (-588.980) (-583.834) [-583.887] (-584.577) * (-584.294) (-585.006) (-583.133) [-584.364] -- 0:00:45
      63000 -- (-586.032) [-583.245] (-583.896) (-584.896) * (-588.242) (-589.510) [-582.962] (-583.430) -- 0:00:44
      63500 -- (-588.902) (-583.443) [-585.803] (-587.241) * (-584.968) (-585.277) (-584.268) [-583.332] -- 0:00:58
      64000 -- (-590.040) [-582.834] (-586.737) (-583.630) * [-586.663] (-587.279) (-583.197) (-583.302) -- 0:00:58
      64500 -- (-585.656) [-582.695] (-587.091) (-586.971) * (-584.803) (-584.774) (-583.529) [-583.567] -- 0:00:58
      65000 -- (-590.749) (-582.737) (-583.869) [-583.108] * (-587.222) (-583.291) [-585.285] (-584.041) -- 0:00:57

      Average standard deviation of split frequencies: 0.029219

      65500 -- (-587.536) [-583.185] (-588.299) (-587.499) * [-582.786] (-586.704) (-584.006) (-583.130) -- 0:00:57
      66000 -- (-584.185) (-584.433) (-586.055) [-585.245] * [-584.710] (-583.513) (-583.654) (-584.796) -- 0:00:56
      66500 -- (-584.369) [-585.047] (-584.610) (-584.177) * (-583.773) [-583.519] (-584.912) (-586.200) -- 0:00:56
      67000 -- (-585.332) (-585.875) (-584.634) [-587.863] * [-585.093] (-586.107) (-586.207) (-590.279) -- 0:00:55
      67500 -- (-583.920) [-585.311] (-586.930) (-587.580) * [-587.185] (-587.707) (-583.777) (-584.716) -- 0:00:55
      68000 -- (-584.957) (-585.156) (-586.903) [-584.701] * [-587.467] (-586.271) (-584.778) (-587.523) -- 0:00:54
      68500 -- (-587.431) [-583.960] (-585.272) (-585.785) * (-583.718) (-587.094) (-584.113) [-583.833] -- 0:00:54
      69000 -- (-588.014) (-583.815) (-584.235) [-583.813] * [-583.918] (-587.280) (-585.585) (-585.862) -- 0:00:53
      69500 -- (-585.586) [-586.520] (-584.649) (-584.029) * (-584.344) [-584.840] (-584.487) (-585.260) -- 0:00:53
      70000 -- (-588.774) [-583.828] (-589.516) (-585.464) * [-583.557] (-583.196) (-585.183) (-589.320) -- 0:00:53

      Average standard deviation of split frequencies: 0.030352

      70500 -- (-590.330) (-585.019) (-586.312) [-583.643] * (-584.594) [-586.124] (-584.648) (-585.815) -- 0:00:52
      71000 -- (-584.910) (-585.177) [-583.021] (-588.762) * (-583.796) [-584.941] (-585.861) (-586.214) -- 0:00:52
      71500 -- [-586.374] (-587.583) (-583.639) (-594.784) * (-583.849) (-585.172) (-585.639) [-585.421] -- 0:00:51
      72000 -- (-585.197) (-589.172) [-584.925] (-583.942) * (-589.852) (-583.788) (-585.484) [-584.028] -- 0:00:51
      72500 -- [-583.250] (-589.488) (-583.917) (-584.043) * (-584.305) (-583.350) (-584.729) [-584.116] -- 0:00:51
      73000 -- (-587.057) (-585.733) (-584.874) [-583.508] * (-584.962) [-583.368] (-583.597) (-585.834) -- 0:00:50
      73500 -- (-586.593) (-584.284) [-585.220] (-585.101) * [-584.743] (-584.963) (-584.370) (-583.189) -- 0:00:50
      74000 -- (-583.046) [-586.785] (-584.406) (-584.710) * (-584.389) (-583.914) [-583.944] (-583.458) -- 0:00:50
      74500 -- (-582.829) (-586.424) (-588.130) [-584.953] * [-585.007] (-584.968) (-584.190) (-585.805) -- 0:00:49
      75000 -- (-584.483) (-587.830) [-584.177] (-584.928) * [-587.474] (-588.662) (-586.974) (-587.795) -- 0:00:49

      Average standard deviation of split frequencies: 0.028946

      75500 -- (-587.926) (-585.832) [-584.236] (-584.883) * (-584.087) (-586.419) [-586.793] (-586.459) -- 0:00:48
      76000 -- (-583.553) [-587.825] (-585.714) (-587.479) * (-583.035) (-585.490) [-584.388] (-586.785) -- 0:00:48
      76500 -- (-587.159) (-583.785) [-583.911] (-584.172) * [-587.296] (-584.160) (-586.253) (-587.999) -- 0:00:48
      77000 -- (-587.243) [-584.563] (-587.806) (-586.961) * (-585.150) (-587.268) [-585.582] (-587.940) -- 0:00:47
      77500 -- (-583.167) (-589.315) [-584.327] (-583.762) * (-584.209) [-586.779] (-585.038) (-585.764) -- 0:00:47
      78000 -- (-582.865) (-585.985) (-584.148) [-585.393] * (-584.116) (-585.005) (-584.315) [-588.720] -- 0:00:47
      78500 -- (-587.541) (-586.506) [-583.707] (-587.034) * [-584.345] (-585.320) (-584.395) (-585.452) -- 0:00:46
      79000 -- (-585.129) (-583.682) [-583.896] (-584.620) * (-586.447) [-584.693] (-590.213) (-586.808) -- 0:00:46
      79500 -- (-587.027) [-586.164] (-586.977) (-583.171) * [-584.645] (-586.120) (-588.294) (-584.069) -- 0:00:57
      80000 -- (-591.752) (-586.499) (-586.084) [-584.315] * (-583.551) (-583.454) (-588.353) [-583.693] -- 0:00:57

      Average standard deviation of split frequencies: 0.026829

      80500 -- (-587.423) [-585.901] (-584.731) (-587.616) * (-586.341) [-586.948] (-583.517) (-584.230) -- 0:00:57
      81000 -- [-585.272] (-584.908) (-583.831) (-584.656) * (-583.978) (-585.737) (-583.370) [-584.106] -- 0:00:56
      81500 -- (-589.703) (-590.357) [-583.437] (-590.805) * [-583.865] (-583.468) (-585.536) (-583.759) -- 0:00:56
      82000 -- (-588.522) [-585.746] (-584.147) (-586.948) * (-585.052) [-583.228] (-590.030) (-585.445) -- 0:00:55
      82500 -- (-584.772) (-585.733) (-584.209) [-585.047] * (-585.790) [-586.184] (-586.752) (-585.948) -- 0:00:55
      83000 -- (-583.826) [-583.516] (-588.954) (-585.047) * [-585.853] (-587.052) (-585.219) (-583.595) -- 0:00:55
      83500 -- [-584.901] (-584.063) (-585.085) (-583.594) * (-588.111) (-585.869) (-585.860) [-585.039] -- 0:00:54
      84000 -- (-585.163) [-583.937] (-591.448) (-583.636) * (-586.608) (-582.692) (-585.903) [-585.389] -- 0:00:54
      84500 -- (-585.925) (-584.664) (-586.855) [-583.744] * (-588.751) (-587.054) [-584.942] (-585.460) -- 0:00:54
      85000 -- (-583.420) [-587.241] (-584.445) (-586.285) * (-590.105) (-583.673) (-584.084) [-585.161] -- 0:00:53

      Average standard deviation of split frequencies: 0.025663

      85500 -- (-586.948) [-586.940] (-583.353) (-584.949) * [-584.682] (-585.309) (-585.380) (-585.378) -- 0:00:53
      86000 -- (-586.411) (-584.443) [-583.877] (-586.294) * [-588.382] (-584.220) (-586.870) (-583.712) -- 0:00:53
      86500 -- [-585.995] (-585.267) (-588.346) (-588.561) * (-588.473) (-585.455) (-586.495) [-584.534] -- 0:00:52
      87000 -- [-586.591] (-586.662) (-587.909) (-586.283) * (-587.710) (-587.724) (-585.829) [-584.277] -- 0:00:52
      87500 -- [-584.628] (-585.202) (-587.916) (-584.589) * (-588.791) (-592.604) [-584.904] (-588.082) -- 0:00:52
      88000 -- (-584.780) [-583.623] (-585.706) (-586.405) * [-584.544] (-583.183) (-588.173) (-586.045) -- 0:00:51
      88500 -- (-584.934) (-585.870) (-586.700) [-584.411] * [-588.062] (-585.265) (-586.362) (-587.834) -- 0:00:51
      89000 -- (-584.561) (-585.511) [-586.760] (-586.526) * [-587.100] (-586.503) (-588.603) (-589.855) -- 0:00:51
      89500 -- [-584.658] (-585.708) (-589.832) (-583.341) * (-586.546) [-584.601] (-584.241) (-585.349) -- 0:00:50
      90000 -- (-586.179) [-583.210] (-585.409) (-584.238) * [-586.697] (-585.901) (-586.799) (-586.697) -- 0:00:50

      Average standard deviation of split frequencies: 0.023917

      90500 -- (-588.804) (-583.287) [-585.371] (-585.762) * (-585.039) [-586.681] (-586.398) (-588.292) -- 0:00:50
      91000 -- (-587.342) (-583.832) [-584.474] (-584.032) * (-590.289) [-586.007] (-584.980) (-587.024) -- 0:00:49
      91500 -- (-585.469) (-585.222) [-582.856] (-584.785) * (-585.854) (-584.876) (-585.840) [-583.035] -- 0:00:49
      92000 -- (-584.070) (-585.334) [-587.845] (-583.388) * (-584.997) [-585.458] (-587.285) (-583.380) -- 0:00:49
      92500 -- (-586.671) (-589.100) [-591.550] (-584.701) * [-583.797] (-584.421) (-585.802) (-584.498) -- 0:00:49
      93000 -- (-585.076) (-585.066) (-585.150) [-587.779] * (-586.682) (-586.208) [-585.582] (-584.429) -- 0:00:48
      93500 -- (-588.078) (-584.419) [-588.488] (-587.711) * [-583.045] (-583.049) (-586.853) (-583.185) -- 0:00:48
      94000 -- [-583.190] (-587.148) (-585.206) (-585.725) * (-585.162) [-587.697] (-586.935) (-585.745) -- 0:00:48
      94500 -- (-585.303) (-584.889) [-584.899] (-585.115) * (-584.233) (-587.428) [-584.164] (-585.281) -- 0:00:47
      95000 -- [-585.702] (-585.247) (-586.464) (-586.824) * [-586.228] (-588.087) (-584.140) (-586.203) -- 0:00:47

      Average standard deviation of split frequencies: 0.022320

      95500 -- (-584.021) (-585.187) [-588.536] (-586.814) * [-591.192] (-588.356) (-583.780) (-589.589) -- 0:00:56
      96000 -- (-583.837) (-585.613) [-583.084] (-587.843) * [-586.385] (-584.629) (-582.901) (-588.265) -- 0:00:56
      96500 -- (-583.701) (-587.122) [-585.913] (-584.233) * (-585.383) [-584.921] (-584.418) (-585.219) -- 0:00:56
      97000 -- (-583.298) (-588.092) (-583.113) [-584.158] * (-586.311) (-585.914) (-586.040) [-589.411] -- 0:00:55
      97500 -- [-583.715] (-583.733) (-584.049) (-586.562) * (-584.129) [-584.146] (-584.399) (-589.945) -- 0:00:55
      98000 -- [-583.760] (-585.697) (-584.595) (-584.713) * (-584.769) [-584.244] (-585.242) (-585.981) -- 0:00:55
      98500 -- (-584.933) (-583.956) [-585.397] (-585.019) * (-585.849) (-590.397) [-588.960] (-585.920) -- 0:00:54
      99000 -- [-583.703] (-583.450) (-584.189) (-584.447) * [-584.097] (-585.946) (-589.318) (-587.029) -- 0:00:54
      99500 -- (-584.385) (-585.948) [-584.499] (-586.455) * (-584.276) [-583.591] (-584.090) (-587.783) -- 0:00:54
      100000 -- (-587.352) (-589.222) (-583.916) [-587.363] * [-585.721] (-584.713) (-584.358) (-588.265) -- 0:00:54

      Average standard deviation of split frequencies: 0.024053

      100500 -- (-589.421) (-583.492) [-587.708] (-583.051) * (-586.038) [-584.400] (-585.266) (-585.207) -- 0:00:53
      101000 -- [-586.403] (-583.266) (-588.654) (-584.720) * (-586.376) [-586.764] (-583.655) (-586.478) -- 0:00:53
      101500 -- (-585.936) (-583.570) [-592.159] (-585.317) * [-583.852] (-586.039) (-583.165) (-586.433) -- 0:00:53
      102000 -- (-584.003) [-584.103] (-583.896) (-585.419) * (-583.332) [-585.634] (-587.417) (-582.623) -- 0:00:52
      102500 -- (-584.667) (-583.810) [-583.554] (-583.770) * (-585.331) (-585.823) [-584.619] (-584.071) -- 0:00:52
      103000 -- (-586.091) (-586.177) (-587.048) [-584.376] * (-589.151) (-584.199) [-583.906] (-587.327) -- 0:00:52
      103500 -- (-589.152) (-583.803) [-586.682] (-584.383) * (-584.464) (-586.684) [-582.845] (-583.369) -- 0:00:51
      104000 -- [-584.675] (-586.292) (-583.157) (-583.840) * (-584.580) (-584.214) [-583.706] (-589.142) -- 0:00:51
      104500 -- (-587.389) [-586.090] (-582.980) (-584.050) * [-584.690] (-585.812) (-584.042) (-585.662) -- 0:00:51
      105000 -- (-588.509) (-586.227) [-587.788] (-587.485) * [-585.072] (-587.814) (-586.873) (-585.538) -- 0:00:51

      Average standard deviation of split frequencies: 0.022236

      105500 -- [-586.026] (-584.161) (-585.403) (-587.070) * (-583.061) (-587.607) [-584.050] (-585.865) -- 0:00:50
      106000 -- (-585.970) (-585.402) [-584.458] (-586.159) * (-584.973) (-583.817) (-584.282) [-584.159] -- 0:00:50
      106500 -- [-586.125] (-583.634) (-585.354) (-583.807) * (-586.800) (-583.128) [-586.665] (-584.016) -- 0:00:50
      107000 -- [-584.916] (-583.389) (-585.776) (-584.287) * (-585.382) (-583.411) [-588.305] (-585.264) -- 0:00:50
      107500 -- [-583.486] (-585.671) (-586.493) (-586.808) * (-585.665) (-584.233) [-586.379] (-583.993) -- 0:00:49
      108000 -- (-583.653) (-583.611) [-583.376] (-589.946) * (-592.634) (-583.452) [-585.601] (-583.468) -- 0:00:49
      108500 -- (-585.774) (-583.422) [-585.577] (-590.140) * (-588.754) (-585.612) (-585.333) [-583.884] -- 0:00:49
      109000 -- (-583.714) (-585.745) (-585.628) [-585.033] * (-584.852) (-585.250) [-583.704] (-586.333) -- 0:00:49
      109500 -- (-584.963) [-585.056] (-585.672) (-582.957) * [-584.466] (-585.618) (-584.516) (-585.511) -- 0:00:48
      110000 -- (-590.307) (-586.247) [-585.317] (-583.589) * (-583.867) (-584.517) [-584.131] (-585.194) -- 0:00:48

      Average standard deviation of split frequencies: 0.017242

      110500 -- (-586.979) [-584.833] (-586.395) (-583.453) * [-584.834] (-591.953) (-586.029) (-584.281) -- 0:00:48
      111000 -- [-589.592] (-586.527) (-589.205) (-586.146) * (-585.508) (-586.022) [-591.471] (-584.272) -- 0:00:48
      111500 -- (-583.370) (-583.978) [-586.823] (-587.488) * (-584.724) (-588.302) [-585.108] (-583.962) -- 0:00:55
      112000 -- (-583.553) [-585.937] (-583.930) (-588.632) * [-586.226] (-587.405) (-583.532) (-585.854) -- 0:00:55
      112500 -- [-583.112] (-584.970) (-584.475) (-583.981) * (-585.793) (-585.587) [-585.939] (-584.090) -- 0:00:55
      113000 -- [-586.725] (-585.671) (-585.478) (-587.707) * (-587.256) [-585.806] (-587.465) (-584.111) -- 0:00:54
      113500 -- (-586.339) [-583.520] (-583.262) (-586.888) * [-585.096] (-589.354) (-584.312) (-584.206) -- 0:00:54
      114000 -- (-585.863) (-584.433) [-586.174] (-585.922) * (-586.051) [-587.826] (-585.806) (-585.647) -- 0:00:54
      114500 -- (-586.316) (-584.222) (-583.342) [-585.968] * (-585.693) (-583.840) (-587.888) [-586.909] -- 0:00:54
      115000 -- (-584.899) (-586.513) [-584.794] (-582.888) * (-586.190) (-584.370) [-588.065] (-586.458) -- 0:00:53

      Average standard deviation of split frequencies: 0.021026

      115500 -- (-584.718) (-584.031) [-583.350] (-585.793) * (-589.493) [-584.739] (-584.798) (-586.623) -- 0:00:53
      116000 -- (-585.990) (-585.316) (-588.259) [-584.416] * (-586.553) [-584.760] (-583.725) (-585.908) -- 0:00:53
      116500 -- (-583.706) (-586.366) (-586.168) [-584.617] * (-584.599) (-585.007) (-588.298) [-584.302] -- 0:00:53
      117000 -- (-587.519) (-585.391) (-584.764) [-583.926] * (-583.968) [-583.764] (-585.603) (-584.306) -- 0:00:52
      117500 -- (-586.618) (-587.277) [-584.672] (-584.149) * [-583.129] (-584.438) (-586.768) (-584.858) -- 0:00:52
      118000 -- (-585.273) (-585.558) [-585.193] (-584.641) * (-584.552) (-585.734) [-586.282] (-587.708) -- 0:00:52
      118500 -- [-584.393] (-586.429) (-583.285) (-589.424) * (-584.466) (-585.529) (-589.937) [-584.330] -- 0:00:52
      119000 -- (-584.355) [-584.660] (-582.994) (-586.759) * (-583.337) (-583.245) [-584.458] (-584.240) -- 0:00:51
      119500 -- [-586.447] (-587.571) (-586.016) (-586.791) * (-587.766) (-589.721) (-586.137) [-586.837] -- 0:00:51
      120000 -- [-583.370] (-585.009) (-584.941) (-584.058) * (-585.926) (-586.637) (-586.161) [-585.809] -- 0:00:51

      Average standard deviation of split frequencies: 0.022907

      120500 -- (-584.933) (-584.956) [-583.702] (-583.654) * (-587.030) (-586.529) [-587.186] (-584.063) -- 0:00:51
      121000 -- (-586.185) [-584.528] (-584.230) (-584.488) * (-588.714) [-586.522] (-591.031) (-584.025) -- 0:00:50
      121500 -- [-584.338] (-586.553) (-582.712) (-583.099) * (-587.641) (-584.095) [-588.607] (-583.560) -- 0:00:50
      122000 -- [-582.938] (-584.789) (-583.458) (-586.202) * (-588.977) [-585.112] (-588.057) (-583.762) -- 0:00:50
      122500 -- [-590.572] (-589.576) (-585.467) (-587.399) * (-585.231) [-585.553] (-584.351) (-583.770) -- 0:00:50
      123000 -- (-584.665) (-585.276) [-584.598] (-585.182) * [-585.306] (-586.369) (-590.183) (-585.024) -- 0:00:49
      123500 -- (-586.492) (-587.900) (-588.437) [-583.062] * [-583.947] (-584.106) (-586.012) (-583.917) -- 0:00:49
      124000 -- (-594.545) (-584.018) (-586.581) [-583.688] * (-584.310) [-583.606] (-583.520) (-584.897) -- 0:00:49
      124500 -- (-589.239) (-585.322) (-584.065) [-589.101] * (-587.758) (-582.939) (-586.664) [-586.305] -- 0:00:49
      125000 -- [-583.498] (-584.455) (-583.959) (-587.800) * (-586.896) [-582.995] (-586.741) (-583.720) -- 0:00:49

      Average standard deviation of split frequencies: 0.022285

      125500 -- (-582.851) [-584.354] (-585.977) (-587.762) * [-584.371] (-586.288) (-582.964) (-587.855) -- 0:00:48
      126000 -- (-589.533) (-587.348) [-584.281] (-588.043) * (-584.873) (-584.495) [-587.995] (-586.756) -- 0:00:48
      126500 -- (-585.120) (-587.012) (-585.138) [-589.032] * (-585.086) [-585.552] (-589.293) (-584.257) -- 0:00:48
      127000 -- (-584.327) [-588.553] (-585.191) (-584.539) * [-587.618] (-584.458) (-586.333) (-584.766) -- 0:00:48
      127500 -- (-586.299) (-587.286) (-585.496) [-585.132] * [-583.881] (-583.183) (-584.227) (-586.409) -- 0:00:47
      128000 -- [-584.255] (-585.661) (-587.080) (-586.203) * (-584.284) (-582.851) (-588.010) [-586.678] -- 0:00:54
      128500 -- (-583.830) [-586.918] (-588.102) (-586.531) * (-586.178) (-586.225) (-587.166) [-585.534] -- 0:00:54
      129000 -- [-586.865] (-588.621) (-585.305) (-585.634) * [-583.930] (-586.178) (-585.436) (-586.754) -- 0:00:54
      129500 -- (-583.594) (-583.575) [-583.646] (-583.075) * [-583.469] (-584.081) (-585.778) (-583.756) -- 0:00:53
      130000 -- [-587.029] (-585.099) (-583.270) (-587.164) * (-583.030) (-585.940) [-583.908] (-591.826) -- 0:00:53

      Average standard deviation of split frequencies: 0.021646

      130500 -- (-582.989) (-586.565) (-588.611) [-591.881] * [-584.028] (-589.038) (-586.413) (-590.784) -- 0:00:53
      131000 -- (-583.186) (-583.912) (-588.193) [-583.287] * (-583.134) (-587.845) [-585.534] (-586.454) -- 0:00:53
      131500 -- (-584.163) (-583.348) (-588.886) [-582.943] * (-584.345) [-585.441] (-584.045) (-584.006) -- 0:00:52
      132000 -- (-584.190) (-586.449) [-584.825] (-584.031) * (-586.733) [-583.490] (-584.162) (-586.693) -- 0:00:52
      132500 -- [-584.577] (-584.800) (-584.917) (-586.428) * (-585.068) (-586.780) (-587.863) [-586.979] -- 0:00:52
      133000 -- (-584.514) [-584.169] (-583.712) (-584.881) * (-584.974) (-585.096) [-585.986] (-585.425) -- 0:00:52
      133500 -- (-587.054) [-586.185] (-583.758) (-585.570) * (-585.727) (-588.598) [-583.620] (-587.831) -- 0:00:51
      134000 -- (-584.650) [-589.828] (-583.800) (-587.429) * (-583.988) (-593.507) [-586.619] (-585.814) -- 0:00:51
      134500 -- [-585.269] (-584.346) (-583.804) (-584.274) * [-588.233] (-584.692) (-584.533) (-586.231) -- 0:00:51
      135000 -- [-588.590] (-585.085) (-583.509) (-586.544) * (-586.636) (-590.406) (-585.813) [-583.179] -- 0:00:51

      Average standard deviation of split frequencies: 0.020009

      135500 -- [-584.112] (-586.071) (-584.078) (-586.681) * [-584.418] (-583.601) (-588.227) (-592.761) -- 0:00:51
      136000 -- (-584.182) [-585.394] (-583.642) (-583.581) * (-583.363) (-585.320) (-583.962) [-584.477] -- 0:00:50
      136500 -- (-587.210) (-584.097) [-583.740] (-586.307) * [-584.203] (-586.422) (-584.715) (-583.941) -- 0:00:50
      137000 -- (-587.702) [-584.316] (-584.671) (-589.453) * (-582.877) [-584.832] (-585.454) (-583.782) -- 0:00:50
      137500 -- (-585.631) (-585.444) [-585.291] (-586.720) * (-584.012) (-584.002) [-587.494] (-589.707) -- 0:00:50
      138000 -- [-584.293] (-583.220) (-589.294) (-585.272) * (-584.361) [-583.407] (-586.121) (-584.881) -- 0:00:49
      138500 -- [-583.145] (-584.051) (-584.766) (-585.537) * (-583.605) (-584.625) (-587.503) [-584.067] -- 0:00:49
      139000 -- (-586.021) (-584.267) (-586.143) [-586.057] * (-583.607) (-588.135) (-589.207) [-584.730] -- 0:00:49
      139500 -- (-585.659) [-583.094] (-588.294) (-583.504) * [-585.109] (-587.600) (-589.695) (-584.554) -- 0:00:49
      140000 -- [-585.406] (-583.854) (-585.165) (-584.511) * [-584.832] (-584.199) (-589.857) (-585.589) -- 0:00:49

      Average standard deviation of split frequencies: 0.017594

      140500 -- (-583.494) (-583.746) [-587.576] (-583.943) * [-585.764] (-584.928) (-586.148) (-583.311) -- 0:00:48
      141000 -- (-583.134) (-584.997) (-584.949) [-583.392] * (-585.848) (-588.837) [-585.799] (-585.383) -- 0:00:48
      141500 -- [-583.409] (-586.705) (-586.971) (-585.134) * (-584.829) (-583.537) [-583.957] (-585.840) -- 0:00:48
      142000 -- (-586.327) (-585.253) [-583.327] (-584.603) * (-582.946) [-586.743] (-583.939) (-584.249) -- 0:00:48
      142500 -- (-584.332) (-585.682) (-584.957) [-584.202] * (-585.971) (-583.914) [-585.906] (-585.717) -- 0:00:48
      143000 -- [-585.163] (-588.024) (-583.459) (-583.336) * (-586.148) (-587.111) (-585.741) [-583.703] -- 0:00:47
      143500 -- (-583.804) (-584.303) (-585.762) [-583.098] * (-584.008) (-587.917) [-586.445] (-584.309) -- 0:00:47
      144000 -- (-586.235) (-583.833) (-587.108) [-586.024] * (-583.393) (-587.857) (-583.947) [-586.371] -- 0:00:47
      144500 -- (-584.134) (-583.712) (-583.685) [-584.961] * [-583.563] (-584.637) (-584.175) (-588.237) -- 0:00:53
      145000 -- (-584.342) (-584.002) [-586.182] (-584.349) * [-584.768] (-585.565) (-585.056) (-583.032) -- 0:00:53

      Average standard deviation of split frequencies: 0.017612

      145500 -- [-584.188] (-588.677) (-583.293) (-585.969) * (-583.733) [-583.533] (-586.346) (-584.432) -- 0:00:52
      146000 -- (-583.937) (-585.717) (-588.354) [-585.951] * [-584.370] (-583.159) (-585.766) (-585.326) -- 0:00:52
      146500 -- (-586.875) (-585.648) [-588.339] (-585.857) * (-584.198) (-584.277) [-584.261] (-583.706) -- 0:00:52
      147000 -- (-587.991) (-587.935) (-586.768) [-590.376] * (-585.519) (-593.703) (-585.760) [-584.146] -- 0:00:52
      147500 -- (-585.117) (-584.760) (-590.552) [-583.917] * (-583.318) [-586.104] (-583.436) (-582.713) -- 0:00:52
      148000 -- (-583.291) (-584.023) (-583.946) [-584.138] * (-583.022) [-584.107] (-585.035) (-583.664) -- 0:00:51
      148500 -- (-587.975) (-587.533) (-585.757) [-586.138] * (-589.719) [-585.361] (-585.390) (-589.286) -- 0:00:51
      149000 -- [-588.158] (-584.596) (-585.064) (-589.179) * (-584.705) (-585.978) (-586.089) [-583.921] -- 0:00:51
      149500 -- (-586.138) (-584.052) [-582.758] (-584.891) * (-584.049) (-584.472) [-588.175] (-586.898) -- 0:00:51
      150000 -- (-585.563) [-584.188] (-582.858) (-583.313) * (-584.652) [-588.910] (-585.493) (-589.595) -- 0:00:51

      Average standard deviation of split frequencies: 0.018773

      150500 -- (-584.519) (-585.167) (-583.390) [-585.445] * [-584.134] (-587.384) (-585.506) (-587.042) -- 0:00:50
      151000 -- (-583.212) [-585.341] (-583.005) (-585.501) * (-588.014) (-583.279) (-583.847) [-584.554] -- 0:00:50
      151500 -- (-586.952) (-586.316) [-583.719] (-585.363) * (-589.078) (-584.119) [-583.393] (-583.697) -- 0:00:50
      152000 -- (-586.733) (-583.334) [-584.277] (-585.503) * (-585.049) [-584.573] (-583.073) (-584.130) -- 0:00:50
      152500 -- (-587.029) (-585.463) (-585.796) [-584.611] * (-587.804) (-586.916) (-589.066) [-585.533] -- 0:00:50
      153000 -- (-583.156) (-585.115) [-585.954] (-591.547) * [-585.387] (-585.526) (-589.922) (-588.182) -- 0:00:49
      153500 -- (-583.001) [-585.342] (-586.355) (-586.333) * (-587.911) (-584.110) [-584.603] (-586.559) -- 0:00:49
      154000 -- (-583.972) [-585.282] (-584.691) (-584.433) * (-585.668) (-588.446) [-584.562] (-585.447) -- 0:00:49
      154500 -- (-584.122) (-586.214) (-585.425) [-585.210] * [-584.528] (-585.072) (-584.670) (-583.136) -- 0:00:49
      155000 -- (-589.435) (-586.845) (-586.295) [-583.926] * [-583.003] (-587.030) (-583.725) (-586.209) -- 0:00:49

      Average standard deviation of split frequencies: 0.019721

      155500 -- (-585.998) [-583.723] (-585.665) (-587.986) * (-583.831) (-592.401) [-588.724] (-585.277) -- 0:00:48
      156000 -- [-585.253] (-583.459) (-585.025) (-584.431) * [-585.944] (-588.272) (-583.286) (-585.392) -- 0:00:48
      156500 -- [-584.741] (-584.772) (-587.303) (-587.458) * (-587.483) [-584.163] (-584.938) (-583.593) -- 0:00:48
      157000 -- (-583.903) (-585.686) (-584.496) [-590.101] * [-588.379] (-584.298) (-585.163) (-583.380) -- 0:00:48
      157500 -- (-585.952) (-585.107) (-587.900) [-585.871] * (-585.071) (-586.301) [-583.548] (-585.279) -- 0:00:48
      158000 -- (-583.048) (-583.081) [-585.264] (-584.635) * (-583.547) (-592.517) (-584.419) [-584.986] -- 0:00:47
      158500 -- (-583.892) (-583.817) [-585.462] (-586.910) * (-583.681) (-588.659) (-586.043) [-584.891] -- 0:00:47
      159000 -- [-583.496] (-583.812) (-582.951) (-589.283) * (-588.319) (-585.608) [-586.265] (-584.812) -- 0:00:47
      159500 -- [-583.263] (-591.063) (-585.439) (-589.626) * (-586.676) [-587.549] (-584.130) (-583.969) -- 0:00:47
      160000 -- (-583.884) (-587.195) [-583.846] (-584.333) * (-586.310) [-586.265] (-585.388) (-584.936) -- 0:00:47

      Average standard deviation of split frequencies: 0.019612

      160500 -- [-583.144] (-583.740) (-583.461) (-586.948) * (-584.223) [-585.443] (-585.927) (-583.920) -- 0:00:47
      161000 -- (-582.802) (-585.176) [-583.675] (-585.093) * (-583.745) (-585.116) [-583.688] (-584.861) -- 0:00:52
      161500 -- (-583.796) [-585.900] (-582.918) (-586.825) * (-589.030) [-585.084] (-582.683) (-586.679) -- 0:00:51
      162000 -- (-584.362) (-586.680) (-587.763) [-587.807] * (-586.858) (-588.759) (-586.725) [-584.700] -- 0:00:51
      162500 -- (-584.415) (-584.272) [-583.728] (-586.716) * (-584.637) (-587.823) [-584.050] (-583.614) -- 0:00:51
      163000 -- [-583.187] (-584.944) (-586.757) (-588.473) * (-586.335) [-584.660] (-586.300) (-583.894) -- 0:00:51
      163500 -- [-584.673] (-583.773) (-583.381) (-584.323) * (-585.805) (-583.488) (-583.674) [-584.348] -- 0:00:51
      164000 -- (-586.041) [-586.883] (-585.725) (-584.384) * (-586.082) [-586.022] (-585.945) (-584.483) -- 0:00:50
      164500 -- [-585.359] (-584.990) (-583.383) (-584.366) * (-585.400) (-584.522) [-587.527] (-583.327) -- 0:00:50
      165000 -- (-585.808) (-583.129) (-584.736) [-583.312] * (-583.836) [-584.687] (-586.604) (-584.807) -- 0:00:50

      Average standard deviation of split frequencies: 0.018982

      165500 -- [-585.984] (-588.351) (-587.792) (-585.252) * [-585.724] (-585.387) (-584.576) (-584.503) -- 0:00:50
      166000 -- (-583.246) (-585.472) (-585.892) [-587.578] * (-583.501) [-585.370] (-584.262) (-587.674) -- 0:00:50
      166500 -- (-583.179) (-584.984) [-584.275] (-584.639) * [-583.229] (-584.065) (-583.620) (-584.417) -- 0:00:50
      167000 -- [-584.144] (-590.552) (-583.420) (-584.684) * (-584.751) [-585.313] (-584.500) (-584.210) -- 0:00:49
      167500 -- [-587.639] (-584.816) (-584.124) (-585.405) * (-584.324) [-591.354] (-584.792) (-585.435) -- 0:00:49
      168000 -- (-586.568) (-587.717) (-584.408) [-585.063] * (-584.229) [-587.164] (-584.495) (-586.481) -- 0:00:49
      168500 -- [-584.040] (-586.229) (-583.514) (-584.269) * (-583.570) (-586.826) [-584.602] (-585.949) -- 0:00:49
      169000 -- (-589.141) [-584.863] (-584.418) (-584.416) * (-583.918) (-590.133) [-587.482] (-586.820) -- 0:00:49
      169500 -- [-586.940] (-584.718) (-583.873) (-584.795) * [-584.549] (-586.218) (-587.909) (-585.689) -- 0:00:48
      170000 -- (-584.484) (-583.561) (-585.568) [-586.633] * (-584.033) [-583.454] (-583.871) (-585.280) -- 0:00:48

      Average standard deviation of split frequencies: 0.018092

      170500 -- (-584.076) (-584.278) (-585.009) [-584.109] * (-584.719) (-584.305) (-586.929) [-584.777] -- 0:00:48
      171000 -- [-585.112] (-584.773) (-582.838) (-587.909) * (-585.149) [-585.647] (-585.384) (-588.666) -- 0:00:48
      171500 -- (-586.619) (-584.990) [-584.072] (-583.870) * [-584.788] (-584.355) (-587.337) (-586.103) -- 0:00:48
      172000 -- (-587.361) (-586.846) (-585.671) [-586.174] * (-584.567) [-584.141] (-585.350) (-589.747) -- 0:00:48
      172500 -- (-584.569) (-585.043) (-585.972) [-585.705] * (-584.515) (-583.701) [-588.103] (-589.664) -- 0:00:47
      173000 -- (-584.133) [-585.508] (-584.380) (-583.201) * [-583.247] (-585.245) (-584.415) (-584.559) -- 0:00:47
      173500 -- [-586.289] (-583.885) (-584.945) (-583.856) * (-583.723) [-584.720] (-587.147) (-583.990) -- 0:00:47
      174000 -- (-586.351) (-584.076) (-594.533) [-585.844] * (-583.477) [-585.961] (-583.994) (-583.470) -- 0:00:47
      174500 -- [-586.180] (-583.622) (-587.403) (-583.894) * (-585.274) [-583.880] (-583.574) (-583.512) -- 0:00:47
      175000 -- (-585.876) (-589.524) [-583.734] (-584.902) * (-586.343) [-584.750] (-586.238) (-587.852) -- 0:00:47

      Average standard deviation of split frequencies: 0.016071

      175500 -- (-585.490) (-588.229) (-585.292) [-584.280] * [-584.532] (-587.241) (-585.404) (-587.349) -- 0:00:46
      176000 -- (-587.576) (-586.749) (-590.636) [-583.141] * (-586.424) [-586.239] (-583.895) (-592.451) -- 0:00:46
      176500 -- (-588.411) (-586.462) (-585.686) [-582.823] * [-585.373] (-584.009) (-589.728) (-585.654) -- 0:00:46
      177000 -- (-583.486) [-584.884] (-583.783) (-584.620) * (-583.888) [-584.788] (-583.809) (-584.521) -- 0:00:51
      177500 -- (-583.211) (-586.350) [-586.998] (-585.685) * (-584.603) (-583.504) (-584.573) [-584.126] -- 0:00:50
      178000 -- [-585.351] (-583.886) (-586.152) (-583.903) * (-583.306) (-584.732) [-583.210] (-586.592) -- 0:00:50
      178500 -- [-583.372] (-583.699) (-588.737) (-583.713) * (-586.307) [-586.531] (-588.205) (-591.344) -- 0:00:50
      179000 -- [-584.240] (-585.323) (-591.748) (-584.516) * (-587.171) (-583.897) (-587.034) [-585.087] -- 0:00:50
      179500 -- [-585.411] (-584.699) (-590.226) (-585.754) * [-584.478] (-585.665) (-586.868) (-586.136) -- 0:00:50
      180000 -- (-584.709) (-585.360) (-586.247) [-587.150] * (-587.422) [-583.911] (-587.968) (-584.991) -- 0:00:50

      Average standard deviation of split frequencies: 0.015945

      180500 -- (-586.499) (-587.007) (-583.420) [-585.085] * (-585.576) (-583.591) [-588.154] (-584.658) -- 0:00:49
      181000 -- (-585.308) (-585.407) (-583.751) [-585.612] * (-586.669) [-585.480] (-589.189) (-587.291) -- 0:00:49
      181500 -- [-585.726] (-588.994) (-586.535) (-584.001) * (-588.408) (-584.849) (-587.985) [-584.593] -- 0:00:49
      182000 -- (-585.545) (-584.994) (-585.434) [-584.390] * [-586.364] (-585.295) (-586.864) (-583.289) -- 0:00:49
      182500 -- (-586.765) [-583.505] (-583.461) (-585.975) * (-584.867) (-586.360) [-583.748] (-584.477) -- 0:00:49
      183000 -- (-584.292) [-583.874] (-584.583) (-584.548) * (-588.394) (-587.701) (-588.632) [-583.430] -- 0:00:49
      183500 -- [-584.280] (-586.010) (-584.545) (-597.944) * [-584.078] (-587.817) (-586.171) (-587.697) -- 0:00:48
      184000 -- (-583.642) (-585.322) [-585.172] (-585.266) * (-585.544) (-586.385) [-585.382] (-584.568) -- 0:00:48
      184500 -- (-585.121) [-585.388] (-588.541) (-587.667) * (-588.667) (-584.096) (-587.641) [-584.618] -- 0:00:48
      185000 -- (-584.548) [-587.128] (-586.672) (-584.775) * (-586.334) (-585.110) [-585.235] (-583.839) -- 0:00:48

      Average standard deviation of split frequencies: 0.017234

      185500 -- (-583.957) (-584.035) [-582.993] (-584.848) * (-586.187) (-584.517) [-586.245] (-588.742) -- 0:00:48
      186000 -- (-583.813) [-583.794] (-582.988) (-587.844) * (-586.069) [-584.094] (-584.596) (-583.920) -- 0:00:48
      186500 -- (-587.170) (-583.270) [-583.361] (-584.226) * (-585.250) [-586.150] (-584.808) (-587.922) -- 0:00:47
      187000 -- (-583.814) (-585.730) (-584.953) [-584.289] * (-587.522) (-585.865) (-584.340) [-585.912] -- 0:00:47
      187500 -- [-584.609] (-583.919) (-585.725) (-588.004) * (-585.431) (-584.677) (-584.130) [-585.408] -- 0:00:47
      188000 -- [-583.902] (-586.619) (-585.773) (-588.266) * (-584.045) [-585.597] (-584.534) (-585.774) -- 0:00:47
      188500 -- (-582.855) [-583.874] (-585.217) (-589.761) * [-583.761] (-585.760) (-587.969) (-587.546) -- 0:00:47
      189000 -- [-584.002] (-585.292) (-585.052) (-591.884) * [-583.086] (-585.497) (-585.149) (-588.239) -- 0:00:47
      189500 -- [-586.563] (-590.686) (-586.860) (-593.880) * (-584.575) [-583.230] (-584.358) (-591.916) -- 0:00:47
      190000 -- [-585.862] (-592.935) (-585.159) (-587.986) * (-584.063) (-585.939) (-584.300) [-586.260] -- 0:00:46

      Average standard deviation of split frequencies: 0.016266

      190500 -- (-586.989) (-585.089) (-586.999) [-584.391] * (-583.243) (-585.361) [-584.585] (-586.923) -- 0:00:46
      191000 -- (-586.995) (-587.751) (-585.244) [-584.558] * (-586.404) (-584.535) (-593.091) [-584.945] -- 0:00:46
      191500 -- (-587.318) [-584.155] (-584.196) (-586.592) * (-587.220) (-583.674) (-591.415) [-585.245] -- 0:00:46
      192000 -- (-585.136) (-588.971) (-584.489) [-582.994] * (-585.930) [-583.492] (-587.394) (-586.323) -- 0:00:46
      192500 -- [-583.350] (-587.644) (-586.630) (-583.554) * (-582.896) (-583.698) [-586.234] (-586.102) -- 0:00:46
      193000 -- (-584.004) (-584.785) (-587.614) [-582.988] * (-585.121) (-586.554) [-588.027] (-586.723) -- 0:00:45
      193500 -- (-583.558) [-584.828] (-592.179) (-585.537) * (-584.302) (-584.893) (-584.185) [-589.436] -- 0:00:50
      194000 -- (-583.906) [-585.674] (-586.431) (-589.562) * (-584.760) (-584.517) [-586.171] (-584.430) -- 0:00:49
      194500 -- [-584.290] (-585.522) (-585.952) (-587.243) * [-585.712] (-588.395) (-585.701) (-583.137) -- 0:00:49
      195000 -- [-583.861] (-585.218) (-586.395) (-590.611) * (-586.190) (-587.134) (-584.536) [-584.397] -- 0:00:49

      Average standard deviation of split frequencies: 0.016969

      195500 -- (-584.511) (-583.607) [-585.736] (-584.807) * (-584.591) [-584.234] (-585.098) (-583.080) -- 0:00:49
      196000 -- (-583.642) [-584.116] (-586.305) (-587.778) * [-587.171] (-583.397) (-585.562) (-583.666) -- 0:00:49
      196500 -- (-586.048) (-583.554) (-583.310) [-587.055] * (-584.699) (-587.697) [-583.055] (-588.600) -- 0:00:49
      197000 -- [-584.068] (-586.123) (-584.776) (-584.133) * (-585.644) [-585.272] (-583.061) (-585.727) -- 0:00:48
      197500 -- (-585.600) (-583.270) (-584.564) [-588.148] * (-583.615) (-583.346) (-583.960) [-583.986] -- 0:00:48
      198000 -- (-583.104) (-583.459) [-587.985] (-588.484) * (-585.018) (-584.201) (-587.669) [-583.503] -- 0:00:48
      198500 -- (-582.894) (-586.491) [-584.122] (-586.236) * (-585.058) (-584.458) [-583.412] (-585.107) -- 0:00:48
      199000 -- [-584.108] (-589.541) (-583.669) (-586.432) * [-583.141] (-585.975) (-585.202) (-584.457) -- 0:00:48
      199500 -- [-584.669] (-588.435) (-586.863) (-589.800) * [-583.101] (-589.536) (-583.640) (-585.260) -- 0:00:48
      200000 -- (-587.615) (-589.374) (-584.654) [-585.482] * [-583.896] (-586.835) (-584.719) (-585.339) -- 0:00:48

      Average standard deviation of split frequencies: 0.015615

      200500 -- (-586.969) [-585.999] (-588.894) (-586.476) * (-584.064) (-586.599) [-584.228] (-584.816) -- 0:00:47
      201000 -- (-586.799) [-583.367] (-588.352) (-590.282) * (-589.047) [-585.253] (-587.744) (-584.680) -- 0:00:47
      201500 -- (-585.430) [-583.519] (-584.727) (-585.942) * [-586.683] (-584.186) (-585.523) (-593.520) -- 0:00:47
      202000 -- (-584.757) [-587.045] (-586.093) (-588.069) * (-588.410) [-583.707] (-583.844) (-588.417) -- 0:00:47
      202500 -- (-584.724) (-589.725) (-585.683) [-584.834] * (-596.103) (-583.815) (-585.268) [-585.314] -- 0:00:47
      203000 -- (-588.728) [-583.693] (-586.976) (-587.445) * (-585.581) (-586.297) (-584.280) [-585.232] -- 0:00:47
      203500 -- [-584.958] (-584.132) (-583.939) (-590.758) * (-584.582) (-587.572) [-584.007] (-595.594) -- 0:00:46
      204000 -- [-582.821] (-584.039) (-583.743) (-585.185) * (-584.274) (-588.171) [-583.277] (-585.661) -- 0:00:46
      204500 -- (-582.739) (-586.735) [-586.214] (-584.279) * [-583.554] (-590.606) (-584.261) (-585.116) -- 0:00:46
      205000 -- (-586.185) (-583.688) [-582.735] (-585.613) * (-585.203) (-589.475) (-586.865) [-587.238] -- 0:00:46

      Average standard deviation of split frequencies: 0.014366

      205500 -- (-586.864) (-589.038) (-584.884) [-583.430] * [-585.679] (-587.623) (-587.268) (-588.364) -- 0:00:46
      206000 -- (-587.862) [-583.001] (-589.957) (-585.474) * (-584.350) (-585.142) [-587.125] (-586.022) -- 0:00:46
      206500 -- [-586.609] (-584.223) (-586.088) (-587.042) * (-585.256) (-584.669) [-584.327] (-590.642) -- 0:00:46
      207000 -- (-584.718) (-585.600) [-588.063] (-586.813) * (-586.966) (-586.116) (-583.983) [-583.091] -- 0:00:45
      207500 -- (-584.506) (-584.826) (-584.608) [-586.246] * (-587.040) (-588.025) [-583.957] (-584.128) -- 0:00:45
      208000 -- (-584.822) (-585.257) [-584.143] (-588.411) * [-586.011] (-584.330) (-584.035) (-583.991) -- 0:00:45
      208500 -- (-585.023) [-585.185] (-587.438) (-585.841) * (-584.074) (-584.655) (-586.468) [-586.362] -- 0:00:45
      209000 -- [-582.857] (-586.828) (-586.344) (-587.336) * (-584.689) [-583.961] (-588.831) (-584.157) -- 0:00:45
      209500 -- [-583.001] (-586.640) (-589.500) (-588.310) * (-585.143) (-586.212) (-585.534) [-584.817] -- 0:00:45
      210000 -- (-585.194) (-588.010) [-584.780] (-586.955) * (-594.149) (-587.421) (-585.915) [-584.386] -- 0:00:48

      Average standard deviation of split frequencies: 0.013294

      210500 -- (-583.300) (-587.539) (-590.910) [-584.337] * [-585.832] (-587.895) (-584.368) (-589.743) -- 0:00:48
      211000 -- (-584.810) (-586.579) (-586.525) [-585.624] * (-587.572) (-586.840) [-583.597] (-587.744) -- 0:00:48
      211500 -- (-587.872) (-583.894) (-585.364) [-585.471] * [-586.572] (-589.480) (-586.281) (-586.741) -- 0:00:48
      212000 -- (-584.088) [-585.335] (-583.513) (-584.253) * [-583.805] (-586.378) (-587.437) (-589.295) -- 0:00:48
      212500 -- (-586.107) [-584.612] (-583.856) (-584.667) * (-583.905) (-584.543) (-587.608) [-585.221] -- 0:00:48
      213000 -- (-588.229) [-585.936] (-585.687) (-584.623) * (-591.091) [-583.825] (-586.637) (-582.882) -- 0:00:48
      213500 -- (-591.224) (-585.886) [-584.594] (-586.287) * (-584.025) (-584.058) (-584.507) [-583.751] -- 0:00:47
      214000 -- [-588.356] (-587.656) (-591.889) (-584.293) * [-583.303] (-583.434) (-584.984) (-585.507) -- 0:00:47
      214500 -- [-585.687] (-584.336) (-587.028) (-584.528) * (-584.214) (-584.995) [-584.170] (-585.388) -- 0:00:47
      215000 -- (-584.820) (-583.501) [-583.215] (-584.910) * [-585.614] (-583.737) (-586.537) (-591.523) -- 0:00:47

      Average standard deviation of split frequencies: 0.011731

      215500 -- (-588.689) (-586.183) [-585.354] (-588.991) * [-585.582] (-586.086) (-586.740) (-589.528) -- 0:00:47
      216000 -- (-585.321) [-585.225] (-586.360) (-586.598) * [-584.960] (-583.887) (-588.888) (-586.574) -- 0:00:47
      216500 -- [-588.186] (-586.423) (-584.482) (-585.518) * (-584.316) [-584.862] (-586.250) (-585.497) -- 0:00:47
      217000 -- [-584.030] (-585.305) (-586.888) (-585.850) * (-587.171) (-585.819) (-585.013) [-587.217] -- 0:00:46
      217500 -- (-585.441) [-587.285] (-588.167) (-586.753) * [-586.701] (-587.094) (-585.086) (-587.523) -- 0:00:46
      218000 -- [-587.490] (-586.484) (-586.278) (-585.808) * [-588.995] (-584.223) (-584.058) (-584.775) -- 0:00:46
      218500 -- (-586.346) [-585.018] (-585.176) (-586.729) * (-584.645) [-584.247] (-583.968) (-590.246) -- 0:00:46
      219000 -- (-585.569) (-584.891) (-584.480) [-585.573] * (-584.598) (-584.212) [-586.256] (-588.236) -- 0:00:46
      219500 -- (-587.663) [-586.353] (-585.557) (-584.787) * [-585.035] (-586.609) (-587.916) (-588.359) -- 0:00:46
      220000 -- (-587.924) (-587.113) (-584.091) [-586.339] * [-585.442] (-587.427) (-583.415) (-586.691) -- 0:00:46

      Average standard deviation of split frequencies: 0.012284

      220500 -- (-584.223) [-587.006] (-584.209) (-583.093) * [-587.937] (-583.635) (-582.951) (-583.809) -- 0:00:45
      221000 -- (-584.134) [-586.432] (-583.257) (-583.822) * [-589.041] (-585.394) (-583.931) (-582.835) -- 0:00:45
      221500 -- (-586.348) [-585.686] (-583.247) (-586.448) * [-587.050] (-588.813) (-583.736) (-585.942) -- 0:00:45
      222000 -- (-585.602) (-587.957) (-585.417) [-585.975] * (-587.219) (-584.615) (-582.967) [-584.452] -- 0:00:45
      222500 -- (-583.879) (-584.396) (-583.438) [-588.123] * (-589.744) [-584.166] (-586.872) (-585.124) -- 0:00:45
      223000 -- [-583.699] (-586.264) (-589.242) (-584.445) * (-590.593) [-583.775] (-583.079) (-586.828) -- 0:00:45
      223500 -- [-583.596] (-585.112) (-586.729) (-584.254) * (-583.763) (-583.842) [-586.111] (-586.302) -- 0:00:45
      224000 -- (-583.328) [-583.312] (-587.156) (-584.081) * (-586.509) [-587.284] (-584.714) (-586.005) -- 0:00:45
      224500 -- [-585.545] (-585.491) (-585.103) (-585.513) * [-584.878] (-587.722) (-585.724) (-584.681) -- 0:00:44
      225000 -- (-584.861) (-585.034) [-585.494] (-583.267) * (-584.998) (-584.635) (-589.876) [-583.990] -- 0:00:44

      Average standard deviation of split frequencies: 0.013674

      225500 -- (-585.227) [-584.888] (-583.881) (-585.193) * (-590.818) (-583.988) [-586.798] (-586.524) -- 0:00:44
      226000 -- (-586.132) (-583.222) (-585.063) [-584.246] * [-584.380] (-584.842) (-591.249) (-586.294) -- 0:00:44
      226500 -- (-584.255) (-584.492) [-587.905] (-583.708) * (-584.322) [-585.547] (-587.214) (-584.436) -- 0:00:47
      227000 -- (-586.649) [-584.360] (-584.822) (-584.948) * (-583.290) (-588.411) [-584.049] (-586.243) -- 0:00:47
      227500 -- (-590.319) (-585.828) [-585.485] (-585.451) * (-585.532) (-583.333) (-584.018) [-585.515] -- 0:00:47
      228000 -- [-584.052] (-584.959) (-585.684) (-585.999) * (-585.728) (-583.505) (-585.987) [-583.579] -- 0:00:47
      228500 -- (-587.804) [-584.901] (-584.962) (-584.209) * (-587.862) (-583.901) (-587.509) [-584.484] -- 0:00:47
      229000 -- (-583.495) (-586.597) [-584.125] (-584.593) * (-587.744) (-588.683) (-584.942) [-583.836] -- 0:00:47
      229500 -- (-582.862) (-586.034) (-584.500) [-584.343] * (-587.066) (-583.612) (-585.169) [-587.010] -- 0:00:47
      230000 -- (-583.415) (-583.930) [-583.580] (-589.548) * (-590.697) (-584.731) (-587.818) [-584.351] -- 0:00:46

      Average standard deviation of split frequencies: 0.013284

      230500 -- (-586.889) (-585.167) [-584.043] (-587.567) * (-583.527) [-585.859] (-585.267) (-585.992) -- 0:00:46
      231000 -- [-586.299] (-584.392) (-586.991) (-587.631) * (-588.774) [-585.610] (-584.905) (-584.622) -- 0:00:46
      231500 -- (-584.776) (-584.546) (-585.199) [-586.255] * (-585.772) (-589.479) (-585.592) [-584.449] -- 0:00:46
      232000 -- (-585.438) [-583.972] (-586.297) (-583.799) * (-585.143) [-587.329] (-587.969) (-586.375) -- 0:00:46
      232500 -- (-588.451) (-583.808) (-583.835) [-584.194] * (-585.259) (-585.235) (-588.267) [-585.698] -- 0:00:46
      233000 -- [-584.221] (-588.888) (-588.160) (-587.149) * (-585.353) (-584.353) (-586.038) [-583.692] -- 0:00:46
      233500 -- (-584.873) (-593.232) (-585.952) [-584.689] * (-585.448) (-583.689) (-584.936) [-588.890] -- 0:00:45
      234000 -- (-585.861) [-591.958] (-585.019) (-584.212) * (-583.448) (-583.380) (-584.740) [-588.030] -- 0:00:45
      234500 -- (-587.407) (-585.168) (-585.311) [-584.576] * (-583.672) (-583.138) [-584.869] (-587.395) -- 0:00:45
      235000 -- (-585.226) (-585.071) [-588.499] (-587.132) * (-586.227) [-582.801] (-585.417) (-587.307) -- 0:00:45

      Average standard deviation of split frequencies: 0.013630

      235500 -- [-584.768] (-586.329) (-584.214) (-588.520) * (-585.310) [-585.519] (-584.772) (-587.442) -- 0:00:45
      236000 -- [-584.025] (-584.997) (-587.213) (-588.107) * [-585.277] (-585.764) (-585.638) (-584.030) -- 0:00:45
      236500 -- (-585.459) [-585.272] (-584.056) (-585.737) * (-586.443) (-585.042) (-582.872) [-587.781] -- 0:00:45
      237000 -- (-584.758) (-584.522) [-584.373] (-585.697) * [-584.909] (-585.031) (-583.443) (-585.244) -- 0:00:45
      237500 -- (-584.326) (-584.165) [-582.957] (-585.434) * (-584.207) (-584.828) [-583.217] (-583.602) -- 0:00:44
      238000 -- (-583.083) (-585.683) [-585.196] (-584.810) * [-584.929] (-584.155) (-588.581) (-583.404) -- 0:00:44
      238500 -- [-584.106] (-584.354) (-590.003) (-585.246) * (-586.293) [-583.847] (-584.201) (-585.061) -- 0:00:44
      239000 -- (-587.328) (-584.267) [-586.038] (-585.897) * (-584.724) [-586.404] (-583.757) (-584.083) -- 0:00:44
      239500 -- [-587.519] (-589.223) (-583.477) (-584.570) * (-584.625) [-583.613] (-590.941) (-588.361) -- 0:00:44
      240000 -- (-584.955) (-585.300) [-585.635] (-586.170) * (-584.948) [-584.364] (-592.400) (-588.144) -- 0:00:44

      Average standard deviation of split frequencies: 0.014446

      240500 -- (-585.093) (-585.418) [-585.236] (-586.659) * (-586.289) [-583.314] (-584.455) (-583.890) -- 0:00:44
      241000 -- (-588.037) (-587.121) (-584.191) [-585.235] * (-586.606) [-584.547] (-586.209) (-583.055) -- 0:00:44
      241500 -- (-586.160) (-588.212) [-583.332] (-585.222) * [-585.108] (-585.635) (-587.244) (-585.636) -- 0:00:43
      242000 -- [-583.516] (-583.985) (-583.805) (-585.853) * (-585.572) [-585.654] (-588.161) (-584.753) -- 0:00:43
      242500 -- (-584.477) (-585.017) [-583.380] (-585.852) * (-583.495) (-585.129) (-583.873) [-584.836] -- 0:00:46
      243000 -- (-583.469) (-586.902) [-584.222] (-585.833) * (-584.270) (-588.066) (-583.728) [-584.099] -- 0:00:46
      243500 -- [-586.977] (-586.508) (-585.705) (-586.544) * (-584.574) (-588.046) (-586.817) [-585.076] -- 0:00:46
      244000 -- (-585.811) (-584.487) (-584.849) [-587.826] * (-589.799) (-585.231) (-586.543) [-583.742] -- 0:00:46
      244500 -- (-586.675) (-583.957) (-590.326) [-583.155] * (-584.317) (-586.603) [-586.670] (-585.065) -- 0:00:46
      245000 -- (-585.249) [-584.020] (-586.460) (-583.536) * (-584.994) (-585.501) (-585.785) [-583.600] -- 0:00:46

      Average standard deviation of split frequencies: 0.013189

      245500 -- (-586.890) (-585.379) [-585.026] (-586.794) * (-585.273) [-588.112] (-586.745) (-587.036) -- 0:00:46
      246000 -- (-586.452) [-586.536] (-585.627) (-589.369) * [-583.599] (-590.065) (-587.868) (-585.712) -- 0:00:45
      246500 -- (-587.016) [-585.674] (-585.661) (-584.871) * (-584.588) (-583.866) (-585.695) [-583.279] -- 0:00:45
      247000 -- [-585.594] (-583.466) (-588.085) (-583.249) * [-586.223] (-584.958) (-584.662) (-585.387) -- 0:00:45
      247500 -- (-582.670) (-587.435) [-584.488] (-584.930) * (-584.606) (-585.578) (-584.199) [-584.915] -- 0:00:45
      248000 -- (-583.677) (-588.978) (-584.142) [-583.388] * (-586.735) [-584.947] (-585.016) (-585.120) -- 0:00:45
      248500 -- (-588.341) [-583.725] (-585.379) (-583.771) * (-586.775) [-584.345] (-582.807) (-588.359) -- 0:00:45
      249000 -- [-583.386] (-585.960) (-584.428) (-585.979) * (-585.441) (-585.648) [-585.029] (-585.084) -- 0:00:45
      249500 -- (-583.925) (-589.116) (-587.381) [-587.301] * (-588.679) (-587.330) [-585.085] (-586.755) -- 0:00:45
      250000 -- [-586.795] (-587.540) (-583.686) (-586.806) * (-585.547) (-588.759) (-586.883) [-584.454] -- 0:00:45

      Average standard deviation of split frequencies: 0.013282

      250500 -- (-585.565) [-584.031] (-587.969) (-586.283) * (-585.804) (-586.958) (-585.311) [-584.111] -- 0:00:44
      251000 -- (-585.263) (-583.002) [-584.778] (-588.865) * (-586.758) (-583.814) [-584.816] (-585.453) -- 0:00:44
      251500 -- (-584.889) (-584.468) (-583.437) [-584.925] * (-588.963) (-585.167) (-585.569) [-583.518] -- 0:00:44
      252000 -- [-583.477] (-585.910) (-583.532) (-589.805) * (-591.824) [-584.733] (-585.412) (-591.570) -- 0:00:44
      252500 -- (-588.250) [-585.356] (-585.301) (-589.303) * (-590.489) (-586.513) [-585.456] (-584.595) -- 0:00:44
      253000 -- (-590.513) [-588.184] (-583.903) (-585.168) * (-583.494) (-583.624) [-585.056] (-583.364) -- 0:00:44
      253500 -- (-588.103) [-585.015] (-585.976) (-583.327) * [-584.826] (-586.425) (-583.481) (-583.617) -- 0:00:44
      254000 -- (-585.486) [-583.594] (-586.700) (-583.497) * (-587.553) [-585.798] (-584.114) (-585.242) -- 0:00:44
      254500 -- [-585.807] (-584.145) (-584.821) (-585.197) * (-583.772) (-587.822) [-583.082] (-585.459) -- 0:00:43
      255000 -- [-584.659] (-583.813) (-583.745) (-584.965) * [-583.835] (-584.409) (-587.712) (-586.698) -- 0:00:43

      Average standard deviation of split frequencies: 0.012315

      255500 -- (-585.424) (-583.830) [-584.617] (-584.410) * (-583.052) (-585.792) [-586.680] (-584.569) -- 0:00:43
      256000 -- [-588.764] (-585.052) (-588.445) (-583.847) * (-583.507) (-584.655) [-586.739] (-583.535) -- 0:00:43
      256500 -- (-584.820) (-589.226) (-588.037) [-586.232] * (-587.211) (-585.762) [-583.523] (-586.076) -- 0:00:43
      257000 -- (-584.519) [-588.894] (-585.898) (-586.285) * [-584.940] (-584.713) (-584.576) (-587.878) -- 0:00:43
      257500 -- (-583.114) (-583.932) [-585.547] (-587.387) * (-584.859) (-584.506) [-587.705] (-584.471) -- 0:00:43
      258000 -- (-583.402) (-584.845) (-585.722) [-584.661] * (-586.613) (-585.373) [-582.963] (-584.282) -- 0:00:43
      258500 -- (-584.844) (-584.308) [-586.142] (-586.284) * (-588.986) (-585.919) (-585.093) [-585.736] -- 0:00:43
      259000 -- [-586.000] (-583.539) (-585.951) (-584.424) * (-587.525) (-587.715) (-584.440) [-585.958] -- 0:00:42
      259500 -- (-584.115) (-585.101) (-586.682) [-586.594] * (-588.066) [-587.536] (-587.028) (-586.751) -- 0:00:45
      260000 -- [-585.765] (-584.870) (-588.140) (-587.378) * (-594.560) [-583.657] (-583.985) (-584.067) -- 0:00:45

      Average standard deviation of split frequencies: 0.013903

      260500 -- (-586.796) [-584.619] (-589.358) (-585.546) * (-587.456) [-583.327] (-584.125) (-584.652) -- 0:00:45
      261000 -- (-585.349) [-585.156] (-588.338) (-585.067) * [-585.224] (-583.851) (-584.664) (-584.003) -- 0:00:45
      261500 -- (-588.277) [-586.280] (-585.212) (-586.768) * (-584.590) (-584.326) (-588.037) [-583.952] -- 0:00:45
      262000 -- (-584.389) (-583.862) (-587.042) [-583.696] * (-584.328) (-586.356) (-583.868) [-584.546] -- 0:00:45
      262500 -- (-588.779) [-584.523] (-587.809) (-585.200) * (-585.668) (-585.822) (-585.736) [-586.592] -- 0:00:44
      263000 -- [-586.613] (-583.042) (-587.280) (-589.343) * (-585.888) [-584.433] (-583.879) (-586.158) -- 0:00:44
      263500 -- (-583.813) [-584.294] (-589.543) (-585.825) * (-583.430) [-586.622] (-585.566) (-583.756) -- 0:00:44
      264000 -- (-584.025) (-586.954) [-590.401] (-583.020) * (-584.606) (-586.327) [-585.162] (-583.947) -- 0:00:44
      264500 -- (-585.809) (-584.892) (-586.657) [-583.552] * (-586.486) (-584.057) (-586.680) [-583.676] -- 0:00:44
      265000 -- (-585.115) (-583.827) (-586.003) [-584.820] * (-583.511) (-583.826) (-583.389) [-582.987] -- 0:00:44

      Average standard deviation of split frequencies: 0.013865

      265500 -- (-591.945) [-583.868] (-584.722) (-583.386) * (-585.955) (-584.006) (-585.584) [-583.780] -- 0:00:44
      266000 -- (-589.803) (-582.808) [-584.178] (-585.617) * (-589.839) (-585.564) (-584.295) [-584.946] -- 0:00:44
      266500 -- (-584.695) [-583.688] (-589.847) (-589.311) * (-589.032) (-584.083) (-583.161) [-583.838] -- 0:00:44
      267000 -- [-583.943] (-583.730) (-585.764) (-587.225) * (-584.756) (-585.111) (-583.764) [-585.638] -- 0:00:43
      267500 -- (-589.147) (-587.190) (-584.958) [-584.040] * (-584.304) [-585.637] (-587.597) (-583.591) -- 0:00:43
      268000 -- (-585.082) (-583.730) (-586.144) [-585.938] * (-588.039) [-584.270] (-587.827) (-584.467) -- 0:00:43
      268500 -- (-589.194) (-584.548) (-588.072) [-587.024] * (-583.876) (-586.767) [-586.021] (-583.420) -- 0:00:43
      269000 -- (-586.601) (-586.036) (-584.057) [-584.401] * (-585.402) (-585.505) (-584.526) [-583.991] -- 0:00:43
      269500 -- (-583.561) (-584.409) [-583.715] (-584.408) * (-587.336) (-584.138) [-585.635] (-585.274) -- 0:00:43
      270000 -- (-588.999) [-585.032] (-587.446) (-585.013) * (-584.227) [-584.936] (-586.447) (-584.112) -- 0:00:43

      Average standard deviation of split frequencies: 0.014958

      270500 -- (-587.620) (-587.617) [-584.452] (-585.408) * (-583.586) (-583.021) (-585.295) [-585.941] -- 0:00:43
      271000 -- [-584.408] (-584.421) (-584.278) (-583.201) * (-584.892) (-583.761) (-583.722) [-585.191] -- 0:00:43
      271500 -- [-584.478] (-584.386) (-583.251) (-590.867) * (-587.787) (-584.572) [-583.783] (-584.068) -- 0:00:42
      272000 -- (-584.836) (-586.910) (-583.826) [-586.516] * (-585.420) (-584.082) [-585.175] (-585.153) -- 0:00:42
      272500 -- (-586.109) (-585.415) [-586.218] (-589.356) * [-589.239] (-585.733) (-584.371) (-586.345) -- 0:00:42
      273000 -- (-584.713) (-584.468) (-586.186) [-587.964] * (-587.496) [-584.547] (-588.154) (-585.040) -- 0:00:42
      273500 -- (-587.431) (-586.222) [-585.880] (-583.121) * (-585.198) (-584.963) [-583.193] (-586.562) -- 0:00:42
      274000 -- [-585.226] (-583.457) (-584.647) (-585.083) * [-584.016] (-584.735) (-585.814) (-586.729) -- 0:00:42
      274500 -- [-583.359] (-584.982) (-583.574) (-584.003) * (-591.164) [-583.623] (-585.575) (-586.346) -- 0:00:42
      275000 -- (-582.866) [-584.763] (-585.515) (-582.869) * [-585.960] (-584.251) (-583.750) (-586.027) -- 0:00:42

      Average standard deviation of split frequencies: 0.013557

      275500 -- (-585.775) (-583.710) (-591.612) [-585.939] * (-583.377) (-588.799) [-583.660] (-589.871) -- 0:00:42
      276000 -- (-587.474) [-583.437] (-586.776) (-590.586) * [-584.609] (-583.716) (-584.886) (-585.155) -- 0:00:44
      276500 -- (-583.918) [-587.034] (-587.668) (-586.048) * (-587.700) [-585.765] (-586.423) (-586.594) -- 0:00:44
      277000 -- [-585.975] (-584.733) (-585.945) (-584.090) * (-585.509) (-587.139) [-588.378] (-586.318) -- 0:00:44
      277500 -- [-585.918] (-586.001) (-584.057) (-586.139) * [-584.046] (-585.196) (-588.922) (-588.676) -- 0:00:44
      278000 -- (-594.996) [-584.775] (-587.070) (-583.710) * (-585.388) [-587.515] (-584.370) (-587.980) -- 0:00:44
      278500 -- [-583.953] (-584.158) (-586.530) (-583.878) * (-588.539) (-586.664) [-589.012] (-585.071) -- 0:00:44
      279000 -- (-587.170) (-584.724) [-583.106] (-583.823) * (-584.797) (-585.645) [-584.430] (-585.503) -- 0:00:43
      279500 -- (-583.524) (-583.372) (-584.998) [-585.598] * (-585.352) (-583.637) (-586.501) [-586.791] -- 0:00:43
      280000 -- (-585.094) (-586.962) [-585.340] (-586.077) * (-583.953) [-583.436] (-584.533) (-587.363) -- 0:00:43

      Average standard deviation of split frequencies: 0.013962

      280500 -- (-583.716) (-587.840) (-586.625) [-586.187] * (-586.238) (-584.791) [-583.890] (-587.702) -- 0:00:43
      281000 -- (-583.216) [-585.048] (-584.630) (-586.791) * [-582.893] (-583.697) (-584.784) (-584.503) -- 0:00:43
      281500 -- (-585.373) (-587.545) [-586.150] (-583.430) * (-583.121) (-585.938) (-584.460) [-583.160] -- 0:00:43
      282000 -- [-585.552] (-586.230) (-586.178) (-583.223) * (-585.053) (-585.318) (-584.205) [-587.876] -- 0:00:43
      282500 -- [-584.082] (-587.562) (-583.601) (-584.181) * [-584.206] (-584.760) (-583.436) (-587.993) -- 0:00:43
      283000 -- [-585.908] (-584.009) (-583.047) (-585.631) * (-593.800) (-584.056) [-583.894] (-583.229) -- 0:00:43
      283500 -- (-586.560) (-583.869) [-583.982] (-584.860) * [-584.329] (-584.596) (-583.469) (-587.988) -- 0:00:42
      284000 -- [-584.718] (-586.363) (-584.835) (-585.996) * [-583.646] (-594.608) (-583.158) (-584.159) -- 0:00:42
      284500 -- (-583.500) [-585.920] (-585.366) (-587.134) * (-584.529) (-589.686) (-588.717) [-586.550] -- 0:00:42
      285000 -- (-583.633) (-585.639) (-587.735) [-584.264] * (-587.484) (-586.446) [-586.554] (-584.660) -- 0:00:42

      Average standard deviation of split frequencies: 0.013574

      285500 -- [-583.846] (-584.938) (-584.201) (-584.606) * (-585.879) (-584.935) (-585.643) [-584.491] -- 0:00:42
      286000 -- [-584.667] (-585.517) (-583.190) (-585.614) * (-587.126) (-584.318) (-585.639) [-588.669] -- 0:00:42
      286500 -- (-584.357) (-583.913) [-586.243] (-585.904) * (-586.112) (-586.281) [-584.729] (-591.410) -- 0:00:42
      287000 -- (-585.155) (-585.954) [-584.568] (-584.055) * [-585.191] (-583.607) (-585.542) (-587.393) -- 0:00:42
      287500 -- (-586.186) (-584.073) (-588.460) [-583.930] * (-587.653) (-583.356) (-582.735) [-585.263] -- 0:00:42
      288000 -- (-587.917) (-587.903) (-584.199) [-584.382] * [-586.674] (-588.465) (-584.015) (-593.717) -- 0:00:42
      288500 -- [-585.826] (-585.208) (-585.268) (-582.949) * (-589.722) (-587.648) [-583.525] (-585.579) -- 0:00:41
      289000 -- (-586.312) (-584.822) (-587.369) [-583.432] * (-585.488) [-586.278] (-583.788) (-586.013) -- 0:00:41
      289500 -- (-586.858) [-586.708] (-586.824) (-586.323) * (-585.121) [-587.371] (-584.436) (-584.480) -- 0:00:41
      290000 -- [-587.953] (-584.190) (-588.405) (-585.643) * [-584.753] (-586.199) (-584.508) (-589.957) -- 0:00:41

      Average standard deviation of split frequencies: 0.013451

      290500 -- (-590.775) [-584.139] (-583.553) (-584.176) * (-584.262) [-586.002] (-585.932) (-585.470) -- 0:00:41
      291000 -- (-588.888) (-585.614) (-587.107) [-585.343] * (-585.018) [-585.318] (-583.973) (-585.260) -- 0:00:41
      291500 -- [-584.094] (-586.243) (-583.024) (-583.957) * [-587.601] (-586.160) (-583.386) (-585.304) -- 0:00:41
      292000 -- (-584.057) (-586.150) (-583.358) [-586.330] * (-587.835) [-583.676] (-585.104) (-583.623) -- 0:00:41
      292500 -- (-583.955) (-583.513) (-585.537) [-584.507] * [-586.442] (-587.254) (-585.122) (-583.252) -- 0:00:41
      293000 -- (-586.239) [-584.037] (-586.399) (-585.413) * (-585.821) (-586.461) [-584.756] (-586.251) -- 0:00:43
      293500 -- (-584.528) [-583.003] (-584.977) (-583.539) * [-584.738] (-583.909) (-587.105) (-583.149) -- 0:00:43
      294000 -- (-585.640) [-586.814] (-584.464) (-590.080) * (-587.882) (-584.163) (-586.524) [-584.767] -- 0:00:43
      294500 -- (-588.189) (-585.693) [-583.684] (-585.981) * (-587.622) (-585.777) [-583.622] (-587.318) -- 0:00:43
      295000 -- (-589.631) (-586.918) (-586.741) [-584.990] * (-583.162) (-588.005) (-583.610) [-583.607] -- 0:00:43

      Average standard deviation of split frequencies: 0.014146

      295500 -- (-587.206) (-588.117) (-584.732) [-587.442] * [-583.162] (-584.268) (-584.391) (-584.433) -- 0:00:42
      296000 -- (-588.447) (-586.569) [-584.066] (-592.572) * (-586.828) (-584.135) (-587.603) [-584.755] -- 0:00:42
      296500 -- [-584.421] (-584.372) (-589.376) (-588.160) * (-583.805) [-582.863] (-587.098) (-585.223) -- 0:00:42
      297000 -- (-587.152) (-587.756) (-587.006) [-586.847] * (-586.291) (-584.046) (-585.049) [-586.309] -- 0:00:42
      297500 -- (-585.289) (-583.938) [-585.536] (-584.320) * (-584.191) (-582.770) (-586.897) [-589.972] -- 0:00:42
      298000 -- (-586.557) [-584.356] (-585.733) (-584.635) * (-584.954) [-584.669] (-585.144) (-587.001) -- 0:00:42
      298500 -- [-585.417] (-583.287) (-588.630) (-583.327) * [-589.439] (-587.972) (-583.579) (-584.404) -- 0:00:42
      299000 -- (-584.914) [-584.976] (-589.227) (-583.729) * (-582.943) (-589.990) [-584.154] (-583.376) -- 0:00:42
      299500 -- (-595.889) [-589.767] (-583.239) (-589.037) * (-585.515) (-588.403) (-584.157) [-583.282] -- 0:00:42
      300000 -- (-585.827) [-583.669] (-583.352) (-586.357) * (-583.911) (-585.197) (-583.780) [-584.994] -- 0:00:42

      Average standard deviation of split frequencies: 0.014572

      300500 -- [-586.277] (-587.621) (-587.780) (-583.058) * (-583.529) (-585.813) (-585.139) [-585.371] -- 0:00:41
      301000 -- (-588.303) (-585.847) (-584.309) [-583.594] * (-589.117) (-586.601) (-584.387) [-585.983] -- 0:00:41
      301500 -- (-584.314) (-583.975) [-585.221] (-582.758) * (-585.141) (-587.502) [-584.342] (-585.407) -- 0:00:41
      302000 -- (-584.865) (-583.907) (-585.542) [-585.111] * [-583.301] (-586.108) (-584.668) (-585.199) -- 0:00:41
      302500 -- [-584.355] (-585.386) (-588.150) (-586.128) * (-583.582) [-587.770] (-585.621) (-583.422) -- 0:00:41
      303000 -- (-584.211) (-589.665) [-583.090] (-586.200) * (-584.973) [-585.940] (-584.090) (-584.904) -- 0:00:41
      303500 -- (-585.336) (-587.961) (-583.895) [-584.266] * (-585.325) [-584.086] (-585.999) (-583.861) -- 0:00:41
      304000 -- (-584.189) (-585.955) [-585.161] (-589.156) * (-589.501) [-586.843] (-588.723) (-583.823) -- 0:00:41
      304500 -- (-586.321) (-585.837) [-585.328] (-583.538) * [-588.972] (-584.798) (-588.807) (-584.523) -- 0:00:41
      305000 -- (-583.487) (-585.501) (-591.645) [-584.052] * (-585.210) (-584.044) (-583.898) [-584.892] -- 0:00:41

      Average standard deviation of split frequencies: 0.014046

      305500 -- [-583.788] (-590.491) (-584.851) (-585.147) * [-584.575] (-589.742) (-584.358) (-586.712) -- 0:00:40
      306000 -- [-584.150] (-585.356) (-588.527) (-583.785) * (-586.803) (-589.292) (-584.187) [-585.021] -- 0:00:40
      306500 -- [-584.184] (-584.220) (-585.851) (-584.332) * [-584.629] (-585.152) (-585.014) (-583.672) -- 0:00:40
      307000 -- [-584.081] (-584.791) (-584.366) (-584.964) * (-585.564) (-586.901) [-583.736] (-584.471) -- 0:00:40
      307500 -- (-585.280) [-589.296] (-583.936) (-584.225) * (-586.749) (-588.009) [-584.116] (-584.929) -- 0:00:40
      308000 -- (-584.745) (-590.090) [-583.901] (-584.969) * (-582.991) (-587.499) [-583.318] (-584.793) -- 0:00:40
      308500 -- [-585.769] (-584.594) (-583.470) (-583.742) * [-583.463] (-585.109) (-583.826) (-583.984) -- 0:00:40
      309000 -- (-585.551) (-585.394) (-584.442) [-583.159] * (-586.628) (-586.253) [-586.090] (-584.501) -- 0:00:40
      309500 -- (-584.403) (-583.658) [-584.411] (-583.161) * (-585.597) [-590.672] (-583.633) (-585.957) -- 0:00:42
      310000 -- [-585.040] (-588.521) (-587.754) (-583.274) * [-583.723] (-587.064) (-583.207) (-585.296) -- 0:00:42

      Average standard deviation of split frequencies: 0.012729

      310500 -- (-586.436) (-584.612) (-585.289) [-584.413] * (-584.710) [-583.654] (-584.801) (-583.335) -- 0:00:42
      311000 -- (-587.474) [-583.346] (-584.258) (-585.081) * (-585.252) [-585.816] (-583.444) (-587.199) -- 0:00:42
      311500 -- [-584.735] (-584.057) (-587.581) (-586.920) * [-584.496] (-586.427) (-584.058) (-583.250) -- 0:00:41
      312000 -- [-585.026] (-586.695) (-586.814) (-585.175) * (-586.325) [-586.029] (-586.693) (-590.412) -- 0:00:41
      312500 -- (-584.144) (-585.344) (-585.081) [-583.787] * [-583.598] (-585.299) (-583.978) (-589.407) -- 0:00:41
      313000 -- (-591.373) (-586.899) [-588.259] (-588.376) * (-585.539) [-583.952] (-585.530) (-587.883) -- 0:00:41
      313500 -- (-583.508) (-588.012) [-584.834] (-588.876) * [-584.240] (-590.794) (-583.812) (-589.636) -- 0:00:41
      314000 -- [-583.876] (-583.334) (-583.931) (-587.301) * [-587.762] (-588.943) (-583.888) (-591.145) -- 0:00:41
      314500 -- [-584.861] (-584.481) (-589.992) (-583.950) * [-588.115] (-584.617) (-585.307) (-585.568) -- 0:00:41
      315000 -- [-585.936] (-584.895) (-586.007) (-583.582) * [-586.666] (-583.996) (-585.947) (-585.742) -- 0:00:41

      Average standard deviation of split frequencies: 0.012929

      315500 -- (-585.480) (-584.589) (-584.908) [-582.910] * (-583.360) (-585.450) [-585.610] (-584.670) -- 0:00:41
      316000 -- (-583.022) (-583.309) [-584.279] (-584.899) * [-583.124] (-584.293) (-583.946) (-584.820) -- 0:00:41
      316500 -- (-584.679) (-584.133) (-584.009) [-585.197] * (-583.653) [-584.658] (-586.518) (-583.798) -- 0:00:41
      317000 -- (-586.713) [-583.245] (-586.611) (-586.523) * (-589.541) (-585.384) [-586.298] (-588.380) -- 0:00:40
      317500 -- [-584.003] (-584.692) (-585.956) (-584.168) * (-583.151) [-589.696] (-589.207) (-583.704) -- 0:00:40
      318000 -- [-584.001] (-585.664) (-591.780) (-590.451) * [-583.137] (-592.323) (-587.836) (-585.105) -- 0:00:40
      318500 -- (-583.369) (-583.999) (-588.652) [-593.194] * (-582.983) [-585.536] (-586.738) (-588.046) -- 0:00:40
      319000 -- (-591.085) [-585.399] (-584.219) (-588.311) * (-589.825) (-583.978) [-585.890] (-594.121) -- 0:00:40
      319500 -- (-583.694) (-584.081) [-586.232] (-586.541) * (-586.305) (-584.384) (-586.593) [-587.020] -- 0:00:40
      320000 -- [-587.576] (-586.118) (-585.221) (-586.778) * (-585.255) (-584.716) [-583.740] (-583.973) -- 0:00:40

      Average standard deviation of split frequencies: 0.013966

      320500 -- (-584.639) (-583.989) (-586.129) [-584.900] * (-586.478) (-584.354) (-584.188) [-587.157] -- 0:00:40
      321000 -- [-584.465] (-584.851) (-588.836) (-583.832) * (-586.087) [-583.731] (-584.408) (-587.659) -- 0:00:40
      321500 -- [-583.406] (-584.694) (-584.364) (-586.841) * (-587.635) (-585.341) [-585.249] (-583.972) -- 0:00:40
      322000 -- [-587.475] (-583.379) (-583.928) (-584.420) * (-586.933) (-586.622) (-584.201) [-582.855] -- 0:00:40
      322500 -- (-585.398) (-586.653) [-586.256] (-587.988) * (-585.790) [-583.416] (-584.644) (-584.784) -- 0:00:39
      323000 -- (-585.997) (-585.191) [-584.703] (-590.073) * [-584.164] (-584.814) (-586.985) (-586.791) -- 0:00:39
      323500 -- [-584.672] (-583.193) (-584.897) (-590.487) * (-587.775) [-586.336] (-589.540) (-585.265) -- 0:00:39
      324000 -- [-583.502] (-584.025) (-584.286) (-587.255) * [-584.583] (-587.415) (-587.129) (-585.653) -- 0:00:39
      324500 -- [-583.550] (-589.444) (-586.110) (-584.737) * (-584.150) [-584.794] (-585.304) (-584.053) -- 0:00:39
      325000 -- [-583.661] (-586.428) (-586.859) (-585.840) * [-584.940] (-585.480) (-586.112) (-585.442) -- 0:00:39

      Average standard deviation of split frequencies: 0.014059

      325500 -- (-583.551) [-587.112] (-582.894) (-585.805) * (-585.646) (-584.884) (-583.508) [-585.492] -- 0:00:39
      326000 -- [-584.225] (-584.248) (-584.585) (-583.136) * [-585.361] (-583.288) (-584.213) (-584.744) -- 0:00:41
      326500 -- (-584.548) [-584.967] (-584.192) (-586.723) * (-588.614) (-584.209) (-584.482) [-585.136] -- 0:00:41
      327000 -- (-586.496) (-584.752) [-584.810] (-585.594) * (-588.512) (-587.286) (-585.189) [-584.460] -- 0:00:41
      327500 -- (-586.913) [-586.904] (-585.416) (-583.861) * (-587.154) (-592.950) [-583.996] (-586.046) -- 0:00:41
      328000 -- (-590.483) (-588.350) [-583.460] (-584.327) * (-584.187) [-584.267] (-587.465) (-586.641) -- 0:00:40
      328500 -- (-585.800) [-584.966] (-583.404) (-586.539) * (-585.019) [-588.837] (-583.542) (-588.961) -- 0:00:40
      329000 -- (-586.767) (-583.327) [-585.163] (-584.527) * [-585.538] (-586.924) (-587.427) (-587.894) -- 0:00:40
      329500 -- (-586.198) (-588.511) (-591.240) [-584.861] * [-583.171] (-586.109) (-585.175) (-584.333) -- 0:00:40
      330000 -- (-589.872) (-587.272) (-584.311) [-584.610] * [-584.698] (-583.317) (-586.763) (-584.883) -- 0:00:40

      Average standard deviation of split frequencies: 0.014556

      330500 -- (-585.524) [-584.940] (-588.596) (-583.053) * (-595.502) (-585.156) [-584.238] (-584.467) -- 0:00:40
      331000 -- (-589.757) (-584.876) (-585.062) [-585.842] * (-584.019) [-583.154] (-584.965) (-585.464) -- 0:00:40
      331500 -- (-586.579) (-588.473) [-583.913] (-585.131) * (-584.102) (-583.983) (-584.879) [-583.921] -- 0:00:40
      332000 -- (-583.691) (-583.500) [-584.718] (-586.785) * (-584.288) [-583.748] (-586.154) (-586.646) -- 0:00:40
      332500 -- (-583.685) (-585.115) [-586.795] (-583.872) * (-584.368) [-585.172] (-584.815) (-584.926) -- 0:00:40
      333000 -- (-585.633) (-584.795) (-588.806) [-583.806] * (-585.717) (-582.975) (-585.493) [-589.697] -- 0:00:40
      333500 -- (-585.209) (-584.227) (-585.069) [-586.206] * (-588.654) (-584.794) (-586.868) [-588.072] -- 0:00:39
      334000 -- (-584.338) (-584.969) [-585.724] (-586.808) * (-582.992) (-585.193) [-585.481] (-583.535) -- 0:00:39
      334500 -- [-585.631] (-583.379) (-584.636) (-587.134) * [-584.340] (-584.123) (-584.027) (-583.337) -- 0:00:39
      335000 -- (-587.280) (-584.419) [-584.571] (-587.947) * (-583.282) [-587.102] (-584.675) (-585.316) -- 0:00:39

      Average standard deviation of split frequencies: 0.013640

      335500 -- (-584.588) (-585.625) [-584.232] (-583.106) * (-583.030) (-588.863) [-585.814] (-590.162) -- 0:00:39
      336000 -- (-589.918) (-583.779) [-585.358] (-584.752) * (-585.653) (-586.782) [-584.634] (-584.972) -- 0:00:39
      336500 -- (-587.291) (-586.546) (-586.152) [-583.899] * (-583.025) (-587.662) [-586.695] (-584.611) -- 0:00:39
      337000 -- (-584.316) (-586.186) (-587.579) [-583.370] * (-585.806) [-584.896] (-586.349) (-587.063) -- 0:00:39
      337500 -- (-591.138) (-585.170) [-584.715] (-583.631) * (-586.551) (-592.992) [-583.598] (-585.501) -- 0:00:39
      338000 -- (-584.607) (-585.165) [-586.395] (-584.279) * (-583.825) [-583.777] (-584.057) (-584.149) -- 0:00:39
      338500 -- [-584.766] (-583.836) (-583.931) (-586.234) * (-584.029) (-582.700) [-588.179] (-588.234) -- 0:00:39
      339000 -- (-589.757) [-583.762] (-584.008) (-588.729) * (-585.303) (-583.481) (-583.458) [-585.447] -- 0:00:38
      339500 -- (-585.238) (-584.887) (-583.691) [-583.715] * [-584.258] (-587.926) (-585.013) (-587.217) -- 0:00:38
      340000 -- (-583.962) (-583.297) (-588.551) [-582.871] * (-585.915) [-584.406] (-587.380) (-583.657) -- 0:00:38

      Average standard deviation of split frequencies: 0.013675

      340500 -- [-585.999] (-583.433) (-587.918) (-582.870) * (-583.448) (-587.416) [-585.431] (-584.733) -- 0:00:38
      341000 -- (-589.233) [-585.346] (-584.685) (-583.988) * (-583.619) [-585.754] (-583.579) (-583.471) -- 0:00:38
      341500 -- (-584.482) (-589.340) [-582.931] (-585.360) * [-584.689] (-585.078) (-588.852) (-583.940) -- 0:00:38
      342000 -- (-583.327) [-585.471] (-583.012) (-585.176) * [-584.971] (-585.903) (-584.625) (-584.424) -- 0:00:38
      342500 -- (-584.473) (-585.304) (-584.042) [-584.027] * (-585.204) [-583.327] (-585.172) (-583.675) -- 0:00:40
      343000 -- (-584.506) [-585.285] (-586.214) (-583.224) * (-585.616) [-586.748] (-585.513) (-584.155) -- 0:00:40
      343500 -- [-584.721] (-586.025) (-585.267) (-584.830) * (-583.331) [-584.095] (-587.615) (-583.262) -- 0:00:40
      344000 -- (-583.483) (-584.986) (-585.802) [-584.705] * (-583.335) (-584.034) (-583.801) [-583.126] -- 0:00:40
      344500 -- (-590.269) (-587.130) [-583.406] (-584.209) * (-583.723) [-583.859] (-583.713) (-583.496) -- 0:00:39
      345000 -- (-585.773) (-584.811) [-583.087] (-584.881) * (-587.290) [-584.069] (-583.985) (-586.055) -- 0:00:39

      Average standard deviation of split frequencies: 0.012903

      345500 -- (-583.558) (-585.183) (-588.746) [-583.434] * (-584.145) (-584.869) [-583.381] (-589.627) -- 0:00:39
      346000 -- (-583.870) (-583.639) (-583.726) [-584.384] * (-585.369) (-586.475) [-585.342] (-584.318) -- 0:00:39
      346500 -- (-584.731) (-587.042) [-586.224] (-584.955) * [-584.573] (-586.400) (-583.649) (-586.383) -- 0:00:39
      347000 -- [-585.535] (-586.852) (-584.787) (-584.145) * (-583.013) (-586.641) (-586.434) [-588.276] -- 0:00:39
      347500 -- (-586.008) (-584.815) [-587.176] (-586.087) * (-585.876) (-589.316) (-586.068) [-585.554] -- 0:00:39
      348000 -- (-588.059) (-584.942) (-583.680) [-583.835] * (-585.590) [-585.805] (-584.275) (-585.921) -- 0:00:39
      348500 -- (-586.983) (-584.803) (-585.812) [-583.932] * (-588.357) (-588.458) (-585.955) [-585.054] -- 0:00:39
      349000 -- (-583.918) [-585.471] (-584.683) (-583.660) * (-586.078) [-584.036] (-586.036) (-587.604) -- 0:00:39
      349500 -- (-584.305) (-586.204) (-585.582) [-584.264] * [-585.768] (-585.623) (-587.778) (-588.652) -- 0:00:39
      350000 -- (-583.999) (-585.644) [-584.012] (-585.013) * [-584.536] (-585.157) (-588.727) (-585.612) -- 0:00:39

      Average standard deviation of split frequencies: 0.013918

      350500 -- [-584.695] (-584.075) (-583.176) (-583.706) * (-584.091) [-584.934] (-585.166) (-585.026) -- 0:00:38
      351000 -- (-590.298) (-587.933) [-583.024] (-584.905) * [-584.147] (-585.454) (-586.233) (-586.263) -- 0:00:38
      351500 -- (-584.709) (-584.550) [-585.167] (-583.583) * [-583.069] (-586.426) (-584.092) (-585.587) -- 0:00:38
      352000 -- (-586.274) [-584.831] (-585.965) (-585.470) * (-583.533) (-583.292) (-584.518) [-585.563] -- 0:00:38
      352500 -- (-583.551) [-584.597] (-585.048) (-583.522) * (-586.034) [-586.022] (-591.082) (-587.136) -- 0:00:38
      353000 -- (-584.768) [-586.266] (-591.309) (-585.955) * (-584.398) [-584.660] (-590.281) (-584.456) -- 0:00:38
      353500 -- (-584.612) (-588.463) (-585.142) [-585.120] * (-586.160) (-584.660) [-587.169] (-587.131) -- 0:00:38
      354000 -- (-583.458) (-584.864) [-584.876] (-590.457) * (-588.041) (-585.533) (-591.732) [-584.644] -- 0:00:38
      354500 -- (-585.297) (-585.501) (-585.334) [-585.487] * (-583.971) (-586.853) (-590.747) [-583.955] -- 0:00:38
      355000 -- [-585.099] (-584.961) (-586.402) (-587.768) * [-584.108] (-583.132) (-583.163) (-586.986) -- 0:00:38

      Average standard deviation of split frequencies: 0.012285

      355500 -- (-586.195) [-584.533] (-584.388) (-584.592) * (-583.894) (-585.605) (-583.900) [-585.063] -- 0:00:38
      356000 -- (-587.872) (-589.586) (-586.454) [-584.367] * [-583.692] (-584.937) (-584.600) (-588.349) -- 0:00:37
      356500 -- (-585.478) (-589.376) (-585.859) [-583.676] * [-583.081] (-588.690) (-586.311) (-586.634) -- 0:00:37
      357000 -- (-584.914) (-591.540) (-585.928) [-585.377] * (-585.030) (-586.119) (-588.367) [-586.739] -- 0:00:37
      357500 -- [-587.012] (-588.285) (-586.122) (-585.071) * (-584.990) [-586.030] (-590.582) (-587.526) -- 0:00:37
      358000 -- (-586.747) (-585.053) (-585.666) [-583.981] * (-583.539) (-583.819) [-586.548] (-591.466) -- 0:00:37
      358500 -- [-583.010] (-585.386) (-585.259) (-588.643) * (-583.957) (-587.222) [-585.245] (-585.631) -- 0:00:37
      359000 -- (-586.387) [-586.252] (-583.385) (-583.608) * (-586.276) [-584.407] (-589.052) (-583.579) -- 0:00:37
      359500 -- (-589.060) (-587.351) (-584.221) [-584.677] * (-583.937) [-585.503] (-585.517) (-583.562) -- 0:00:39
      360000 -- (-586.681) [-583.310] (-585.286) (-586.619) * (-582.825) [-586.267] (-585.408) (-583.555) -- 0:00:39

      Average standard deviation of split frequencies: 0.011473

      360500 -- (-584.861) (-584.617) (-583.594) [-583.865] * [-582.827] (-586.864) (-585.415) (-583.438) -- 0:00:39
      361000 -- (-583.871) (-584.174) (-584.054) [-583.399] * [-583.763] (-584.838) (-584.319) (-586.957) -- 0:00:38
      361500 -- (-585.488) [-584.375] (-586.520) (-584.721) * (-583.481) [-587.626] (-588.192) (-585.269) -- 0:00:38
      362000 -- (-588.231) [-583.696] (-585.537) (-586.589) * (-588.284) [-582.828] (-583.305) (-584.068) -- 0:00:38
      362500 -- (-583.899) [-585.091] (-583.717) (-586.118) * (-585.664) (-583.741) [-583.627] (-584.339) -- 0:00:38
      363000 -- (-587.826) (-583.743) [-587.855] (-587.302) * (-585.280) [-584.778] (-586.778) (-586.670) -- 0:00:38
      363500 -- [-583.598] (-587.110) (-584.582) (-584.570) * (-586.924) (-592.501) (-584.718) [-587.205] -- 0:00:38
      364000 -- (-583.670) [-586.327] (-585.131) (-585.526) * (-586.278) [-584.026] (-584.316) (-586.354) -- 0:00:38
      364500 -- [-583.376] (-584.919) (-584.310) (-583.522) * (-588.293) (-584.057) [-585.001] (-584.449) -- 0:00:38
      365000 -- (-583.765) [-584.637] (-584.254) (-585.642) * [-589.477] (-585.015) (-585.086) (-586.237) -- 0:00:38

      Average standard deviation of split frequencies: 0.011735

      365500 -- (-585.878) (-585.778) [-587.075] (-584.852) * (-587.783) (-582.945) (-584.952) [-583.637] -- 0:00:38
      366000 -- (-584.701) (-584.867) (-585.592) [-585.142] * (-584.377) (-583.941) (-584.293) [-584.877] -- 0:00:38
      366500 -- (-584.112) (-584.404) [-588.415] (-584.780) * (-584.034) [-583.054] (-583.330) (-584.979) -- 0:00:38
      367000 -- [-583.255] (-584.554) (-584.338) (-585.838) * (-584.433) [-587.304] (-583.795) (-588.784) -- 0:00:37
      367500 -- [-585.402] (-585.363) (-586.695) (-583.371) * (-588.827) (-588.548) [-585.434] (-583.249) -- 0:00:37
      368000 -- [-584.905] (-583.699) (-587.696) (-584.244) * [-587.198] (-590.239) (-587.766) (-585.542) -- 0:00:37
      368500 -- [-586.645] (-586.459) (-583.492) (-586.706) * (-586.094) [-583.367] (-585.742) (-586.391) -- 0:00:37
      369000 -- (-584.735) [-584.299] (-583.286) (-585.846) * (-588.502) [-583.701] (-585.455) (-587.921) -- 0:00:37
      369500 -- [-583.066] (-585.030) (-584.175) (-583.703) * (-586.923) [-584.696] (-584.776) (-587.553) -- 0:00:37
      370000 -- (-583.360) (-589.245) (-585.189) [-584.228] * [-585.913] (-588.051) (-587.889) (-584.873) -- 0:00:37

      Average standard deviation of split frequencies: 0.012493

      370500 -- (-584.089) [-583.456] (-583.920) (-583.610) * (-588.130) (-584.503) (-585.348) [-587.382] -- 0:00:37
      371000 -- (-585.355) [-584.076] (-585.045) (-583.398) * (-585.011) (-583.362) (-584.459) [-585.243] -- 0:00:37
      371500 -- (-585.270) (-584.732) (-584.046) [-583.216] * (-583.907) (-583.148) [-588.023] (-585.313) -- 0:00:37
      372000 -- (-584.986) (-584.004) [-582.784] (-589.124) * (-588.587) [-584.319] (-588.255) (-585.907) -- 0:00:37
      372500 -- [-585.174] (-585.786) (-583.755) (-583.225) * [-586.241] (-584.098) (-584.444) (-586.280) -- 0:00:37
      373000 -- (-584.979) (-582.993) (-583.739) [-584.034] * (-585.388) [-584.632] (-588.669) (-582.938) -- 0:00:36
      373500 -- (-583.920) (-584.792) (-589.358) [-585.213] * (-583.771) (-584.198) (-588.159) [-583.774] -- 0:00:36
      374000 -- (-583.983) (-586.565) (-585.459) [-584.447] * (-585.795) [-583.406] (-585.798) (-583.318) -- 0:00:36
      374500 -- (-584.968) (-584.000) [-584.346] (-587.614) * (-584.826) [-583.595] (-586.284) (-584.014) -- 0:00:36
      375000 -- (-585.119) (-586.986) [-583.464] (-584.003) * [-584.313] (-583.642) (-586.732) (-584.565) -- 0:00:36

      Average standard deviation of split frequencies: 0.011841

      375500 -- (-585.135) (-585.065) (-587.629) [-583.890] * (-584.654) (-583.995) [-585.043] (-583.936) -- 0:00:36
      376000 -- (-583.987) [-584.212] (-588.558) (-591.747) * (-583.971) (-583.627) [-586.041] (-586.724) -- 0:00:36
      376500 -- (-582.984) (-585.855) (-585.837) [-589.970] * (-584.615) [-583.525] (-585.472) (-583.568) -- 0:00:38
      377000 -- [-585.222] (-585.991) (-583.952) (-584.883) * [-582.983] (-585.767) (-584.620) (-584.512) -- 0:00:38
      377500 -- [-583.659] (-586.154) (-585.533) (-586.291) * (-586.452) [-584.995] (-584.053) (-582.983) -- 0:00:37
      378000 -- (-583.861) [-584.210] (-583.422) (-586.685) * (-586.613) (-587.681) [-585.466] (-583.585) -- 0:00:37
      378500 -- [-586.811] (-586.916) (-583.664) (-586.951) * (-583.656) (-587.655) [-584.322] (-583.473) -- 0:00:37
      379000 -- (-586.162) (-586.316) [-590.012] (-587.557) * (-585.143) (-584.141) [-584.222] (-584.105) -- 0:00:37
      379500 -- (-588.261) [-589.169] (-589.985) (-583.958) * [-583.451] (-585.431) (-585.056) (-587.192) -- 0:00:37
      380000 -- (-582.900) (-583.710) [-588.147] (-584.393) * (-583.773) (-584.470) [-584.012] (-587.718) -- 0:00:37

      Average standard deviation of split frequencies: 0.011902

      380500 -- (-585.558) (-584.779) [-585.154] (-586.552) * (-586.755) (-583.861) (-583.561) [-584.987] -- 0:00:37
      381000 -- (-585.286) (-583.846) (-586.069) [-584.825] * (-587.118) [-583.922] (-583.945) (-585.129) -- 0:00:37
      381500 -- (-587.172) (-588.982) (-586.888) [-585.525] * (-584.106) [-587.653] (-583.691) (-585.966) -- 0:00:37
      382000 -- (-585.422) (-584.391) [-587.558] (-587.124) * (-584.420) [-583.923] (-584.161) (-583.760) -- 0:00:37
      382500 -- (-583.920) (-583.597) (-584.424) [-587.069] * (-583.441) (-586.634) (-586.528) [-583.293] -- 0:00:37
      383000 -- [-583.603] (-586.641) (-585.169) (-584.182) * [-585.770] (-583.800) (-585.775) (-583.635) -- 0:00:37
      383500 -- (-583.489) (-585.618) (-587.684) [-588.173] * (-585.246) (-584.171) (-588.413) [-584.104] -- 0:00:36
      384000 -- (-587.062) (-585.362) (-587.605) [-583.492] * (-588.135) [-584.410] (-586.029) (-585.647) -- 0:00:36
      384500 -- (-588.181) (-584.618) (-589.090) [-584.055] * (-585.775) [-584.249] (-585.612) (-586.219) -- 0:00:36
      385000 -- (-584.524) (-584.371) (-584.172) [-584.240] * (-583.753) [-586.613] (-584.783) (-584.905) -- 0:00:36

      Average standard deviation of split frequencies: 0.011873

      385500 -- [-585.683] (-586.326) (-583.754) (-584.456) * (-583.676) [-585.197] (-585.112) (-585.652) -- 0:00:36
      386000 -- (-587.341) [-586.861] (-584.460) (-583.562) * [-584.462] (-586.503) (-588.804) (-588.321) -- 0:00:36
      386500 -- (-584.866) (-586.696) (-585.478) [-589.075] * (-586.580) [-584.339] (-587.424) (-588.174) -- 0:00:36
      387000 -- (-584.744) [-587.113] (-587.096) (-588.282) * [-586.548] (-585.159) (-586.983) (-584.928) -- 0:00:36
      387500 -- (-586.654) (-585.486) (-585.671) [-585.244] * (-585.589) (-585.010) [-585.961] (-583.934) -- 0:00:36
      388000 -- (-585.726) (-585.902) (-583.783) [-583.666] * (-588.199) (-585.933) [-583.069] (-584.464) -- 0:00:36
      388500 -- (-585.737) (-585.823) [-585.538] (-588.818) * (-583.018) (-585.871) [-585.985] (-584.550) -- 0:00:36
      389000 -- (-585.642) [-585.556] (-583.996) (-585.519) * (-591.955) (-585.933) (-586.306) [-584.120] -- 0:00:36
      389500 -- (-585.673) (-589.393) (-583.581) [-584.589] * (-585.050) [-583.544] (-585.583) (-583.383) -- 0:00:36
      390000 -- (-585.534) (-585.139) (-585.110) [-583.394] * (-584.962) [-584.357] (-591.514) (-583.299) -- 0:00:35

      Average standard deviation of split frequencies: 0.012989

      390500 -- (-584.791) [-584.459] (-584.182) (-587.676) * [-586.090] (-587.950) (-584.357) (-584.956) -- 0:00:35
      391000 -- (-585.778) (-584.790) (-584.192) [-587.097] * (-586.151) (-585.491) [-583.909] (-593.392) -- 0:00:35
      391500 -- (-582.848) (-583.991) (-583.363) [-585.588] * [-583.569] (-584.094) (-584.739) (-584.688) -- 0:00:35
      392000 -- (-582.853) (-586.788) [-583.583] (-584.057) * [-583.458] (-585.601) (-583.397) (-585.527) -- 0:00:35
      392500 -- (-584.609) (-585.298) [-583.772] (-584.406) * (-584.860) (-591.608) [-585.306] (-584.995) -- 0:00:35
      393000 -- (-585.262) (-585.219) [-584.352] (-583.507) * (-584.022) [-589.164] (-584.522) (-586.967) -- 0:00:35
      393500 -- (-587.081) (-584.860) [-584.273] (-584.630) * (-583.270) (-586.993) (-584.103) [-586.785] -- 0:00:36
      394000 -- (-586.117) (-586.907) (-587.172) [-585.195] * (-584.115) (-584.203) [-584.523] (-584.832) -- 0:00:36
      394500 -- (-585.886) (-586.644) (-584.126) [-584.929] * [-585.010] (-584.401) (-584.556) (-584.621) -- 0:00:36
      395000 -- (-586.587) (-585.249) [-583.983] (-584.716) * (-586.730) (-583.671) (-584.714) [-584.419] -- 0:00:36

      Average standard deviation of split frequencies: 0.013161

      395500 -- (-585.698) (-585.629) (-583.457) [-583.960] * (-585.238) [-583.716] (-584.260) (-586.387) -- 0:00:36
      396000 -- (-585.437) (-585.076) (-584.991) [-584.320] * (-584.681) (-583.689) (-584.295) [-586.136] -- 0:00:36
      396500 -- (-588.212) (-584.301) [-582.927] (-586.404) * [-587.908] (-585.647) (-585.502) (-587.020) -- 0:00:36
      397000 -- (-586.656) (-584.991) [-585.534] (-586.416) * (-584.297) (-589.648) (-586.611) [-586.451] -- 0:00:36
      397500 -- [-589.540] (-585.083) (-583.941) (-586.370) * (-585.696) (-584.045) (-586.786) [-585.594] -- 0:00:36
      398000 -- (-586.757) (-585.654) [-584.188] (-588.457) * [-584.362] (-585.268) (-585.981) (-587.355) -- 0:00:36
      398500 -- [-585.038] (-583.997) (-587.089) (-583.640) * [-585.061] (-584.640) (-586.271) (-597.654) -- 0:00:36
      399000 -- [-583.219] (-583.498) (-584.764) (-584.712) * (-584.694) [-587.185] (-584.607) (-594.694) -- 0:00:36
      399500 -- (-583.482) (-585.471) (-585.206) [-584.088] * (-588.060) (-586.690) (-586.369) [-585.639] -- 0:00:36
      400000 -- [-583.113] (-584.306) (-585.460) (-584.100) * (-583.995) (-587.020) (-587.435) [-584.493] -- 0:00:36

      Average standard deviation of split frequencies: 0.013269

      400500 -- (-584.818) (-586.197) [-583.476] (-584.440) * [-585.011] (-584.730) (-586.070) (-586.258) -- 0:00:35
      401000 -- (-584.190) [-586.464] (-583.702) (-583.297) * (-586.327) (-586.934) (-584.775) [-584.359] -- 0:00:35
      401500 -- (-582.892) [-583.390] (-584.422) (-583.502) * (-585.902) (-585.309) (-584.083) [-583.747] -- 0:00:35
      402000 -- (-585.023) (-583.851) (-584.866) [-584.440] * (-584.995) [-583.474] (-585.930) (-583.395) -- 0:00:35
      402500 -- (-584.474) [-585.623] (-587.379) (-588.048) * (-584.878) (-583.184) [-583.574] (-583.708) -- 0:00:35
      403000 -- [-584.595] (-584.494) (-583.677) (-584.559) * (-583.725) (-584.809) [-585.447] (-586.014) -- 0:00:35
      403500 -- (-586.588) (-584.111) [-588.504] (-584.513) * (-584.042) (-587.035) [-587.917] (-582.968) -- 0:00:35
      404000 -- (-586.307) (-588.382) [-585.058] (-583.429) * [-585.359] (-587.606) (-586.656) (-585.006) -- 0:00:35
      404500 -- [-588.651] (-587.903) (-586.552) (-584.484) * [-585.851] (-586.346) (-586.533) (-585.594) -- 0:00:35
      405000 -- (-584.469) (-585.810) (-585.058) [-583.321] * (-583.565) (-584.316) [-584.733] (-584.561) -- 0:00:35

      Average standard deviation of split frequencies: 0.013095

      405500 -- [-587.333] (-584.740) (-585.327) (-584.829) * [-583.417] (-588.453) (-585.823) (-583.255) -- 0:00:35
      406000 -- (-583.544) (-585.701) (-589.031) [-585.544] * [-584.336] (-586.534) (-585.686) (-583.287) -- 0:00:35
      406500 -- [-589.615] (-586.926) (-584.044) (-583.138) * (-586.872) (-584.751) [-585.860] (-587.311) -- 0:00:35
      407000 -- [-586.330] (-583.599) (-584.641) (-585.032) * [-586.103] (-584.115) (-585.462) (-587.144) -- 0:00:34
      407500 -- [-584.292] (-586.552) (-585.488) (-587.024) * [-584.771] (-584.695) (-586.425) (-587.624) -- 0:00:34
      408000 -- (-585.175) (-584.716) (-586.190) [-584.686] * [-584.974] (-585.425) (-585.532) (-585.177) -- 0:00:34
      408500 -- (-585.157) (-586.316) [-584.455] (-585.426) * (-583.915) (-587.287) [-584.283] (-584.188) -- 0:00:34
      409000 -- (-584.463) [-584.896] (-583.660) (-583.205) * (-583.252) [-585.436] (-589.428) (-589.909) -- 0:00:34
      409500 -- [-585.703] (-586.467) (-588.439) (-583.351) * (-588.259) (-589.913) [-586.677] (-584.501) -- 0:00:34
      410000 -- (-584.355) [-588.370] (-586.921) (-583.351) * (-586.339) (-586.666) (-586.135) [-583.592] -- 0:00:35

      Average standard deviation of split frequencies: 0.013505

      410500 -- (-585.464) [-584.145] (-586.352) (-585.247) * (-583.570) (-587.147) (-584.158) [-583.823] -- 0:00:35
      411000 -- (-583.282) [-584.276] (-588.961) (-585.791) * [-583.234] (-587.273) (-586.553) (-585.677) -- 0:00:35
      411500 -- (-585.427) [-583.572] (-583.907) (-587.087) * [-585.262] (-586.373) (-586.251) (-585.877) -- 0:00:35
      412000 -- (-584.021) (-586.639) [-582.881] (-585.494) * [-586.530] (-585.853) (-585.234) (-582.772) -- 0:00:35
      412500 -- (-584.217) (-585.013) (-583.406) [-585.956] * (-589.784) [-583.655] (-584.918) (-583.799) -- 0:00:35
      413000 -- (-586.336) [-585.579] (-586.528) (-586.251) * (-587.193) (-584.689) [-586.203] (-583.576) -- 0:00:35
      413500 -- [-584.149] (-584.098) (-585.413) (-589.506) * (-583.056) [-583.792] (-593.079) (-583.196) -- 0:00:35
      414000 -- [-584.659] (-587.281) (-586.428) (-584.755) * [-585.781] (-584.724) (-584.423) (-583.361) -- 0:00:35
      414500 -- [-583.863] (-584.167) (-589.184) (-584.692) * [-584.507] (-584.629) (-584.912) (-587.964) -- 0:00:35
      415000 -- (-583.882) [-586.791] (-585.577) (-586.297) * (-589.031) [-587.832] (-583.637) (-584.848) -- 0:00:35

      Average standard deviation of split frequencies: 0.013265

      415500 -- [-583.856] (-587.969) (-585.436) (-582.878) * [-585.202] (-583.908) (-584.300) (-583.035) -- 0:00:35
      416000 -- (-588.144) [-588.034] (-585.709) (-584.162) * (-586.277) (-589.867) [-585.205] (-586.194) -- 0:00:35
      416500 -- (-588.286) [-586.292] (-583.064) (-585.084) * (-585.544) (-586.269) [-585.738] (-583.458) -- 0:00:35
      417000 -- [-589.161] (-585.831) (-583.663) (-590.530) * [-583.887] (-586.561) (-583.975) (-587.745) -- 0:00:34
      417500 -- [-584.117] (-583.869) (-583.475) (-585.416) * (-584.415) (-585.041) (-583.817) [-585.221] -- 0:00:34
      418000 -- (-583.985) [-583.596] (-583.326) (-585.062) * (-583.930) (-584.837) [-585.671] (-585.514) -- 0:00:34
      418500 -- (-583.894) [-584.576] (-585.825) (-584.796) * (-583.848) (-584.983) [-584.590] (-585.575) -- 0:00:34
      419000 -- (-588.223) (-585.324) [-584.686] (-584.194) * (-588.503) (-585.360) [-583.039] (-585.242) -- 0:00:34
      419500 -- (-584.497) (-585.494) (-583.598) [-585.580] * (-588.196) [-584.730] (-584.627) (-584.073) -- 0:00:34
      420000 -- (-588.503) [-583.431] (-583.704) (-584.723) * [-585.581] (-584.699) (-586.105) (-587.215) -- 0:00:34

      Average standard deviation of split frequencies: 0.013136

      420500 -- (-584.571) (-586.168) (-584.233) [-587.484] * (-584.164) (-585.406) [-586.572] (-588.254) -- 0:00:34
      421000 -- (-587.445) [-584.620] (-588.107) (-588.859) * (-584.307) (-583.209) [-585.650] (-584.615) -- 0:00:34
      421500 -- (-583.531) [-584.961] (-585.844) (-586.693) * [-586.663] (-584.172) (-584.811) (-587.162) -- 0:00:34
      422000 -- (-583.612) [-584.584] (-583.911) (-583.674) * [-586.168] (-584.251) (-586.550) (-586.416) -- 0:00:34
      422500 -- (-585.374) (-583.247) [-584.776] (-583.283) * (-585.433) (-586.334) (-584.351) [-584.480] -- 0:00:34
      423000 -- (-584.643) (-584.335) (-583.908) [-583.531] * [-584.501] (-587.856) (-584.105) (-589.335) -- 0:00:34
      423500 -- (-584.010) [-588.023] (-584.602) (-583.838) * [-587.772] (-585.643) (-583.851) (-587.622) -- 0:00:34
      424000 -- (-584.740) (-585.713) [-583.888] (-584.646) * (-586.582) (-584.522) [-584.713] (-583.612) -- 0:00:33
      424500 -- [-585.045] (-584.942) (-585.630) (-586.509) * (-584.596) (-583.460) [-584.543] (-585.606) -- 0:00:33
      425000 -- (-583.109) [-585.701] (-586.958) (-588.168) * (-583.778) (-583.094) [-585.183] (-584.124) -- 0:00:33

      Average standard deviation of split frequencies: 0.013771

      425500 -- (-589.542) (-585.367) [-585.019] (-590.125) * [-584.794] (-585.084) (-585.476) (-584.216) -- 0:00:33
      426000 -- (-583.972) (-583.354) (-586.494) [-588.040] * (-587.050) [-585.586] (-585.117) (-583.509) -- 0:00:33
      426500 -- (-583.306) (-584.736) [-585.761] (-584.372) * (-584.737) [-583.631] (-589.600) (-584.434) -- 0:00:33
      427000 -- (-586.779) (-585.626) (-585.616) [-583.181] * [-585.086] (-585.601) (-587.330) (-588.354) -- 0:00:34
      427500 -- [-585.220] (-584.131) (-584.804) (-584.189) * (-589.792) [-584.542] (-586.759) (-584.096) -- 0:00:34
      428000 -- (-584.378) [-589.662] (-584.433) (-587.171) * [-587.245] (-583.767) (-584.040) (-584.049) -- 0:00:34
      428500 -- (-584.208) (-588.017) (-583.104) [-588.650] * (-585.054) (-585.857) [-583.930] (-584.421) -- 0:00:34
      429000 -- (-586.619) (-585.755) [-587.131] (-587.338) * [-584.581] (-585.339) (-583.581) (-584.128) -- 0:00:34
      429500 -- (-584.556) [-584.460] (-583.713) (-584.001) * [-583.524] (-584.738) (-584.262) (-592.234) -- 0:00:34
      430000 -- (-584.938) [-587.146] (-587.253) (-585.117) * (-584.937) (-583.555) [-585.161] (-587.482) -- 0:00:34

      Average standard deviation of split frequencies: 0.014595

      430500 -- (-586.280) (-586.542) (-585.617) [-583.568] * [-584.038] (-583.235) (-588.032) (-585.587) -- 0:00:34
      431000 -- (-590.413) (-587.177) [-583.646] (-584.138) * (-584.061) [-583.707] (-585.489) (-583.258) -- 0:00:34
      431500 -- (-584.254) (-583.721) [-584.537] (-586.720) * [-583.986] (-584.397) (-590.386) (-589.670) -- 0:00:34
      432000 -- [-583.588] (-584.000) (-585.918) (-583.251) * [-589.122] (-586.605) (-590.331) (-586.405) -- 0:00:34
      432500 -- [-588.287] (-584.647) (-589.489) (-587.206) * [-582.849] (-586.089) (-586.160) (-583.882) -- 0:00:34
      433000 -- (-583.709) (-585.674) [-585.645] (-585.684) * (-585.675) (-584.762) [-585.916] (-585.664) -- 0:00:34
      433500 -- (-584.211) (-584.377) [-584.293] (-586.339) * (-583.416) (-585.704) [-589.584] (-584.019) -- 0:00:33
      434000 -- (-584.760) [-584.885] (-584.024) (-585.429) * (-584.578) (-583.626) [-583.226] (-584.108) -- 0:00:33
      434500 -- [-585.577] (-585.778) (-584.797) (-584.686) * (-585.824) (-583.891) (-584.318) [-584.666] -- 0:00:33
      435000 -- (-584.807) [-584.713] (-590.060) (-586.940) * [-585.161] (-586.751) (-584.716) (-583.887) -- 0:00:33

      Average standard deviation of split frequencies: 0.014716

      435500 -- (-585.357) (-584.428) [-587.323] (-586.736) * [-584.955] (-587.287) (-587.907) (-583.607) -- 0:00:33
      436000 -- (-583.045) (-589.051) [-583.131] (-585.275) * (-584.672) [-585.835] (-588.212) (-584.691) -- 0:00:33
      436500 -- (-587.694) (-594.215) [-583.992] (-586.104) * (-584.526) (-587.852) [-586.252] (-583.945) -- 0:00:33
      437000 -- (-585.483) [-584.995] (-584.958) (-584.074) * (-584.323) [-588.215] (-589.809) (-587.193) -- 0:00:33
      437500 -- (-584.749) (-584.868) [-587.262] (-584.544) * (-586.135) (-584.535) (-585.314) [-583.548] -- 0:00:33
      438000 -- (-585.038) (-584.875) [-584.544] (-585.186) * (-583.445) [-585.094] (-583.799) (-586.577) -- 0:00:33
      438500 -- (-585.893) [-583.426] (-583.922) (-586.145) * (-583.185) [-583.696] (-585.918) (-588.500) -- 0:00:33
      439000 -- (-584.133) (-585.206) [-584.581] (-584.943) * (-584.591) (-583.080) (-583.916) [-584.830] -- 0:00:33
      439500 -- (-584.076) (-584.280) [-583.945] (-582.952) * (-587.889) (-582.843) (-583.857) [-583.732] -- 0:00:33
      440000 -- [-585.041] (-584.230) (-584.901) (-583.647) * (-582.992) (-584.864) (-585.216) [-586.709] -- 0:00:33

      Average standard deviation of split frequencies: 0.015795

      440500 -- (-586.344) (-584.442) [-584.600] (-586.729) * (-582.950) [-584.569] (-587.266) (-583.293) -- 0:00:33
      441000 -- (-589.528) (-587.882) [-587.841] (-588.968) * [-586.311] (-584.620) (-586.543) (-589.764) -- 0:00:32
      441500 -- (-585.520) (-583.559) [-584.152] (-590.950) * (-587.767) (-586.962) (-584.162) [-583.265] -- 0:00:32
      442000 -- [-586.632] (-584.123) (-583.425) (-584.134) * (-585.201) [-588.013] (-587.063) (-585.213) -- 0:00:32
      442500 -- (-584.865) (-585.499) [-584.074] (-584.972) * (-583.335) (-586.444) [-585.813] (-585.352) -- 0:00:32
      443000 -- (-585.610) (-587.036) (-582.943) [-587.208] * (-589.993) (-586.269) (-584.852) [-585.259] -- 0:00:32
      443500 -- (-585.384) (-588.620) [-583.564] (-587.880) * (-583.298) (-585.167) [-583.912] (-582.895) -- 0:00:32
      444000 -- (-584.702) [-585.755] (-583.555) (-588.520) * (-591.635) [-585.239] (-587.532) (-584.207) -- 0:00:33
      444500 -- (-585.433) (-588.831) (-585.864) [-583.273] * [-584.137] (-583.828) (-585.186) (-583.219) -- 0:00:33
      445000 -- (-585.779) [-585.712] (-586.063) (-584.088) * (-586.591) (-583.441) [-586.322] (-584.529) -- 0:00:33

      Average standard deviation of split frequencies: 0.014856

      445500 -- (-584.238) (-584.078) [-584.881] (-583.510) * (-584.605) [-584.161] (-586.353) (-584.127) -- 0:00:33
      446000 -- (-584.017) [-584.257] (-584.949) (-584.252) * [-584.675] (-585.784) (-584.915) (-585.741) -- 0:00:33
      446500 -- (-586.434) [-584.699] (-591.445) (-590.346) * (-584.255) (-586.661) [-583.979] (-583.702) -- 0:00:33
      447000 -- (-584.752) [-587.879] (-586.678) (-588.708) * (-584.482) [-585.709] (-584.833) (-585.529) -- 0:00:33
      447500 -- (-584.790) [-589.119] (-585.521) (-584.198) * (-583.737) (-585.991) (-586.904) [-584.593] -- 0:00:33
      448000 -- (-584.228) [-586.962] (-584.836) (-585.262) * (-583.204) (-584.362) [-583.687] (-586.499) -- 0:00:33
      448500 -- [-586.336] (-584.720) (-587.126) (-586.364) * (-583.760) (-583.500) [-585.679] (-586.878) -- 0:00:33
      449000 -- (-584.904) (-587.105) [-586.818] (-588.606) * (-585.258) [-584.377] (-584.083) (-584.930) -- 0:00:33
      449500 -- (-585.623) (-584.013) [-588.019] (-583.788) * (-583.535) [-585.567] (-587.769) (-586.345) -- 0:00:33
      450000 -- (-584.817) [-584.296] (-588.086) (-585.561) * (-589.659) [-583.585] (-585.708) (-586.004) -- 0:00:33

      Average standard deviation of split frequencies: 0.014829

      450500 -- (-584.793) (-584.593) (-585.794) [-584.654] * [-583.966] (-583.943) (-586.652) (-583.715) -- 0:00:32
      451000 -- (-585.213) [-587.497] (-584.032) (-586.618) * (-583.612) (-584.418) [-584.549] (-587.581) -- 0:00:32
      451500 -- [-585.004] (-586.559) (-584.437) (-588.358) * (-583.634) (-584.285) [-583.908] (-584.411) -- 0:00:32
      452000 -- (-585.544) (-585.491) [-584.178] (-583.488) * (-587.182) (-585.418) [-584.554] (-584.695) -- 0:00:32
      452500 -- [-585.926] (-584.386) (-586.061) (-583.810) * (-587.889) [-584.782] (-583.274) (-583.629) -- 0:00:32
      453000 -- (-583.609) (-584.155) [-586.597] (-586.961) * [-587.394] (-585.006) (-586.268) (-585.553) -- 0:00:32
      453500 -- (-585.226) (-584.998) [-586.724] (-586.375) * (-587.443) (-585.205) [-587.282] (-585.638) -- 0:00:32
      454000 -- (-587.956) (-584.290) [-583.424] (-586.788) * (-587.939) [-583.289] (-585.906) (-583.264) -- 0:00:32
      454500 -- (-586.262) (-584.083) (-584.047) [-585.233] * (-585.094) [-585.620] (-584.394) (-584.780) -- 0:00:32
      455000 -- (-583.680) (-584.322) (-583.641) [-582.847] * (-586.203) (-585.178) [-587.377] (-582.943) -- 0:00:32

      Average standard deviation of split frequencies: 0.014534

      455500 -- (-584.938) (-583.884) (-584.923) [-582.841] * [-584.108] (-584.820) (-583.869) (-586.564) -- 0:00:32
      456000 -- [-586.693] (-584.212) (-587.597) (-585.906) * (-586.171) (-584.595) [-583.561] (-584.084) -- 0:00:32
      456500 -- (-586.189) (-584.173) (-588.638) [-584.576] * (-588.837) (-585.968) (-583.876) [-583.739] -- 0:00:32
      457000 -- (-586.874) (-583.859) (-585.035) [-583.283] * (-586.416) (-586.939) [-585.960] (-584.077) -- 0:00:32
      457500 -- (-586.536) (-587.578) (-586.801) [-585.175] * (-584.003) [-584.785] (-585.295) (-586.075) -- 0:00:32
      458000 -- (-584.793) (-591.310) (-585.974) [-583.496] * [-584.110] (-586.686) (-585.161) (-583.911) -- 0:00:31
      458500 -- (-587.351) [-585.743] (-584.496) (-588.734) * (-584.240) (-585.418) [-583.413] (-586.492) -- 0:00:31
      459000 -- (-586.633) [-588.572] (-586.845) (-586.345) * (-587.410) (-585.001) (-583.184) [-585.815] -- 0:00:31
      459500 -- (-585.105) (-585.691) (-584.106) [-584.302] * (-583.586) [-586.774] (-583.903) (-589.588) -- 0:00:31
      460000 -- (-584.442) [-586.400] (-589.132) (-584.535) * [-585.091] (-590.346) (-587.145) (-584.297) -- 0:00:31

      Average standard deviation of split frequencies: 0.013664

      460500 -- (-584.063) (-584.801) [-587.931] (-585.499) * (-584.592) (-584.952) [-585.375] (-583.252) -- 0:00:32
      461000 -- (-583.794) (-584.091) (-586.994) [-585.185] * (-589.085) [-586.566] (-592.090) (-585.146) -- 0:00:32
      461500 -- (-583.310) [-586.167] (-586.080) (-583.442) * (-585.294) (-585.042) [-584.082] (-584.167) -- 0:00:32
      462000 -- (-591.580) (-585.994) [-585.613] (-584.147) * (-585.120) (-585.366) [-583.998] (-582.690) -- 0:00:32
      462500 -- (-586.726) (-589.666) [-583.401] (-584.669) * [-583.513] (-583.753) (-585.447) (-585.689) -- 0:00:32
      463000 -- (-585.849) (-587.463) [-583.742] (-591.774) * (-587.370) [-584.702] (-585.569) (-584.418) -- 0:00:32
      463500 -- (-586.768) [-585.712] (-584.399) (-584.695) * (-584.378) [-583.281] (-583.523) (-583.563) -- 0:00:32
      464000 -- (-585.191) [-588.110] (-585.928) (-582.941) * (-584.589) (-584.823) [-582.854] (-586.427) -- 0:00:32
      464500 -- (-583.259) (-585.016) [-587.235] (-585.805) * (-587.665) (-583.191) (-587.187) [-583.550] -- 0:00:32
      465000 -- [-586.775] (-586.356) (-585.858) (-585.450) * (-586.076) (-582.869) (-583.517) [-585.535] -- 0:00:32

      Average standard deviation of split frequencies: 0.012645

      465500 -- (-587.460) (-584.736) [-585.140] (-583.511) * (-583.497) [-589.980] (-583.823) (-586.943) -- 0:00:32
      466000 -- (-591.339) (-584.332) [-584.895] (-584.839) * (-586.055) [-585.950] (-583.799) (-587.381) -- 0:00:32
      466500 -- (-583.497) (-584.158) (-584.939) [-584.644] * (-586.135) (-583.968) [-583.312] (-587.270) -- 0:00:32
      467000 -- [-585.400] (-585.311) (-586.014) (-587.982) * (-585.760) (-587.636) [-583.933] (-586.962) -- 0:00:31
      467500 -- (-584.740) (-584.498) (-584.681) [-586.928] * (-589.610) [-586.053] (-584.059) (-586.199) -- 0:00:31
      468000 -- (-584.060) (-586.294) [-588.313] (-590.306) * (-588.127) [-585.251] (-583.472) (-586.531) -- 0:00:31
      468500 -- (-583.889) (-589.914) [-586.520] (-583.532) * (-588.080) (-585.488) [-584.366] (-586.138) -- 0:00:31
      469000 -- (-583.253) (-585.716) (-586.734) [-584.523] * (-588.263) (-585.959) [-583.270] (-584.520) -- 0:00:31
      469500 -- (-584.462) (-583.762) [-587.304] (-584.647) * (-584.725) (-586.332) [-584.371] (-583.140) -- 0:00:31
      470000 -- (-583.923) (-585.155) [-584.791] (-584.079) * (-583.348) [-585.090] (-585.818) (-585.974) -- 0:00:31

      Average standard deviation of split frequencies: 0.012078

      470500 -- (-585.360) [-589.248] (-587.269) (-583.467) * (-584.640) (-583.777) (-584.755) [-587.036] -- 0:00:31
      471000 -- (-587.033) (-584.565) (-583.529) [-586.982] * (-585.243) [-584.615] (-584.428) (-587.860) -- 0:00:31
      471500 -- (-584.512) (-585.701) [-583.057] (-586.480) * [-584.825] (-585.343) (-583.343) (-586.710) -- 0:00:31
      472000 -- (-582.996) (-583.248) (-585.896) [-584.721] * (-587.526) [-586.017] (-586.217) (-583.842) -- 0:00:31
      472500 -- (-584.994) (-585.041) (-584.756) [-584.475] * (-588.350) (-589.168) [-586.317] (-590.380) -- 0:00:31
      473000 -- [-583.117] (-587.085) (-586.623) (-586.647) * (-585.586) (-590.048) [-584.252] (-586.950) -- 0:00:31
      473500 -- (-584.110) [-587.625] (-583.738) (-584.612) * [-582.966] (-586.830) (-586.087) (-584.073) -- 0:00:31
      474000 -- (-583.612) (-586.851) (-586.246) [-585.846] * (-586.593) (-587.758) (-586.639) [-583.828] -- 0:00:31
      474500 -- (-585.332) (-589.302) (-591.767) [-583.009] * (-585.146) (-586.552) (-583.224) [-584.916] -- 0:00:31
      475000 -- (-584.951) (-587.317) (-584.460) [-582.872] * (-584.504) [-589.728] (-585.777) (-587.391) -- 0:00:30

      Average standard deviation of split frequencies: 0.011593

      475500 -- [-584.761] (-583.510) (-585.267) (-586.888) * [-586.055] (-586.693) (-584.899) (-585.932) -- 0:00:30
      476000 -- (-586.454) (-583.330) (-587.199) [-583.206] * (-587.264) [-583.884] (-584.895) (-585.991) -- 0:00:30
      476500 -- (-586.091) [-583.523] (-583.970) (-583.955) * (-588.386) (-584.146) (-585.346) [-583.886] -- 0:00:30
      477000 -- [-584.641] (-587.114) (-586.208) (-584.182) * (-583.163) (-585.317) (-583.474) [-584.196] -- 0:00:30
      477500 -- (-585.848) (-586.602) [-583.531] (-586.934) * (-584.520) [-585.325] (-583.416) (-588.382) -- 0:00:31
      478000 -- (-585.124) [-583.322] (-583.195) (-588.356) * (-585.037) [-585.327] (-583.561) (-590.031) -- 0:00:31
      478500 -- (-584.310) [-583.273] (-583.502) (-585.259) * (-584.922) [-586.417] (-587.082) (-589.262) -- 0:00:31
      479000 -- (-583.814) [-584.570] (-582.942) (-583.588) * [-583.116] (-589.686) (-586.988) (-586.312) -- 0:00:31
      479500 -- (-584.847) [-584.331] (-582.783) (-583.234) * (-583.210) (-588.681) (-589.622) [-585.510] -- 0:00:31
      480000 -- (-586.293) [-583.490] (-583.043) (-590.368) * (-584.770) (-583.760) (-584.540) [-585.595] -- 0:00:31

      Average standard deviation of split frequencies: 0.011033

      480500 -- (-584.092) [-583.489] (-591.483) (-588.112) * (-585.681) (-586.677) (-584.008) [-584.698] -- 0:00:31
      481000 -- [-584.494] (-585.410) (-583.681) (-585.752) * [-587.041] (-586.068) (-584.852) (-584.997) -- 0:00:31
      481500 -- (-584.416) [-583.957] (-583.681) (-584.128) * [-583.923] (-586.119) (-583.861) (-586.264) -- 0:00:31
      482000 -- (-584.577) (-587.962) [-584.179] (-584.771) * (-590.140) (-585.266) (-588.742) [-585.037] -- 0:00:31
      482500 -- (-587.181) (-586.904) (-585.787) [-587.100] * (-585.112) (-586.845) [-586.516] (-586.742) -- 0:00:31
      483000 -- (-585.711) [-583.698] (-588.968) (-585.039) * (-588.016) [-589.098] (-586.339) (-589.906) -- 0:00:31
      483500 -- [-585.546] (-596.781) (-584.408) (-586.027) * (-583.123) (-585.029) [-587.211] (-585.015) -- 0:00:30
      484000 -- [-585.985] (-587.145) (-584.590) (-583.869) * (-585.717) (-587.456) [-584.734] (-584.470) -- 0:00:30
      484500 -- (-587.211) (-583.976) [-583.337] (-584.082) * (-585.414) (-583.786) [-585.715] (-584.890) -- 0:00:30
      485000 -- (-586.201) [-584.733] (-589.106) (-586.912) * (-583.596) (-584.185) (-585.972) [-584.517] -- 0:00:30

      Average standard deviation of split frequencies: 0.011518

      485500 -- (-584.978) (-585.526) (-586.173) [-585.828] * (-585.910) [-584.201] (-585.679) (-583.249) -- 0:00:30
      486000 -- (-587.627) (-585.753) (-584.442) [-583.051] * [-583.676] (-583.598) (-584.457) (-586.476) -- 0:00:30
      486500 -- (-584.948) (-586.766) [-584.105] (-583.477) * (-585.606) (-583.313) (-586.147) [-586.803] -- 0:00:30
      487000 -- (-583.481) (-585.633) [-583.933] (-588.933) * [-585.078] (-583.313) (-587.635) (-583.670) -- 0:00:30
      487500 -- [-584.671] (-585.841) (-584.529) (-583.791) * (-585.793) (-583.214) (-586.265) [-586.051] -- 0:00:30
      488000 -- (-585.038) [-586.430] (-590.664) (-586.591) * (-584.775) (-583.458) (-586.134) [-585.356] -- 0:00:30
      488500 -- [-584.203] (-583.235) (-584.402) (-586.723) * (-585.060) [-583.511] (-584.293) (-586.257) -- 0:00:30
      489000 -- (-586.120) (-582.969) [-583.593] (-585.209) * [-583.660] (-583.328) (-583.298) (-584.527) -- 0:00:30
      489500 -- (-588.509) (-586.143) (-588.166) [-584.876] * (-583.855) [-582.927] (-583.805) (-586.570) -- 0:00:30
      490000 -- [-584.506] (-586.571) (-583.605) (-584.314) * (-586.980) (-585.516) (-585.608) [-584.386] -- 0:00:30

      Average standard deviation of split frequencies: 0.010568

      490500 -- (-585.075) (-587.870) (-585.037) [-584.035] * (-587.356) (-585.469) [-584.569] (-584.751) -- 0:00:30
      491000 -- [-587.144] (-586.746) (-585.889) (-584.984) * (-584.621) (-586.099) (-591.699) [-584.414] -- 0:00:30
      491500 -- (-583.816) (-585.256) [-584.352] (-585.781) * [-584.283] (-583.777) (-586.540) (-584.182) -- 0:00:30
      492000 -- (-586.272) (-585.797) [-585.975] (-585.299) * [-587.576] (-587.914) (-590.993) (-583.788) -- 0:00:29
      492500 -- (-583.575) (-582.919) (-589.722) [-586.274] * [-589.904] (-584.794) (-588.402) (-585.157) -- 0:00:29
      493000 -- (-584.075) (-583.272) (-590.081) [-584.370] * (-583.624) (-583.528) (-584.633) [-585.892] -- 0:00:29
      493500 -- (-584.770) (-585.561) (-587.805) [-583.322] * (-590.494) [-583.826] (-583.543) (-584.861) -- 0:00:29
      494000 -- (-588.364) (-585.560) (-586.208) [-583.634] * (-585.032) (-583.898) [-583.351] (-584.727) -- 0:00:29
      494500 -- (-587.310) (-585.054) [-585.106] (-585.376) * (-588.606) (-585.728) (-583.334) [-588.926] -- 0:00:30
      495000 -- [-590.425] (-584.834) (-586.617) (-588.885) * (-583.516) (-585.995) [-585.600] (-586.285) -- 0:00:30

      Average standard deviation of split frequencies: 0.010518

      495500 -- [-586.290] (-584.252) (-587.079) (-587.119) * (-583.738) [-583.865] (-583.815) (-586.455) -- 0:00:30
      496000 -- (-584.294) (-585.927) (-587.405) [-584.977] * (-587.817) (-586.466) [-583.791] (-585.281) -- 0:00:30
      496500 -- (-586.396) (-587.545) [-584.924] (-585.378) * (-585.019) [-585.986] (-586.991) (-585.614) -- 0:00:30
      497000 -- [-585.649] (-586.945) (-583.592) (-584.264) * (-584.619) [-584.014] (-586.419) (-587.823) -- 0:00:30
      497500 -- (-585.123) [-583.375] (-584.537) (-585.641) * (-586.918) [-584.172] (-586.218) (-584.340) -- 0:00:30
      498000 -- (-584.343) (-584.603) [-587.113] (-585.304) * [-583.490] (-586.149) (-583.459) (-583.243) -- 0:00:30
      498500 -- (-585.228) [-583.094] (-586.538) (-586.424) * (-585.395) [-583.580] (-586.467) (-583.647) -- 0:00:30
      499000 -- (-586.305) [-585.256] (-585.433) (-583.411) * (-586.536) (-585.121) (-590.841) [-584.471] -- 0:00:30
      499500 -- (-589.161) (-585.561) (-584.904) [-587.146] * [-585.310] (-585.495) (-587.215) (-588.598) -- 0:00:30
      500000 -- (-584.105) (-584.526) (-586.917) [-586.327] * (-583.246) (-583.915) (-588.051) [-584.671] -- 0:00:30

      Average standard deviation of split frequencies: 0.009980

      500500 -- (-585.700) [-584.445] (-583.129) (-584.462) * [-583.818] (-587.152) (-584.288) (-585.765) -- 0:00:29
      501000 -- (-586.074) [-585.354] (-583.907) (-585.158) * [-585.112] (-583.540) (-588.909) (-585.709) -- 0:00:29
      501500 -- (-586.488) (-587.618) [-584.343] (-588.001) * [-585.657] (-583.549) (-584.629) (-584.671) -- 0:00:29
      502000 -- (-583.293) [-585.277] (-584.709) (-586.509) * [-585.298] (-583.654) (-588.465) (-583.586) -- 0:00:29
      502500 -- (-584.692) (-592.198) (-585.148) [-585.490] * [-584.897] (-583.854) (-588.069) (-586.013) -- 0:00:29
      503000 -- (-586.847) (-587.407) [-584.078] (-586.964) * (-594.935) [-584.152] (-589.812) (-585.496) -- 0:00:29
      503500 -- (-585.697) (-585.036) [-583.971] (-583.040) * (-587.804) [-586.155] (-584.714) (-584.029) -- 0:00:29
      504000 -- (-586.213) (-585.515) (-586.882) [-584.772] * (-583.973) [-584.130] (-584.082) (-583.694) -- 0:00:29
      504500 -- (-585.104) (-585.597) [-582.950] (-587.994) * [-583.702] (-585.031) (-585.814) (-584.645) -- 0:00:29
      505000 -- (-584.547) [-584.514] (-583.633) (-584.803) * (-583.517) (-584.292) [-587.040] (-583.818) -- 0:00:29

      Average standard deviation of split frequencies: 0.009083

      505500 -- (-583.050) (-588.587) [-587.245] (-584.605) * (-586.696) (-583.894) [-586.855] (-583.978) -- 0:00:29
      506000 -- (-583.195) (-586.067) [-584.816] (-584.163) * [-586.800] (-586.836) (-584.370) (-585.167) -- 0:00:29
      506500 -- (-583.372) [-586.979] (-584.518) (-586.053) * (-583.327) [-583.572] (-586.117) (-584.162) -- 0:00:29
      507000 -- (-584.901) (-583.941) (-585.020) [-584.743] * [-587.133] (-583.671) (-584.344) (-584.884) -- 0:00:29
      507500 -- (-587.815) (-584.795) (-587.209) [-582.901] * (-584.234) [-585.518] (-586.565) (-583.841) -- 0:00:29
      508000 -- (-587.085) (-584.692) (-587.054) [-583.522] * (-585.154) (-585.763) [-583.894] (-584.164) -- 0:00:29
      508500 -- (-589.128) (-582.834) [-583.863] (-585.388) * (-583.019) (-584.453) [-583.326] (-584.422) -- 0:00:28
      509000 -- (-586.355) (-584.612) [-584.477] (-585.879) * (-584.687) [-582.963] (-583.837) (-594.773) -- 0:00:28
      509500 -- (-589.752) (-584.162) (-584.639) [-587.998] * (-584.040) (-585.388) (-585.632) [-586.723] -- 0:00:28
      510000 -- (-585.332) (-586.345) [-588.050] (-586.831) * [-585.612] (-583.357) (-585.663) (-585.356) -- 0:00:28

      Average standard deviation of split frequencies: 0.010277

      510500 -- (-583.715) [-585.091] (-583.483) (-585.013) * (-583.950) [-585.292] (-589.995) (-587.198) -- 0:00:28
      511000 -- (-586.845) (-583.672) [-584.409] (-585.917) * (-588.376) (-585.703) [-588.237] (-583.851) -- 0:00:29
      511500 -- (-585.365) [-586.541] (-586.872) (-587.180) * (-588.395) (-589.032) [-586.688] (-589.238) -- 0:00:29
      512000 -- [-584.165] (-585.893) (-585.397) (-584.312) * (-585.410) (-589.997) [-587.481] (-584.560) -- 0:00:29
      512500 -- [-586.540] (-589.060) (-585.176) (-584.211) * [-586.349] (-590.948) (-585.600) (-584.071) -- 0:00:29
      513000 -- [-585.479] (-587.165) (-590.982) (-585.852) * (-586.061) (-588.629) (-585.508) [-585.497] -- 0:00:29
      513500 -- (-586.549) (-583.011) [-587.711] (-585.128) * (-585.928) (-586.763) [-586.771] (-586.211) -- 0:00:29
      514000 -- (-585.297) [-584.525] (-587.059) (-587.819) * (-584.871) (-585.225) [-586.750] (-583.902) -- 0:00:29
      514500 -- (-583.637) (-584.188) (-583.837) [-583.560] * (-587.179) (-583.525) (-584.345) [-588.241] -- 0:00:29
      515000 -- (-584.113) (-584.935) [-584.146] (-583.995) * (-586.220) (-584.061) (-582.932) [-587.114] -- 0:00:29

      Average standard deviation of split frequencies: 0.010049

      515500 -- (-585.644) [-587.855] (-586.403) (-584.109) * (-583.125) (-583.291) [-583.117] (-588.819) -- 0:00:29
      516000 -- (-585.460) (-584.969) (-585.793) [-585.571] * (-584.690) (-584.076) [-586.520] (-584.510) -- 0:00:29
      516500 -- (-583.209) (-584.834) (-586.597) [-583.400] * (-586.119) (-584.351) (-584.592) [-583.609] -- 0:00:29
      517000 -- (-586.445) (-585.805) [-583.941] (-584.271) * (-583.997) (-584.551) [-584.088] (-582.954) -- 0:00:28
      517500 -- (-584.717) [-586.779] (-582.930) (-585.858) * [-584.990] (-584.708) (-584.147) (-586.584) -- 0:00:28
      518000 -- (-585.762) [-584.362] (-583.819) (-588.577) * (-586.343) [-584.629] (-586.023) (-587.868) -- 0:00:28
      518500 -- (-584.398) (-585.525) (-587.518) [-585.652] * (-584.436) [-585.058] (-588.559) (-585.057) -- 0:00:28
      519000 -- [-583.581] (-584.681) (-584.884) (-584.111) * (-589.376) (-586.279) (-585.815) [-583.609] -- 0:00:28
      519500 -- (-584.600) (-583.671) (-585.721) [-585.416] * (-590.389) (-583.700) (-587.879) [-586.549] -- 0:00:28
      520000 -- (-583.899) (-587.031) [-585.774] (-586.920) * (-583.948) [-584.547] (-583.055) (-590.125) -- 0:00:28

      Average standard deviation of split frequencies: 0.010525

      520500 -- [-583.000] (-583.868) (-587.433) (-586.794) * (-583.304) (-586.137) [-582.952] (-588.059) -- 0:00:28
      521000 -- (-588.025) (-584.363) (-585.566) [-584.002] * [-583.676] (-586.739) (-582.733) (-583.790) -- 0:00:28
      521500 -- [-586.106] (-585.315) (-583.960) (-584.574) * (-584.102) (-584.202) (-583.437) [-584.163] -- 0:00:28
      522000 -- [-584.491] (-584.021) (-584.858) (-583.283) * [-583.784] (-584.822) (-588.436) (-588.263) -- 0:00:28
      522500 -- (-583.633) (-583.406) [-584.189] (-590.543) * (-588.603) (-585.338) (-588.306) [-588.371] -- 0:00:28
      523000 -- [-583.843] (-584.252) (-585.864) (-584.111) * [-586.865] (-583.911) (-585.821) (-584.618) -- 0:00:28
      523500 -- (-583.718) (-583.443) (-585.231) [-583.191] * (-587.355) [-584.740] (-586.651) (-587.939) -- 0:00:28
      524000 -- (-585.573) [-583.529] (-596.441) (-585.554) * (-585.259) [-584.498] (-584.855) (-589.197) -- 0:00:28
      524500 -- [-583.563] (-585.717) (-583.759) (-582.939) * [-586.799] (-583.961) (-587.615) (-585.801) -- 0:00:28
      525000 -- [-586.072] (-584.703) (-583.614) (-588.391) * (-585.080) (-585.451) (-584.103) [-585.301] -- 0:00:28

      Average standard deviation of split frequencies: 0.010026

      525500 -- (-586.591) (-583.032) [-585.981] (-583.905) * [-585.325] (-585.108) (-586.319) (-583.362) -- 0:00:27
      526000 -- (-585.107) (-585.385) (-586.965) [-588.080] * [-584.614] (-586.006) (-586.336) (-584.218) -- 0:00:27
      526500 -- (-584.771) [-584.843] (-587.693) (-584.836) * (-584.937) (-585.161) [-586.304] (-583.583) -- 0:00:28
      527000 -- (-584.245) (-589.044) [-583.502] (-583.085) * (-586.424) [-583.867] (-588.168) (-586.281) -- 0:00:28
      527500 -- (-583.380) (-585.960) (-584.785) [-586.664] * [-585.546] (-583.607) (-584.598) (-584.998) -- 0:00:28
      528000 -- (-583.693) [-583.991] (-584.763) (-585.700) * [-584.492] (-583.931) (-587.206) (-584.511) -- 0:00:28
      528500 -- (-585.273) (-586.384) (-583.884) [-586.196] * (-583.654) (-588.356) [-591.703] (-584.256) -- 0:00:28
      529000 -- (-589.681) (-584.621) [-586.132] (-583.428) * [-583.285] (-584.905) (-588.926) (-583.098) -- 0:00:28
      529500 -- (-589.139) [-584.722] (-584.152) (-586.668) * (-588.652) (-584.286) [-584.027] (-585.628) -- 0:00:28
      530000 -- (-586.482) (-584.806) [-584.289] (-585.614) * (-588.713) (-585.712) [-586.089] (-586.483) -- 0:00:28

      Average standard deviation of split frequencies: 0.009327

      530500 -- (-583.592) [-587.982] (-584.821) (-583.504) * (-587.072) (-586.887) (-583.650) [-584.570] -- 0:00:28
      531000 -- (-587.406) (-589.540) (-584.971) [-587.340] * (-584.877) (-584.615) [-587.268] (-587.367) -- 0:00:28
      531500 -- (-587.186) (-587.466) (-587.412) [-584.182] * [-585.411] (-589.602) (-587.690) (-587.004) -- 0:00:28
      532000 -- (-589.338) (-585.701) (-587.297) [-584.018] * (-586.976) (-586.573) [-583.915] (-590.502) -- 0:00:28
      532500 -- (-584.019) [-584.147] (-584.767) (-587.185) * (-588.373) [-584.817] (-586.245) (-583.354) -- 0:00:28
      533000 -- (-583.892) [-585.897] (-584.155) (-587.153) * [-585.744] (-585.302) (-584.035) (-584.132) -- 0:00:28
      533500 -- [-585.347] (-587.963) (-587.967) (-583.771) * (-585.440) (-587.511) (-589.082) [-582.853] -- 0:00:27
      534000 -- (-585.328) (-584.863) [-583.775] (-588.758) * (-586.427) (-586.909) (-587.524) [-588.316] -- 0:00:27
      534500 -- (-584.624) (-586.014) (-584.280) [-582.924] * [-587.273] (-588.612) (-588.460) (-584.788) -- 0:00:27
      535000 -- [-583.527] (-584.946) (-584.854) (-584.514) * (-589.279) (-587.871) [-582.889] (-586.422) -- 0:00:27

      Average standard deviation of split frequencies: 0.009235

      535500 -- (-584.975) [-585.792] (-588.506) (-583.959) * (-584.992) [-583.408] (-583.525) (-584.066) -- 0:00:27
      536000 -- (-583.134) (-583.521) [-585.913] (-585.619) * (-587.317) [-585.416] (-584.130) (-587.078) -- 0:00:27
      536500 -- (-585.224) [-583.180] (-584.524) (-586.383) * (-585.715) (-586.607) (-584.690) [-583.869] -- 0:00:27
      537000 -- (-584.469) (-588.319) (-583.601) [-583.585] * (-584.460) (-584.702) [-586.858] (-586.348) -- 0:00:27
      537500 -- (-590.631) (-585.074) [-589.011] (-583.615) * (-587.388) [-584.514] (-586.584) (-583.762) -- 0:00:27
      538000 -- (-588.769) (-588.931) [-585.890] (-588.392) * (-583.153) (-584.542) [-584.045] (-585.785) -- 0:00:27
      538500 -- (-584.866) [-584.821] (-583.360) (-588.472) * [-582.908] (-593.033) (-584.455) (-583.932) -- 0:00:27
      539000 -- (-583.412) (-588.591) (-585.344) [-590.629] * (-582.845) [-585.748] (-590.758) (-585.419) -- 0:00:27
      539500 -- (-584.370) [-585.075] (-584.691) (-586.803) * (-583.444) (-589.042) (-587.285) [-584.173] -- 0:00:27
      540000 -- [-584.589] (-585.374) (-585.738) (-585.840) * [-583.872] (-584.696) (-584.592) (-583.646) -- 0:00:27

      Average standard deviation of split frequencies: 0.008882

      540500 -- (-585.163) [-585.165] (-584.958) (-588.153) * (-583.556) [-584.506] (-586.551) (-584.697) -- 0:00:27
      541000 -- [-584.237] (-585.072) (-586.366) (-583.080) * (-591.637) [-589.242] (-587.198) (-584.187) -- 0:00:27
      541500 -- (-590.350) [-584.926] (-584.611) (-585.319) * (-583.414) [-586.129] (-585.519) (-583.776) -- 0:00:27
      542000 -- (-583.377) [-583.428] (-584.432) (-584.506) * (-584.948) [-584.371] (-585.198) (-585.973) -- 0:00:27
      542500 -- (-584.305) [-583.228] (-588.544) (-585.303) * (-585.974) (-590.228) [-586.533] (-583.709) -- 0:00:27
      543000 -- (-585.414) [-587.865] (-588.431) (-584.063) * [-585.884] (-583.210) (-585.023) (-587.517) -- 0:00:27
      543500 -- [-583.104] (-585.205) (-585.704) (-583.330) * [-584.484] (-585.332) (-585.425) (-585.968) -- 0:00:27
      544000 -- (-586.707) [-585.021] (-587.582) (-584.975) * (-584.007) [-584.705] (-584.292) (-584.347) -- 0:00:27
      544500 -- [-584.821] (-584.224) (-587.774) (-586.825) * (-584.581) (-584.441) (-583.482) [-586.117] -- 0:00:27
      545000 -- (-583.597) (-587.245) (-586.786) [-586.849] * [-584.299] (-583.106) (-584.442) (-585.363) -- 0:00:27

      Average standard deviation of split frequencies: 0.009335

      545500 -- [-586.301] (-586.390) (-587.292) (-583.052) * (-584.578) [-583.224] (-583.212) (-584.609) -- 0:00:27
      546000 -- (-587.480) [-583.247] (-584.827) (-584.146) * (-585.315) (-583.180) (-589.485) [-584.358] -- 0:00:27
      546500 -- (-583.582) [-586.702] (-585.466) (-586.314) * [-587.459] (-584.414) (-587.912) (-586.659) -- 0:00:27
      547000 -- (-584.276) (-583.379) (-585.309) [-584.250] * (-584.366) [-585.388] (-586.217) (-586.392) -- 0:00:27
      547500 -- (-588.441) (-584.215) [-586.594] (-583.002) * [-587.370] (-586.215) (-587.177) (-585.437) -- 0:00:27
      548000 -- (-583.291) (-584.202) (-585.379) [-585.239] * (-584.589) [-584.601] (-587.507) (-583.490) -- 0:00:27
      548500 -- [-584.721] (-593.043) (-584.122) (-585.825) * (-585.464) [-586.433] (-584.624) (-584.558) -- 0:00:27
      549000 -- (-583.983) (-585.830) (-583.966) [-583.648] * (-584.417) (-584.185) [-585.480] (-583.544) -- 0:00:27
      549500 -- (-584.762) (-587.640) [-583.263] (-583.852) * [-584.178] (-585.460) (-586.778) (-588.166) -- 0:00:27
      550000 -- [-582.992] (-583.317) (-587.337) (-583.307) * (-585.507) [-584.195] (-584.804) (-590.476) -- 0:00:27

      Average standard deviation of split frequencies: 0.009310

      550500 -- [-586.336] (-587.402) (-584.150) (-585.338) * (-585.709) (-583.462) (-585.077) [-583.717] -- 0:00:26
      551000 -- (-586.220) (-587.522) [-584.388] (-583.915) * (-584.366) (-585.487) (-586.668) [-584.143] -- 0:00:26
      551500 -- (-583.451) (-587.608) [-584.894] (-586.667) * (-583.941) (-583.196) (-585.686) [-585.206] -- 0:00:26
      552000 -- (-583.631) (-589.811) [-586.026] (-585.116) * [-585.460] (-583.406) (-584.490) (-584.101) -- 0:00:26
      552500 -- (-584.326) (-586.502) [-584.314] (-585.958) * [-584.978] (-587.673) (-589.277) (-587.353) -- 0:00:26
      553000 -- [-583.844] (-584.156) (-585.026) (-585.308) * (-586.452) [-586.848] (-585.386) (-587.108) -- 0:00:26
      553500 -- (-586.795) (-583.788) (-584.450) [-583.196] * [-585.536] (-585.193) (-585.303) (-586.263) -- 0:00:26
      554000 -- (-584.234) [-584.970] (-587.970) (-584.024) * (-584.762) [-585.911] (-584.736) (-583.643) -- 0:00:26
      554500 -- [-584.198] (-587.651) (-584.485) (-584.044) * (-583.295) (-591.135) (-584.680) [-584.393] -- 0:00:26
      555000 -- [-588.364] (-585.246) (-584.527) (-584.618) * [-583.717] (-585.511) (-587.688) (-584.528) -- 0:00:26

      Average standard deviation of split frequencies: 0.009485

      555500 -- [-587.438] (-583.175) (-587.725) (-584.319) * (-587.295) (-583.525) [-584.749] (-584.017) -- 0:00:26
      556000 -- [-583.759] (-586.148) (-584.165) (-585.495) * [-585.340] (-583.769) (-583.887) (-584.901) -- 0:00:26
      556500 -- (-585.635) [-583.725] (-584.024) (-585.616) * (-586.393) (-584.469) [-583.879] (-586.570) -- 0:00:26
      557000 -- (-588.397) (-586.430) (-590.777) [-583.095] * (-584.367) (-586.665) (-584.663) [-587.865] -- 0:00:26
      557500 -- [-586.776] (-588.355) (-585.626) (-585.572) * [-583.082] (-590.109) (-585.660) (-586.680) -- 0:00:26
      558000 -- (-585.399) [-583.369] (-584.867) (-587.182) * [-585.431] (-590.232) (-585.079) (-586.433) -- 0:00:26
      558500 -- (-585.307) [-583.361] (-594.169) (-587.068) * (-583.492) (-584.711) [-583.959] (-584.876) -- 0:00:26
      559000 -- (-583.551) (-588.898) (-591.902) [-584.534] * [-585.675] (-584.977) (-584.274) (-587.256) -- 0:00:26
      559500 -- [-584.925] (-586.869) (-585.982) (-586.234) * [-583.764] (-584.793) (-583.711) (-583.819) -- 0:00:26
      560000 -- (-587.999) [-584.488] (-585.506) (-586.286) * [-584.085] (-585.813) (-588.750) (-586.323) -- 0:00:26

      Average standard deviation of split frequencies: 0.009722

      560500 -- (-585.202) (-586.006) [-585.620] (-583.856) * [-586.030] (-584.061) (-584.234) (-583.990) -- 0:00:26
      561000 -- (-584.679) (-587.386) (-585.046) [-583.175] * [-587.353] (-583.841) (-585.308) (-583.068) -- 0:00:26
      561500 -- (-589.192) [-585.404] (-586.108) (-584.610) * (-587.026) [-583.461] (-585.316) (-585.305) -- 0:00:26
      562000 -- (-584.037) [-584.573] (-585.239) (-584.194) * (-584.948) [-585.174] (-585.380) (-585.643) -- 0:00:26
      562500 -- [-583.006] (-586.867) (-585.466) (-587.806) * (-583.499) [-586.002] (-584.454) (-586.827) -- 0:00:26
      563000 -- (-585.730) (-588.361) (-588.212) [-586.649] * (-586.583) (-583.183) [-584.766] (-584.345) -- 0:00:26
      563500 -- (-584.507) [-583.931] (-584.393) (-587.674) * (-584.325) (-585.091) (-584.528) [-588.727] -- 0:00:26
      564000 -- [-584.283] (-583.110) (-583.582) (-587.457) * (-584.686) (-583.650) (-585.162) [-584.539] -- 0:00:26
      564500 -- [-586.011] (-583.519) (-583.716) (-588.387) * [-586.418] (-584.632) (-583.056) (-584.451) -- 0:00:26
      565000 -- (-585.030) (-584.514) (-591.694) [-586.802] * (-587.139) [-586.600] (-587.188) (-582.777) -- 0:00:26

      Average standard deviation of split frequencies: 0.009786

      565500 -- (-585.077) [-583.273] (-588.339) (-585.534) * [-584.278] (-587.870) (-584.578) (-582.891) -- 0:00:26
      566000 -- [-584.162] (-582.937) (-590.680) (-585.314) * (-584.263) (-585.986) (-584.285) [-582.891] -- 0:00:26
      566500 -- (-584.912) [-586.362] (-585.454) (-585.372) * (-585.756) (-585.399) (-585.396) [-588.314] -- 0:00:26
      567000 -- [-583.628] (-588.573) (-582.878) (-584.478) * (-587.412) (-583.452) [-585.311] (-584.776) -- 0:00:25
      567500 -- (-584.447) [-587.001] (-582.778) (-585.536) * [-585.328] (-583.407) (-587.473) (-584.935) -- 0:00:25
      568000 -- [-583.272] (-586.333) (-584.678) (-584.275) * (-584.862) (-583.055) [-585.497] (-585.937) -- 0:00:25
      568500 -- (-584.830) (-585.004) [-584.713] (-588.075) * (-587.895) [-586.702] (-584.788) (-588.493) -- 0:00:25
      569000 -- [-584.118] (-585.022) (-587.447) (-585.728) * (-586.919) (-583.078) (-582.935) [-584.075] -- 0:00:25
      569500 -- (-583.877) (-585.094) [-584.976] (-585.258) * [-584.724] (-584.467) (-587.674) (-585.065) -- 0:00:25
      570000 -- (-587.547) (-584.629) [-587.536] (-586.367) * (-583.332) (-586.167) [-585.559] (-588.074) -- 0:00:25

      Average standard deviation of split frequencies: 0.010377

      570500 -- (-584.110) (-583.867) [-583.813] (-583.650) * (-585.834) (-586.219) (-586.282) [-584.561] -- 0:00:25
      571000 -- (-587.973) (-584.958) [-583.649] (-583.915) * (-585.817) [-585.828] (-585.968) (-585.517) -- 0:00:25
      571500 -- (-588.287) (-587.877) [-584.442] (-582.751) * (-586.278) (-585.737) (-587.401) [-583.435] -- 0:00:25
      572000 -- (-585.441) (-584.290) [-585.986] (-584.141) * (-590.160) (-586.305) (-584.921) [-584.598] -- 0:00:25
      572500 -- [-583.964] (-583.625) (-585.502) (-585.581) * (-589.228) [-583.938] (-584.443) (-585.511) -- 0:00:25
      573000 -- [-585.091] (-584.708) (-585.776) (-584.626) * [-585.209] (-586.878) (-584.851) (-584.069) -- 0:00:25
      573500 -- [-584.683] (-585.372) (-587.321) (-586.272) * (-585.217) [-584.494] (-584.484) (-584.035) -- 0:00:25
      574000 -- (-584.416) (-584.559) [-586.647] (-585.069) * (-585.423) (-584.276) [-584.622] (-588.654) -- 0:00:25
      574500 -- (-584.386) (-590.281) [-583.264] (-587.169) * (-586.594) (-584.873) (-585.064) [-584.224] -- 0:00:25
      575000 -- [-584.733] (-591.593) (-583.982) (-584.445) * (-583.481) (-588.860) [-586.702] (-583.564) -- 0:00:25

      Average standard deviation of split frequencies: 0.009821

      575500 -- (-585.288) (-584.676) (-585.113) [-583.462] * (-586.074) (-587.691) [-584.303] (-585.772) -- 0:00:25
      576000 -- (-584.451) (-585.444) (-584.655) [-583.492] * (-586.438) (-584.340) [-583.788] (-584.919) -- 0:00:25
      576500 -- [-584.018] (-584.554) (-583.838) (-583.546) * [-584.331] (-587.387) (-583.639) (-583.921) -- 0:00:25
      577000 -- (-584.972) [-587.464] (-585.039) (-590.612) * [-584.017] (-594.937) (-586.987) (-583.973) -- 0:00:25
      577500 -- (-587.200) (-586.130) (-584.578) [-588.403] * [-583.484] (-584.865) (-584.939) (-584.654) -- 0:00:25
      578000 -- (-589.362) (-585.834) [-584.675] (-587.662) * [-585.173] (-586.802) (-585.872) (-584.335) -- 0:00:25
      578500 -- (-592.860) (-585.591) [-587.988] (-585.708) * (-584.002) (-585.995) (-585.221) [-586.092] -- 0:00:25
      579000 -- (-585.568) [-585.463] (-585.499) (-590.596) * [-587.368] (-586.257) (-590.973) (-584.238) -- 0:00:25
      579500 -- [-584.205] (-584.702) (-583.932) (-589.443) * (-586.040) (-583.730) (-583.895) [-585.442] -- 0:00:25
      580000 -- (-589.185) (-585.500) (-583.623) [-583.232] * (-584.944) (-584.693) [-584.792] (-585.441) -- 0:00:25

      Average standard deviation of split frequencies: 0.009590

      580500 -- (-588.740) [-584.506] (-587.005) (-585.854) * [-583.480] (-584.291) (-583.317) (-588.248) -- 0:00:25
      581000 -- [-585.390] (-585.553) (-583.342) (-584.538) * [-588.853] (-585.304) (-583.400) (-585.697) -- 0:00:25
      581500 -- [-584.340] (-585.599) (-587.394) (-583.252) * (-586.031) (-585.809) (-583.386) [-585.386] -- 0:00:25
      582000 -- (-583.903) (-584.776) [-584.878] (-583.187) * (-585.420) (-586.146) [-584.815] (-586.763) -- 0:00:25
      582500 -- (-583.891) (-583.873) (-583.805) [-585.260] * (-584.502) [-584.650] (-586.349) (-585.962) -- 0:00:25
      583000 -- (-583.983) [-585.290] (-585.432) (-585.225) * (-589.103) (-584.185) (-584.973) [-583.090] -- 0:00:25
      583500 -- (-585.397) [-584.798] (-587.113) (-586.286) * (-592.382) (-595.185) [-584.570] (-584.780) -- 0:00:24
      584000 -- (-585.429) [-584.272] (-585.650) (-585.113) * (-582.925) (-586.663) (-584.920) [-582.803] -- 0:00:24
      584500 -- [-583.695] (-586.252) (-585.729) (-585.400) * [-586.088] (-592.067) (-585.287) (-583.406) -- 0:00:24
      585000 -- [-585.375] (-588.041) (-592.818) (-587.507) * (-585.152) (-585.900) (-590.799) [-583.317] -- 0:00:24

      Average standard deviation of split frequencies: 0.009754

      585500 -- (-582.951) (-585.249) [-585.312] (-584.487) * (-583.085) [-587.706] (-589.820) (-582.815) -- 0:00:24
      586000 -- (-582.911) (-583.552) (-585.605) [-584.608] * [-586.729] (-586.740) (-592.030) (-583.853) -- 0:00:24
      586500 -- [-586.265] (-587.656) (-584.559) (-584.371) * (-584.455) [-586.816] (-585.365) (-587.347) -- 0:00:24
      587000 -- (-586.748) (-587.868) (-584.455) [-583.982] * (-584.260) [-583.227] (-585.617) (-585.191) -- 0:00:24
      587500 -- (-588.064) [-589.353] (-585.249) (-584.976) * (-583.628) (-584.787) [-585.050] (-588.438) -- 0:00:24
      588000 -- (-584.305) [-584.193] (-583.997) (-585.664) * [-584.783] (-583.410) (-588.407) (-583.656) -- 0:00:24
      588500 -- [-582.828] (-582.859) (-583.639) (-584.085) * (-585.388) (-583.761) (-587.143) [-583.067] -- 0:00:24
      589000 -- [-583.284] (-583.460) (-583.831) (-587.013) * (-585.679) (-584.415) [-584.944] (-585.673) -- 0:00:24
      589500 -- (-583.527) [-588.039] (-584.307) (-585.279) * (-586.480) (-586.079) (-587.261) [-586.532] -- 0:00:24
      590000 -- (-584.740) (-584.293) [-584.828] (-584.312) * (-588.578) (-587.971) [-586.447] (-584.184) -- 0:00:24

      Average standard deviation of split frequencies: 0.010076

      590500 -- (-583.951) [-583.560] (-587.981) (-585.647) * (-589.281) (-586.857) (-585.712) [-589.285] -- 0:00:24
      591000 -- (-588.994) (-583.270) [-585.767] (-584.996) * (-587.729) [-585.627] (-586.176) (-587.522) -- 0:00:24
      591500 -- (-583.605) (-584.503) [-584.925] (-586.579) * (-589.706) (-583.953) (-585.766) [-583.596] -- 0:00:24
      592000 -- [-583.960] (-584.440) (-583.699) (-584.178) * (-583.307) [-588.649] (-584.846) (-588.827) -- 0:00:24
      592500 -- (-589.928) [-584.949] (-585.289) (-584.666) * [-583.342] (-589.132) (-585.007) (-584.305) -- 0:00:24
      593000 -- (-586.901) (-588.603) [-584.778] (-586.059) * [-587.009] (-590.049) (-585.586) (-584.316) -- 0:00:24
      593500 -- (-586.453) [-583.703] (-585.144) (-585.841) * (-586.059) (-592.427) (-584.073) [-587.757] -- 0:00:24
      594000 -- (-584.856) [-585.347] (-586.685) (-584.806) * (-584.400) (-588.790) [-584.717] (-588.313) -- 0:00:24
      594500 -- [-586.322] (-584.674) (-585.399) (-584.498) * (-583.004) (-583.761) [-590.486] (-587.086) -- 0:00:24
      595000 -- (-582.694) [-584.630] (-586.684) (-591.100) * [-583.584] (-583.638) (-584.470) (-587.510) -- 0:00:24

      Average standard deviation of split frequencies: 0.010282

      595500 -- [-585.159] (-587.436) (-586.615) (-585.595) * (-585.263) (-587.725) (-587.681) [-587.987] -- 0:00:24
      596000 -- [-583.838] (-589.427) (-585.187) (-585.401) * [-583.546] (-584.889) (-583.796) (-586.239) -- 0:00:24
      596500 -- (-585.579) (-584.622) (-584.758) [-585.710] * (-585.064) (-584.052) (-583.865) [-584.857] -- 0:00:24
      597000 -- (-586.802) (-585.578) [-586.212] (-586.703) * (-588.344) (-584.887) [-585.106] (-585.980) -- 0:00:24
      597500 -- (-584.798) [-584.620] (-583.801) (-583.999) * (-584.908) (-583.903) (-584.647) [-582.926] -- 0:00:24
      598000 -- [-584.430] (-585.254) (-583.423) (-587.164) * (-582.848) [-583.360] (-585.083) (-583.492) -- 0:00:24
      598500 -- (-584.708) [-583.705] (-584.226) (-589.303) * [-587.547] (-583.738) (-587.150) (-583.821) -- 0:00:24
      599000 -- (-587.240) [-584.706] (-584.523) (-589.176) * (-586.983) (-589.382) (-583.982) [-586.164] -- 0:00:24
      599500 -- (-586.474) (-590.574) (-584.643) [-586.854] * (-587.034) (-591.576) [-584.603] (-586.887) -- 0:00:24
      600000 -- (-586.802) (-587.794) [-585.057] (-586.194) * (-584.737) (-586.181) [-586.685] (-588.991) -- 0:00:24

      Average standard deviation of split frequencies: 0.009663

      600500 -- [-584.894] (-587.096) (-583.545) (-586.435) * (-586.951) (-584.711) [-586.129] (-585.426) -- 0:00:23
      601000 -- [-584.696] (-590.453) (-585.112) (-585.777) * (-587.128) (-585.133) [-583.992] (-584.585) -- 0:00:23
      601500 -- (-587.709) [-586.860] (-590.401) (-584.506) * (-585.012) (-585.842) (-587.371) [-584.228] -- 0:00:23
      602000 -- [-593.119] (-583.530) (-584.598) (-586.730) * (-585.461) [-586.975] (-586.325) (-584.461) -- 0:00:23
      602500 -- (-590.971) [-584.912] (-585.054) (-583.853) * (-584.380) (-584.765) [-585.201] (-583.335) -- 0:00:23
      603000 -- [-584.074] (-585.064) (-584.910) (-585.648) * (-583.945) (-583.967) [-583.299] (-584.013) -- 0:00:23
      603500 -- (-583.647) (-586.106) [-584.921] (-585.247) * [-584.227] (-583.594) (-584.129) (-583.320) -- 0:00:23
      604000 -- (-586.171) (-587.897) (-583.112) [-583.881] * (-583.821) [-583.595] (-584.812) (-582.959) -- 0:00:23
      604500 -- (-586.436) (-586.352) [-586.629] (-583.596) * [-585.680] (-586.325) (-586.780) (-584.603) -- 0:00:23
      605000 -- (-584.983) (-584.948) [-585.364] (-587.268) * (-583.358) (-584.757) [-585.677] (-584.286) -- 0:00:23

      Average standard deviation of split frequencies: 0.009432

      605500 -- (-589.876) (-584.941) (-584.573) [-583.945] * (-582.779) [-584.415] (-584.450) (-585.504) -- 0:00:23
      606000 -- (-585.707) [-584.904] (-595.165) (-584.049) * [-583.354] (-584.216) (-583.499) (-583.290) -- 0:00:23
      606500 -- (-585.400) [-588.890] (-586.385) (-583.608) * (-585.210) (-585.513) [-583.885] (-584.386) -- 0:00:23
      607000 -- (-583.739) (-588.322) [-584.818] (-585.547) * (-584.833) (-584.398) (-583.254) [-584.802] -- 0:00:23
      607500 -- [-585.164] (-587.835) (-584.732) (-586.252) * (-583.937) (-586.626) [-583.696] (-583.852) -- 0:00:23
      608000 -- (-586.743) [-584.305] (-586.513) (-583.681) * (-584.463) [-584.115] (-583.571) (-586.626) -- 0:00:23
      608500 -- (-589.268) [-586.032] (-584.200) (-583.896) * (-584.046) (-585.297) (-584.100) [-586.034] -- 0:00:23
      609000 -- (-584.676) [-584.768] (-586.708) (-584.631) * (-588.835) (-584.740) (-583.742) [-583.563] -- 0:00:23
      609500 -- [-585.099] (-585.399) (-587.679) (-584.310) * (-584.041) (-584.948) [-583.050] (-584.270) -- 0:00:23
      610000 -- (-586.319) [-583.313] (-587.795) (-588.348) * [-585.776] (-585.701) (-585.494) (-586.914) -- 0:00:23

      Average standard deviation of split frequencies: 0.010035

      610500 -- [-587.807] (-584.668) (-588.953) (-586.195) * [-584.888] (-589.326) (-587.431) (-584.676) -- 0:00:23
      611000 -- (-592.130) (-589.280) (-584.610) [-584.518] * (-583.846) [-585.215] (-586.136) (-584.279) -- 0:00:23
      611500 -- (-585.465) (-585.462) [-582.817] (-585.749) * (-583.292) (-585.379) (-585.603) [-586.116] -- 0:00:23
      612000 -- (-586.607) [-584.197] (-585.788) (-584.483) * (-585.940) (-585.413) [-584.516] (-591.238) -- 0:00:23
      612500 -- (-586.423) (-583.847) [-587.570] (-586.783) * (-585.336) [-584.882] (-587.420) (-584.216) -- 0:00:23
      613000 -- (-585.640) (-586.404) [-588.502] (-586.067) * (-583.701) [-584.259] (-586.342) (-587.258) -- 0:00:23
      613500 -- (-586.582) (-584.756) [-585.250] (-584.391) * (-585.037) (-584.649) (-584.822) [-590.566] -- 0:00:23
      614000 -- (-585.016) (-584.062) (-583.466) [-584.297] * (-586.082) (-586.263) (-586.067) [-585.362] -- 0:00:23
      614500 -- (-583.851) (-587.963) [-585.257] (-583.573) * (-584.148) (-588.813) [-586.888] (-587.826) -- 0:00:23
      615000 -- (-583.511) [-582.919] (-587.036) (-584.059) * (-587.122) (-584.278) [-585.342] (-588.941) -- 0:00:23

      Average standard deviation of split frequencies: 0.010044

      615500 -- (-583.057) (-584.014) [-588.507] (-584.473) * (-586.445) [-584.886] (-588.713) (-586.527) -- 0:00:23
      616000 -- (-586.113) (-584.982) (-585.233) [-585.753] * (-584.004) (-584.762) (-586.184) [-585.851] -- 0:00:23
      616500 -- (-587.705) (-588.189) (-586.376) [-583.797] * (-586.643) [-584.563] (-586.647) (-584.311) -- 0:00:23
      617000 -- [-584.107] (-585.923) (-583.358) (-584.074) * (-585.423) (-587.680) (-587.911) [-584.427] -- 0:00:22
      617500 -- (-584.529) [-583.638] (-583.583) (-585.059) * (-587.258) (-584.757) [-584.169] (-584.115) -- 0:00:22
      618000 -- [-588.169] (-584.354) (-583.946) (-584.015) * (-586.737) (-583.918) [-585.350] (-584.980) -- 0:00:22
      618500 -- [-586.237] (-588.941) (-587.403) (-589.799) * (-584.908) (-583.413) [-585.113] (-584.815) -- 0:00:22
      619000 -- (-586.032) (-584.897) [-584.876] (-586.200) * (-583.882) [-585.123] (-584.952) (-584.729) -- 0:00:22
      619500 -- (-588.201) [-583.933] (-587.025) (-584.195) * [-582.977] (-587.183) (-583.644) (-584.236) -- 0:00:22
      620000 -- (-587.347) [-583.878] (-585.475) (-585.732) * (-583.225) (-586.407) (-585.517) [-587.311] -- 0:00:22

      Average standard deviation of split frequencies: 0.010016

      620500 -- (-587.101) [-586.565] (-589.275) (-585.353) * (-586.043) [-585.694] (-585.600) (-582.913) -- 0:00:22
      621000 -- (-586.550) (-583.916) [-583.964] (-590.686) * (-583.345) (-587.177) [-584.926] (-584.781) -- 0:00:22
      621500 -- (-587.071) [-583.498] (-584.887) (-584.833) * (-587.724) (-584.851) [-583.490] (-585.512) -- 0:00:22
      622000 -- (-584.867) (-584.490) (-585.604) [-583.798] * (-584.682) [-584.360] (-587.594) (-585.002) -- 0:00:22
      622500 -- [-586.195] (-585.602) (-585.365) (-584.056) * (-583.986) (-584.690) (-588.595) [-584.214] -- 0:00:22
      623000 -- (-585.772) [-584.738] (-585.952) (-584.907) * (-583.769) (-584.128) [-586.177] (-587.009) -- 0:00:22
      623500 -- (-584.538) (-584.986) (-586.918) [-584.711] * (-585.631) (-583.588) [-583.659] (-586.269) -- 0:00:22
      624000 -- (-584.088) [-583.992] (-584.453) (-584.185) * (-587.066) (-583.909) (-586.779) [-584.056] -- 0:00:22
      624500 -- (-586.923) (-584.285) [-582.845] (-582.881) * (-587.133) (-582.863) (-589.799) [-584.301] -- 0:00:22
      625000 -- (-585.415) [-582.956] (-583.274) (-586.301) * [-584.095] (-584.965) (-586.387) (-583.863) -- 0:00:22

      Average standard deviation of split frequencies: 0.010072

      625500 -- (-584.921) (-582.985) [-584.501] (-584.829) * (-585.416) (-585.006) (-587.195) [-585.081] -- 0:00:22
      626000 -- (-585.455) (-585.208) [-585.719] (-583.996) * (-583.807) (-587.466) (-586.076) [-586.299] -- 0:00:22
      626500 -- (-584.818) (-584.936) (-583.934) [-585.146] * (-585.296) (-588.142) (-584.612) [-584.436] -- 0:00:22
      627000 -- (-584.174) (-585.916) (-586.316) [-584.436] * (-584.498) [-587.795] (-584.359) (-584.204) -- 0:00:22
      627500 -- (-586.081) [-584.819] (-583.812) (-584.696) * (-583.101) (-584.579) [-582.906] (-585.197) -- 0:00:22
      628000 -- (-587.507) [-583.896] (-582.866) (-584.671) * [-584.673] (-584.091) (-584.408) (-583.862) -- 0:00:22
      628500 -- [-586.282] (-584.511) (-583.063) (-587.058) * (-586.621) (-583.369) [-585.918] (-585.491) -- 0:00:22
      629000 -- (-586.728) (-588.271) (-583.294) [-584.530] * (-589.104) (-584.695) (-587.826) [-583.337] -- 0:00:22
      629500 -- [-584.486] (-584.208) (-586.795) (-584.598) * (-587.132) [-584.976] (-584.513) (-583.503) -- 0:00:22
      630000 -- (-583.769) (-588.434) [-583.229] (-584.401) * (-585.478) [-584.517] (-584.149) (-586.454) -- 0:00:22

      Average standard deviation of split frequencies: 0.010511

      630500 -- [-585.205] (-584.695) (-584.568) (-591.699) * (-584.601) (-584.233) [-586.522] (-585.761) -- 0:00:22
      631000 -- (-584.881) (-583.683) (-583.071) [-583.838] * (-585.220) [-583.325] (-584.832) (-583.744) -- 0:00:22
      631500 -- (-584.874) (-585.667) (-584.591) [-585.384] * [-585.218] (-583.619) (-587.175) (-583.982) -- 0:00:22
      632000 -- [-585.796] (-587.679) (-585.822) (-588.978) * (-587.843) (-583.105) (-584.449) [-583.816] -- 0:00:22
      632500 -- (-585.073) (-586.897) (-585.475) [-585.432] * (-588.406) [-584.533] (-582.855) (-587.073) -- 0:00:22
      633000 -- (-584.950) [-584.176] (-585.730) (-586.700) * (-587.430) [-584.209] (-589.244) (-583.376) -- 0:00:22
      633500 -- (-585.303) (-585.434) (-584.826) [-584.562] * (-585.600) [-584.372] (-585.381) (-583.269) -- 0:00:21
      634000 -- (-586.113) [-592.399] (-584.722) (-584.147) * (-592.165) (-584.667) (-584.814) [-585.584] -- 0:00:21
      634500 -- (-584.845) (-588.769) (-583.553) [-583.602] * (-585.642) (-584.214) (-584.828) [-585.064] -- 0:00:21
      635000 -- (-585.507) (-585.800) [-582.803] (-583.541) * (-585.252) (-584.693) [-585.828] (-584.022) -- 0:00:21

      Average standard deviation of split frequencies: 0.010794

      635500 -- (-584.770) [-590.034] (-583.085) (-585.494) * [-583.076] (-584.087) (-584.940) (-583.232) -- 0:00:21
      636000 -- (-585.280) (-586.195) (-586.056) [-587.628] * (-583.193) (-583.353) [-584.168] (-584.871) -- 0:00:21
      636500 -- (-589.422) (-584.558) [-585.613] (-585.615) * (-587.630) (-583.421) [-584.365] (-587.741) -- 0:00:21
      637000 -- [-588.045] (-583.735) (-586.043) (-584.797) * [-586.551] (-583.941) (-585.489) (-586.980) -- 0:00:22
      637500 -- (-586.136) (-584.405) (-584.319) [-586.009] * (-584.727) [-584.016] (-587.263) (-586.635) -- 0:00:22
      638000 -- (-587.220) (-586.100) (-584.344) [-583.879] * (-584.607) (-585.282) [-582.927] (-585.816) -- 0:00:22
      638500 -- (-585.088) (-585.237) (-588.475) [-589.534] * (-584.590) [-585.199] (-587.547) (-584.898) -- 0:00:22
      639000 -- (-583.986) (-586.075) [-585.637] (-589.438) * (-586.758) (-583.937) [-584.470] (-586.503) -- 0:00:22
      639500 -- [-584.502] (-586.287) (-585.549) (-585.860) * [-584.998] (-583.921) (-584.436) (-584.577) -- 0:00:21
      640000 -- (-586.324) (-585.874) (-583.937) [-584.776] * (-583.023) [-587.646] (-585.387) (-584.854) -- 0:00:21

      Average standard deviation of split frequencies: 0.010485

      640500 -- (-585.346) [-585.328] (-585.999) (-584.991) * (-586.324) (-587.364) [-585.600] (-583.458) -- 0:00:21
      641000 -- [-584.746] (-592.948) (-583.066) (-583.750) * (-583.952) (-589.810) (-587.279) [-584.731] -- 0:00:21
      641500 -- (-584.451) [-586.018] (-586.793) (-583.027) * (-588.115) [-584.848] (-585.342) (-585.890) -- 0:00:21
      642000 -- (-584.149) (-586.982) (-586.516) [-586.660] * (-584.125) (-586.073) [-585.757] (-584.257) -- 0:00:21
      642500 -- (-586.216) (-587.659) (-585.171) [-585.657] * [-587.494] (-583.073) (-585.890) (-585.879) -- 0:00:21
      643000 -- [-583.176] (-586.318) (-589.088) (-583.928) * (-587.926) (-588.510) (-584.984) [-584.398] -- 0:00:21
      643500 -- (-583.935) [-585.919] (-584.864) (-583.883) * [-583.440] (-585.107) (-586.977) (-585.514) -- 0:00:21
      644000 -- (-585.355) [-587.957] (-584.922) (-585.445) * (-583.652) (-585.783) (-585.311) [-582.982] -- 0:00:21
      644500 -- (-586.033) [-587.980] (-584.238) (-583.492) * (-583.272) [-584.394] (-582.870) (-582.993) -- 0:00:21
      645000 -- (-591.542) [-586.055] (-583.506) (-583.433) * (-584.055) [-585.712] (-583.782) (-584.977) -- 0:00:21

      Average standard deviation of split frequencies: 0.010171

      645500 -- (-583.925) (-583.826) [-582.983] (-584.549) * (-583.533) [-585.120] (-582.856) (-584.665) -- 0:00:21
      646000 -- (-583.932) [-584.233] (-585.534) (-585.039) * (-584.459) (-584.167) [-583.161] (-584.390) -- 0:00:21
      646500 -- (-584.979) [-585.824] (-584.169) (-588.531) * [-584.406] (-584.392) (-585.732) (-586.949) -- 0:00:21
      647000 -- (-586.327) (-588.472) (-585.773) [-587.173] * (-585.267) (-584.036) [-583.766] (-585.133) -- 0:00:21
      647500 -- [-587.086] (-586.403) (-584.978) (-588.049) * [-586.760] (-586.742) (-584.970) (-584.081) -- 0:00:21
      648000 -- (-583.533) (-585.098) (-584.015) [-584.249] * (-584.309) (-585.557) (-585.297) [-584.641] -- 0:00:21
      648500 -- (-584.452) (-584.227) (-584.039) [-585.077] * (-585.062) [-584.946] (-587.798) (-584.954) -- 0:00:21
      649000 -- (-585.168) (-587.099) (-584.754) [-586.201] * (-585.602) (-584.611) (-584.924) [-583.823] -- 0:00:21
      649500 -- [-587.818] (-588.838) (-584.088) (-585.797) * (-589.384) [-583.595] (-583.751) (-583.436) -- 0:00:21
      650000 -- [-583.907] (-586.381) (-583.285) (-586.659) * (-583.230) [-585.595] (-583.827) (-583.871) -- 0:00:21

      Average standard deviation of split frequencies: 0.011003

      650500 -- [-583.517] (-586.966) (-583.813) (-584.143) * (-584.508) (-583.932) [-583.155] (-585.089) -- 0:00:20
      651000 -- (-586.023) [-585.903] (-586.496) (-583.591) * (-584.299) [-586.014] (-584.627) (-583.460) -- 0:00:20
      651500 -- (-587.273) [-584.562] (-585.956) (-584.481) * (-584.187) (-585.248) [-585.124] (-583.425) -- 0:00:20
      652000 -- (-586.498) (-586.538) [-583.831] (-583.991) * (-587.344) (-585.404) (-583.578) [-584.658] -- 0:00:20
      652500 -- (-586.467) [-586.062] (-586.661) (-589.286) * [-585.070] (-583.766) (-587.265) (-583.637) -- 0:00:20
      653000 -- (-586.533) (-586.785) (-584.535) [-584.642] * [-584.493] (-583.265) (-588.891) (-583.477) -- 0:00:20
      653500 -- [-585.242] (-584.043) (-584.816) (-586.149) * (-583.729) (-585.926) (-585.713) [-583.383] -- 0:00:21
      654000 -- [-585.329] (-583.882) (-586.371) (-586.290) * (-584.867) (-585.580) (-584.258) [-583.227] -- 0:00:21
      654500 -- (-589.539) [-584.105] (-584.730) (-586.869) * [-585.657] (-585.470) (-584.928) (-590.448) -- 0:00:21
      655000 -- (-583.891) (-583.227) [-583.283] (-586.338) * (-590.666) [-585.383] (-588.273) (-590.599) -- 0:00:21

      Average standard deviation of split frequencies: 0.011183

      655500 -- (-592.233) (-587.875) (-584.872) [-583.832] * (-586.922) (-585.190) (-585.912) [-586.134] -- 0:00:21
      656000 -- (-592.509) [-587.205] (-587.250) (-584.875) * (-583.301) [-584.059] (-584.590) (-584.060) -- 0:00:20
      656500 -- [-584.350] (-584.859) (-584.242) (-584.784) * (-590.438) [-583.520] (-587.667) (-585.722) -- 0:00:20
      657000 -- [-584.489] (-585.475) (-584.006) (-585.945) * [-583.751] (-582.881) (-584.221) (-585.363) -- 0:00:20
      657500 -- (-584.664) (-588.808) (-584.821) [-586.519] * (-585.037) (-582.785) (-585.475) [-585.725] -- 0:00:20
      658000 -- [-585.632] (-585.808) (-583.370) (-589.129) * (-584.572) (-583.274) (-586.573) [-591.007] -- 0:00:20
      658500 -- [-583.772] (-584.312) (-585.068) (-584.508) * (-583.953) [-583.303] (-585.180) (-587.242) -- 0:00:20
      659000 -- (-583.822) (-583.388) (-584.316) [-583.251] * (-586.316) (-584.014) (-586.829) [-584.037] -- 0:00:20
      659500 -- (-585.356) [-583.480] (-585.408) (-584.384) * (-587.837) [-591.893] (-585.033) (-585.681) -- 0:00:20
      660000 -- (-585.838) [-584.225] (-584.705) (-583.955) * [-586.462] (-588.482) (-587.122) (-584.266) -- 0:00:20

      Average standard deviation of split frequencies: 0.011193

      660500 -- (-584.453) [-589.571] (-584.597) (-584.900) * (-590.817) [-583.344] (-583.935) (-584.281) -- 0:00:20
      661000 -- (-584.424) (-592.314) (-587.128) [-584.481] * (-584.053) [-585.501] (-583.433) (-588.380) -- 0:00:20
      661500 -- (-584.055) (-584.145) [-586.366] (-584.367) * (-583.696) (-587.479) [-585.455] (-587.846) -- 0:00:20
      662000 -- (-583.860) (-584.836) [-585.151] (-586.711) * (-585.755) (-586.081) (-583.903) [-586.482] -- 0:00:20
      662500 -- (-583.789) (-583.462) (-585.875) [-586.857] * (-584.034) [-584.714] (-583.623) (-589.487) -- 0:00:20
      663000 -- (-584.415) [-585.929] (-584.575) (-588.792) * (-582.954) (-586.980) (-583.054) [-585.694] -- 0:00:20
      663500 -- [-585.572] (-584.865) (-585.841) (-590.715) * (-583.902) [-586.120] (-584.152) (-585.025) -- 0:00:20
      664000 -- (-583.847) [-583.870] (-585.190) (-586.194) * (-584.170) (-591.292) (-584.625) [-583.834] -- 0:00:20
      664500 -- (-583.898) (-584.901) (-588.561) [-585.340] * (-583.269) (-593.211) [-584.413] (-587.304) -- 0:00:20
      665000 -- [-583.796] (-585.487) (-583.873) (-584.421) * (-584.110) (-583.746) (-587.739) [-587.273] -- 0:00:20

      Average standard deviation of split frequencies: 0.010883

      665500 -- [-583.908] (-587.594) (-583.406) (-584.211) * (-584.446) (-583.401) (-584.024) [-585.346] -- 0:00:20
      666000 -- [-584.464] (-590.287) (-583.487) (-585.940) * [-585.666] (-583.882) (-584.244) (-584.223) -- 0:00:20
      666500 -- [-583.749] (-587.495) (-587.732) (-583.750) * [-583.777] (-586.361) (-585.591) (-583.571) -- 0:00:20
      667000 -- (-584.032) [-585.391] (-585.964) (-583.012) * (-584.271) [-585.425] (-584.053) (-583.444) -- 0:00:19
      667500 -- (-584.208) [-585.154] (-587.180) (-583.289) * (-588.167) [-585.849] (-584.310) (-584.873) -- 0:00:19
      668000 -- (-583.142) (-583.947) [-584.505] (-584.643) * (-586.412) (-585.882) (-587.455) [-584.572] -- 0:00:19
      668500 -- [-583.813] (-588.236) (-585.244) (-584.968) * [-586.696] (-584.725) (-584.152) (-588.003) -- 0:00:19
      669000 -- [-585.993] (-583.423) (-587.538) (-583.512) * (-585.430) (-588.824) (-585.565) [-582.973] -- 0:00:19
      669500 -- (-585.879) (-585.234) [-584.979] (-583.635) * (-584.132) (-585.352) (-586.321) [-584.248] -- 0:00:19
      670000 -- [-584.291] (-588.469) (-586.284) (-585.379) * (-584.326) (-583.785) (-585.950) [-587.187] -- 0:00:19

      Average standard deviation of split frequencies: 0.011114

      670500 -- (-588.425) (-585.365) (-586.123) [-585.321] * (-584.920) (-584.354) (-589.079) [-583.641] -- 0:00:20
      671000 -- (-588.410) (-585.864) (-586.759) [-583.867] * (-588.629) (-583.841) (-586.812) [-587.282] -- 0:00:20
      671500 -- [-585.936] (-584.925) (-586.569) (-584.183) * (-584.451) [-585.370] (-591.061) (-586.322) -- 0:00:20
      672000 -- (-584.065) (-585.588) (-585.830) [-587.277] * (-584.300) (-583.431) [-584.493] (-586.823) -- 0:00:20
      672500 -- (-584.454) (-583.261) (-584.461) [-584.798] * (-583.676) (-585.448) [-585.294] (-584.680) -- 0:00:19
      673000 -- [-583.451] (-584.428) (-585.320) (-586.022) * (-585.370) (-584.555) (-585.478) [-583.466] -- 0:00:19
      673500 -- (-583.147) [-584.444] (-584.412) (-585.243) * (-583.298) [-584.619] (-584.644) (-583.510) -- 0:00:19
      674000 -- (-584.595) [-584.203] (-583.132) (-584.232) * (-583.751) (-584.975) (-583.616) [-583.311] -- 0:00:19
      674500 -- (-584.449) (-586.336) (-584.043) [-583.442] * (-583.729) (-585.213) (-583.618) [-583.613] -- 0:00:19
      675000 -- (-584.606) [-583.671] (-583.955) (-587.426) * (-583.238) (-584.835) (-589.282) [-583.761] -- 0:00:19

      Average standard deviation of split frequencies: 0.011070

      675500 -- (-585.420) [-583.636] (-583.178) (-587.456) * [-583.238] (-583.802) (-583.487) (-589.479) -- 0:00:19
      676000 -- (-586.038) (-586.148) [-583.017] (-584.527) * [-585.408] (-587.591) (-586.734) (-583.354) -- 0:00:19
      676500 -- [-582.832] (-583.782) (-584.911) (-583.735) * (-585.379) (-584.078) (-586.657) [-583.286] -- 0:00:19
      677000 -- (-583.155) (-583.111) [-590.657] (-584.481) * (-590.166) (-584.634) [-584.810] (-585.322) -- 0:00:19
      677500 -- (-584.107) (-585.884) (-590.768) [-584.960] * (-585.613) (-587.321) (-586.753) [-583.422] -- 0:00:19
      678000 -- (-584.107) (-585.267) (-586.489) [-584.683] * [-584.946] (-586.178) (-583.555) (-584.239) -- 0:00:19
      678500 -- (-584.919) [-586.206] (-584.412) (-587.029) * (-588.256) [-583.421] (-584.749) (-584.223) -- 0:00:19
      679000 -- (-585.271) (-586.070) [-583.268] (-585.450) * [-584.743] (-583.752) (-584.529) (-588.304) -- 0:00:19
      679500 -- (-588.334) (-593.328) [-583.738] (-588.298) * (-585.710) (-587.559) [-586.114] (-584.924) -- 0:00:19
      680000 -- (-584.658) (-585.340) (-583.964) [-584.810] * (-583.606) (-585.296) [-584.014] (-585.824) -- 0:00:19

      Average standard deviation of split frequencies: 0.011427

      680500 -- (-584.583) [-588.344] (-585.428) (-586.729) * [-584.786] (-588.494) (-585.491) (-584.246) -- 0:00:19
      681000 -- (-583.612) [-591.056] (-589.306) (-585.025) * (-587.078) (-587.366) (-586.510) [-583.706] -- 0:00:19
      681500 -- [-585.001] (-589.788) (-587.131) (-583.450) * [-586.708] (-584.782) (-587.350) (-584.694) -- 0:00:19
      682000 -- (-584.466) (-583.876) [-584.430] (-583.449) * (-585.197) [-583.575] (-585.134) (-585.583) -- 0:00:19
      682500 -- (-584.453) (-582.833) (-586.013) [-583.540] * (-583.404) (-585.208) [-586.410] (-585.406) -- 0:00:19
      683000 -- (-584.065) (-583.463) [-586.666] (-584.497) * (-587.926) (-584.303) [-583.273] (-586.521) -- 0:00:19
      683500 -- (-588.993) [-585.627] (-583.678) (-594.977) * [-585.329] (-585.880) (-584.200) (-586.214) -- 0:00:18
      684000 -- (-586.107) (-587.559) [-585.218] (-588.766) * (-586.821) (-583.019) (-585.035) [-584.056] -- 0:00:18
      684500 -- (-586.389) (-585.707) (-583.831) [-584.759] * [-583.385] (-586.841) (-585.241) (-584.744) -- 0:00:18
      685000 -- [-584.851] (-587.308) (-585.286) (-588.872) * [-583.822] (-583.663) (-586.554) (-584.375) -- 0:00:18

      Average standard deviation of split frequencies: 0.011237

      685500 -- (-585.316) (-585.162) [-583.205] (-586.308) * (-583.313) (-584.969) (-583.531) [-583.011] -- 0:00:18
      686000 -- [-587.354] (-587.079) (-586.917) (-582.935) * [-583.859] (-585.202) (-584.081) (-584.102) -- 0:00:18
      686500 -- (-585.020) (-583.745) [-582.846] (-585.188) * (-586.873) (-584.192) [-583.979] (-586.519) -- 0:00:18
      687000 -- (-585.972) (-584.635) [-584.250] (-587.408) * (-585.320) [-584.391] (-585.633) (-585.011) -- 0:00:18
      687500 -- (-585.484) (-589.809) [-584.113] (-585.317) * [-583.166] (-582.898) (-587.280) (-583.683) -- 0:00:19
      688000 -- [-585.811] (-588.921) (-583.462) (-587.580) * (-584.938) (-584.273) [-583.573] (-583.955) -- 0:00:19
      688500 -- (-588.456) (-583.048) (-586.184) [-583.352] * (-585.482) [-584.259] (-591.260) (-584.622) -- 0:00:19
      689000 -- (-588.013) (-585.739) [-583.260] (-587.306) * (-586.476) (-586.496) (-588.114) [-586.518] -- 0:00:18
      689500 -- (-584.126) (-587.138) [-585.903] (-587.671) * (-586.072) [-583.864] (-586.961) (-583.363) -- 0:00:18
      690000 -- (-584.680) (-587.527) (-588.195) [-586.646] * [-584.309] (-588.701) (-587.601) (-583.864) -- 0:00:18

      Average standard deviation of split frequencies: 0.010579

      690500 -- (-585.092) (-583.472) [-587.245] (-586.312) * (-588.554) [-583.902] (-583.730) (-583.447) -- 0:00:18
      691000 -- (-583.848) [-586.313] (-588.383) (-584.580) * (-584.559) (-587.058) [-583.600] (-584.997) -- 0:00:18
      691500 -- [-587.951] (-584.974) (-589.633) (-583.992) * (-584.617) (-586.850) [-585.191] (-588.354) -- 0:00:18
      692000 -- (-584.774) (-583.585) [-584.628] (-585.040) * (-584.877) (-584.842) (-584.799) [-584.468] -- 0:00:18
      692500 -- (-584.967) (-583.980) (-585.095) [-583.568] * (-585.826) [-584.210] (-583.794) (-583.683) -- 0:00:18
      693000 -- (-586.144) (-586.411) (-583.321) [-583.969] * (-584.550) [-582.890] (-584.571) (-588.670) -- 0:00:18
      693500 -- (-583.357) (-587.401) [-585.732] (-584.197) * (-584.536) [-584.445] (-585.784) (-591.618) -- 0:00:18
      694000 -- (-592.003) [-585.241] (-585.282) (-583.470) * [-583.829] (-585.815) (-585.698) (-583.624) -- 0:00:18
      694500 -- (-585.395) (-583.066) (-586.251) [-583.577] * (-591.109) [-583.967] (-585.344) (-587.157) -- 0:00:18
      695000 -- (-588.496) [-585.357] (-583.918) (-583.322) * (-586.950) (-584.475) [-584.250] (-590.400) -- 0:00:18

      Average standard deviation of split frequencies: 0.010040

      695500 -- [-586.531] (-584.425) (-585.502) (-586.316) * (-586.579) (-588.265) (-588.225) [-584.236] -- 0:00:18
      696000 -- (-585.543) (-584.911) [-584.299] (-586.761) * (-584.862) [-587.346] (-587.571) (-584.359) -- 0:00:18
      696500 -- (-583.959) (-585.816) [-582.798] (-584.977) * [-585.160] (-585.852) (-587.148) (-586.461) -- 0:00:18
      697000 -- [-583.326] (-586.603) (-588.501) (-586.808) * (-587.116) [-584.156] (-586.407) (-585.729) -- 0:00:18
      697500 -- (-583.915) (-584.468) (-589.422) [-584.353] * [-587.462] (-584.177) (-585.367) (-583.710) -- 0:00:18
      698000 -- (-584.598) (-586.434) (-585.241) [-584.017] * (-587.008) (-583.409) (-585.598) [-583.427] -- 0:00:18
      698500 -- (-587.267) (-585.064) (-584.241) [-583.125] * [-588.723] (-585.255) (-584.216) (-584.637) -- 0:00:18
      699000 -- (-586.215) (-585.338) [-585.967] (-587.621) * (-584.413) (-585.159) [-584.422] (-584.577) -- 0:00:18
      699500 -- [-586.696] (-588.315) (-591.273) (-586.285) * (-587.675) (-584.976) (-585.459) [-584.516] -- 0:00:18
      700000 -- [-584.104] (-584.886) (-583.460) (-585.843) * (-584.052) [-583.595] (-587.468) (-583.573) -- 0:00:18

      Average standard deviation of split frequencies: 0.009587

      700500 -- [-584.869] (-584.587) (-585.106) (-589.010) * (-585.528) [-584.173] (-587.913) (-585.274) -- 0:00:17
      701000 -- (-587.355) (-584.118) (-585.886) [-583.892] * (-584.731) (-585.302) (-587.203) [-584.138] -- 0:00:17
      701500 -- (-583.397) (-583.451) (-586.785) [-584.478] * (-583.892) [-583.810] (-585.412) (-584.581) -- 0:00:17
      702000 -- [-583.249] (-583.247) (-585.294) (-585.546) * (-583.576) (-588.925) [-583.384] (-583.637) -- 0:00:17
      702500 -- (-583.549) (-583.113) [-584.654] (-584.641) * (-584.353) (-586.338) [-582.780] (-582.954) -- 0:00:17
      703000 -- (-584.280) [-583.885] (-585.202) (-584.644) * (-584.277) (-585.187) [-585.612] (-584.311) -- 0:00:17
      703500 -- (-584.620) [-584.921] (-584.286) (-584.023) * (-587.148) (-586.625) (-586.606) [-584.818] -- 0:00:17
      704000 -- (-585.367) (-587.304) (-584.798) [-584.747] * (-584.926) (-587.572) [-586.104] (-584.797) -- 0:00:18
      704500 -- [-583.896] (-587.038) (-584.055) (-583.599) * (-588.199) (-588.265) (-587.938) [-584.583] -- 0:00:18
      705000 -- (-584.461) (-583.236) (-584.375) [-587.787] * [-585.267] (-583.102) (-584.564) (-583.564) -- 0:00:17

      Average standard deviation of split frequencies: 0.009584

      705500 -- [-584.495] (-583.973) (-592.038) (-586.030) * (-585.315) (-587.290) (-585.854) [-583.564] -- 0:00:17
      706000 -- (-587.108) (-592.047) (-590.364) [-586.112] * (-586.330) (-583.230) [-583.167] (-585.437) -- 0:00:17
      706500 -- (-584.992) (-585.286) [-583.822] (-588.235) * (-585.494) (-587.822) [-586.023] (-583.503) -- 0:00:17
      707000 -- (-585.256) [-585.910] (-583.063) (-587.677) * (-586.156) [-584.642] (-590.626) (-583.091) -- 0:00:17
      707500 -- (-584.814) [-586.834] (-586.178) (-585.126) * [-584.129] (-584.269) (-588.994) (-584.122) -- 0:00:17
      708000 -- [-584.535] (-592.855) (-590.576) (-585.349) * (-586.939) [-585.041] (-592.618) (-584.483) -- 0:00:17
      708500 -- [-584.422] (-583.501) (-585.105) (-583.450) * (-586.303) (-584.438) (-586.310) [-583.914] -- 0:00:17
      709000 -- (-584.841) [-584.496] (-584.494) (-584.415) * (-583.506) [-584.318] (-587.068) (-584.189) -- 0:00:17
      709500 -- [-583.455] (-582.959) (-584.983) (-584.124) * (-584.453) [-584.635] (-583.752) (-583.183) -- 0:00:17
      710000 -- [-583.433] (-583.258) (-583.439) (-582.630) * (-583.527) (-585.071) [-584.531] (-583.377) -- 0:00:17

      Average standard deviation of split frequencies: 0.009365

      710500 -- (-583.893) [-583.869] (-587.834) (-585.862) * (-587.048) (-582.838) (-584.840) [-583.877] -- 0:00:17
      711000 -- (-585.709) [-583.288] (-584.641) (-584.405) * (-588.279) (-583.167) (-584.865) [-590.392] -- 0:00:17
      711500 -- (-591.396) (-584.200) [-585.474] (-585.450) * (-584.907) [-584.825] (-585.657) (-588.847) -- 0:00:17
      712000 -- (-584.037) (-585.466) (-583.686) [-583.811] * (-584.967) (-585.071) (-584.177) [-583.404] -- 0:00:17
      712500 -- (-587.817) [-587.343] (-584.746) (-587.360) * (-583.580) [-584.175] (-583.480) (-587.185) -- 0:00:17
      713000 -- (-585.297) [-584.236] (-585.664) (-585.444) * (-586.098) (-584.108) (-582.996) [-588.161] -- 0:00:17
      713500 -- (-583.773) (-583.352) (-583.271) [-584.553] * (-588.175) (-584.290) [-584.603] (-586.555) -- 0:00:17
      714000 -- (-584.054) (-587.763) (-583.006) [-586.525] * (-587.151) (-583.852) (-583.601) [-587.108] -- 0:00:17
      714500 -- (-584.140) [-586.479] (-584.391) (-588.398) * [-584.705] (-582.880) (-584.550) (-590.520) -- 0:00:17
      715000 -- (-584.049) (-583.203) (-585.029) [-585.827] * (-589.239) (-585.962) [-585.378] (-590.098) -- 0:00:17

      Average standard deviation of split frequencies: 0.009024

      715500 -- [-584.288] (-584.501) (-589.721) (-586.945) * (-583.353) (-588.813) (-586.214) [-586.733] -- 0:00:17
      716000 -- (-585.367) (-583.878) (-585.905) [-584.999] * [-584.730] (-584.598) (-589.355) (-583.378) -- 0:00:17
      716500 -- (-585.336) (-587.815) (-588.150) [-583.824] * (-586.176) (-584.282) (-589.260) [-585.964] -- 0:00:17
      717000 -- (-583.322) (-588.305) [-587.181] (-586.680) * (-583.273) [-584.536] (-585.970) (-583.466) -- 0:00:16
      717500 -- (-583.807) [-583.772] (-591.406) (-583.391) * (-585.792) (-585.045) [-587.271] (-588.314) -- 0:00:16
      718000 -- [-584.496] (-587.461) (-586.381) (-584.477) * [-583.231] (-587.297) (-583.848) (-589.476) -- 0:00:16
      718500 -- (-589.381) [-589.745] (-584.265) (-589.983) * (-583.884) [-585.212] (-584.899) (-583.977) -- 0:00:16
      719000 -- (-583.986) [-586.767] (-584.232) (-589.241) * (-583.411) (-584.291) (-586.193) [-585.375] -- 0:00:16
      719500 -- (-583.947) [-585.231] (-586.523) (-586.523) * (-584.958) (-584.072) [-585.614] (-583.615) -- 0:00:16
      720000 -- (-585.121) (-588.360) (-584.960) [-583.796] * [-587.089] (-584.605) (-584.513) (-584.481) -- 0:00:16

      Average standard deviation of split frequencies: 0.009273

      720500 -- (-586.334) (-585.082) [-584.914] (-584.905) * (-585.104) [-584.880] (-584.161) (-583.902) -- 0:00:16
      721000 -- [-587.066] (-584.664) (-583.146) (-585.008) * [-583.900] (-583.931) (-587.507) (-588.477) -- 0:00:17
      721500 -- (-582.820) (-584.228) [-583.983] (-583.763) * (-585.404) (-583.006) [-587.259] (-586.166) -- 0:00:16
      722000 -- (-583.894) (-584.121) (-584.579) [-585.295] * (-588.066) [-584.914] (-583.691) (-586.053) -- 0:00:16
      722500 -- (-584.201) (-585.290) (-585.725) [-583.544] * (-585.175) [-586.306] (-585.914) (-585.295) -- 0:00:16
      723000 -- [-583.796] (-583.716) (-583.002) (-587.885) * (-583.175) (-583.734) (-584.647) [-585.373] -- 0:00:16
      723500 -- (-588.342) (-591.075) [-583.340] (-585.975) * (-583.564) (-583.715) [-586.040] (-583.745) -- 0:00:16
      724000 -- (-585.593) (-587.433) (-584.464) [-585.065] * (-582.735) [-584.858] (-585.036) (-588.435) -- 0:00:16
      724500 -- (-587.019) (-584.927) [-583.999] (-584.083) * (-587.511) (-586.953) (-584.923) [-585.228] -- 0:00:16
      725000 -- (-583.845) [-583.909] (-584.741) (-584.805) * (-584.465) [-588.438] (-588.281) (-584.581) -- 0:00:16

      Average standard deviation of split frequencies: 0.009167

      725500 -- (-587.323) (-584.719) (-588.969) [-583.781] * (-583.492) (-583.765) (-585.319) [-583.165] -- 0:00:16
      726000 -- (-583.938) (-586.672) (-585.831) [-583.737] * [-588.035] (-586.370) (-584.967) (-585.114) -- 0:00:16
      726500 -- (-584.689) [-585.602] (-587.709) (-583.740) * (-584.461) [-585.554] (-584.401) (-583.919) -- 0:00:16
      727000 -- (-583.405) (-586.380) [-586.552] (-584.741) * (-585.415) (-586.125) [-583.806] (-585.322) -- 0:00:16
      727500 -- (-585.990) [-586.824] (-585.900) (-586.889) * [-584.512] (-588.198) (-586.129) (-586.093) -- 0:00:16
      728000 -- (-586.559) (-584.284) [-585.774] (-584.172) * (-583.723) (-587.153) [-587.257] (-584.265) -- 0:00:16
      728500 -- (-586.653) (-585.507) (-591.605) [-584.545] * (-586.691) (-588.557) (-586.426) [-584.469] -- 0:00:16
      729000 -- (-585.295) (-584.871) [-584.502] (-584.649) * (-584.071) (-584.549) [-590.606] (-584.542) -- 0:00:16
      729500 -- (-588.545) [-586.294] (-583.974) (-584.574) * (-587.857) [-586.093] (-593.714) (-585.969) -- 0:00:16
      730000 -- (-586.800) [-585.204] (-585.416) (-585.076) * (-587.719) [-584.525] (-585.202) (-586.762) -- 0:00:16

      Average standard deviation of split frequencies: 0.008691

      730500 -- (-585.199) [-583.059] (-584.227) (-584.923) * (-584.440) [-585.070] (-585.097) (-585.947) -- 0:00:16
      731000 -- (-585.480) (-584.964) [-584.528] (-588.838) * (-584.480) (-583.093) [-584.565] (-588.512) -- 0:00:16
      731500 -- (-584.192) (-583.410) (-588.723) [-587.050] * (-584.368) (-586.141) (-586.075) [-587.128] -- 0:00:16
      732000 -- (-584.482) (-583.077) [-586.469] (-587.280) * (-584.468) (-583.903) [-584.770] (-584.502) -- 0:00:16
      732500 -- (-583.848) [-584.154] (-586.821) (-585.934) * (-584.726) [-589.238] (-585.234) (-589.557) -- 0:00:16
      733000 -- (-584.001) (-582.841) (-588.589) [-583.634] * (-587.012) (-587.042) [-584.105] (-588.529) -- 0:00:16
      733500 -- (-583.455) (-584.309) (-585.412) [-589.188] * (-583.424) (-585.089) [-587.474] (-584.295) -- 0:00:15
      734000 -- (-584.018) (-585.431) (-584.913) [-586.873] * [-583.979] (-584.109) (-585.497) (-584.552) -- 0:00:15
      734500 -- [-584.057] (-584.185) (-587.019) (-587.252) * [-584.260] (-586.153) (-586.372) (-586.466) -- 0:00:15
      735000 -- (-582.855) (-583.143) (-584.691) [-585.465] * (-586.844) [-584.109] (-584.209) (-584.073) -- 0:00:15

      Average standard deviation of split frequencies: 0.008439

      735500 -- (-582.959) [-584.562] (-593.436) (-585.343) * [-583.832] (-584.727) (-585.424) (-584.036) -- 0:00:15
      736000 -- (-583.920) (-585.565) (-586.283) [-583.710] * (-584.999) [-584.996] (-587.138) (-589.723) -- 0:00:15
      736500 -- (-585.097) [-585.606] (-588.019) (-585.698) * (-585.094) [-586.448] (-585.099) (-585.639) -- 0:00:15
      737000 -- (-583.853) (-584.918) [-585.517] (-586.549) * [-583.834] (-584.878) (-585.698) (-586.178) -- 0:00:15
      737500 -- (-583.495) [-584.784] (-586.198) (-586.482) * (-588.000) [-584.697] (-585.351) (-583.650) -- 0:00:15
      738000 -- (-583.851) [-584.549] (-586.180) (-586.613) * (-588.249) (-585.455) (-587.806) [-585.490] -- 0:00:15
      738500 -- (-585.741) [-585.668] (-586.312) (-585.969) * (-590.232) (-584.048) [-583.797] (-587.768) -- 0:00:15
      739000 -- (-586.602) [-586.374] (-586.323) (-584.408) * (-590.146) [-583.507] (-583.925) (-588.601) -- 0:00:15
      739500 -- (-586.146) [-584.556] (-586.878) (-584.032) * (-592.680) (-585.625) [-583.954] (-585.754) -- 0:00:15
      740000 -- (-587.193) (-587.914) (-583.496) [-583.942] * (-588.777) (-589.763) (-583.823) [-584.215] -- 0:00:15

      Average standard deviation of split frequencies: 0.008274

      740500 -- (-586.570) (-585.210) [-584.083] (-586.438) * (-585.153) (-585.154) [-590.084] (-584.576) -- 0:00:15
      741000 -- (-586.563) [-584.341] (-586.670) (-584.218) * (-585.649) [-587.698] (-585.377) (-587.640) -- 0:00:15
      741500 -- (-589.479) (-588.722) (-586.687) [-585.384] * [-586.555] (-586.325) (-588.356) (-584.253) -- 0:00:15
      742000 -- (-585.314) [-589.566] (-583.096) (-584.563) * (-586.530) (-587.512) (-585.021) [-585.371] -- 0:00:15
      742500 -- (-583.212) (-585.077) [-584.968] (-583.972) * (-584.240) (-587.329) [-588.796] (-583.823) -- 0:00:15
      743000 -- (-586.479) [-584.624] (-586.964) (-584.580) * [-585.736] (-586.403) (-584.784) (-584.381) -- 0:00:15
      743500 -- [-586.340] (-584.380) (-584.304) (-586.549) * (-584.065) (-584.060) [-584.957] (-583.827) -- 0:00:15
      744000 -- (-584.763) (-584.933) [-583.314] (-586.547) * [-586.802] (-582.946) (-585.487) (-583.550) -- 0:00:15
      744500 -- (-591.436) [-583.200] (-583.634) (-585.073) * (-586.387) (-585.813) (-584.379) [-583.807] -- 0:00:15
      745000 -- [-582.746] (-583.857) (-585.152) (-582.890) * (-584.663) (-585.585) (-583.687) [-584.465] -- 0:00:15

      Average standard deviation of split frequencies: 0.007992

      745500 -- (-583.717) (-585.244) (-584.697) [-585.009] * (-583.007) (-584.275) [-588.311] (-585.191) -- 0:00:15
      746000 -- (-583.429) [-589.359] (-588.593) (-586.221) * (-585.412) (-586.890) [-583.366] (-585.715) -- 0:00:15
      746500 -- (-584.872) (-586.045) [-583.095] (-585.289) * (-588.405) (-582.969) (-585.943) [-585.573] -- 0:00:15
      747000 -- (-584.678) (-583.540) [-584.401] (-583.775) * (-585.165) [-584.089] (-587.091) (-590.558) -- 0:00:15
      747500 -- (-587.250) [-584.021] (-583.075) (-584.321) * (-587.750) (-583.576) (-584.893) [-585.275] -- 0:00:15
      748000 -- (-590.248) (-585.478) (-582.933) [-586.622] * (-591.642) (-586.524) [-584.200] (-587.055) -- 0:00:15
      748500 -- (-585.722) (-584.592) (-584.158) [-583.630] * (-590.365) [-586.396] (-586.399) (-587.103) -- 0:00:15
      749000 -- (-585.556) (-586.608) (-587.521) [-583.280] * (-585.707) (-588.592) [-583.557] (-583.472) -- 0:00:15
      749500 -- [-585.291] (-583.883) (-589.186) (-583.338) * (-585.667) (-584.560) [-585.409] (-583.961) -- 0:00:15
      750000 -- [-584.757] (-583.640) (-585.580) (-584.950) * (-586.157) (-585.520) (-585.412) [-584.897] -- 0:00:15

      Average standard deviation of split frequencies: 0.008127

      750500 -- (-585.975) [-584.644] (-584.667) (-586.373) * (-585.767) (-584.533) (-584.841) [-583.108] -- 0:00:14
      751000 -- [-583.640] (-584.542) (-584.540) (-585.039) * (-583.373) [-587.436] (-583.518) (-588.550) -- 0:00:14
      751500 -- (-583.025) [-583.763] (-585.602) (-587.224) * (-585.881) (-584.495) [-584.794] (-583.139) -- 0:00:14
      752000 -- (-596.487) [-582.996] (-585.897) (-584.200) * (-585.708) (-584.006) [-587.668] (-584.668) -- 0:00:14
      752500 -- [-586.059] (-585.270) (-590.247) (-585.562) * (-585.039) (-587.315) [-585.578] (-583.583) -- 0:00:14
      753000 -- (-584.731) (-588.947) (-585.536) [-585.090] * (-583.128) (-587.992) [-587.677] (-584.026) -- 0:00:14
      753500 -- (-586.352) (-586.225) [-586.413] (-583.994) * (-584.368) (-586.933) [-585.678] (-586.142) -- 0:00:14
      754000 -- (-584.607) (-583.903) (-584.133) [-583.994] * (-585.750) (-587.013) (-586.034) [-584.931] -- 0:00:14
      754500 -- (-584.109) [-583.468] (-584.079) (-584.076) * (-587.243) (-584.126) (-582.946) [-583.751] -- 0:00:14
      755000 -- [-586.005] (-583.219) (-583.372) (-585.216) * (-590.018) (-583.260) [-585.425] (-585.727) -- 0:00:14

      Average standard deviation of split frequencies: 0.007677

      755500 -- (-586.797) (-584.590) [-584.014] (-585.281) * (-585.256) (-586.990) [-586.450] (-585.144) -- 0:00:14
      756000 -- (-584.885) [-585.766] (-583.605) (-585.603) * [-583.904] (-584.524) (-584.874) (-585.659) -- 0:00:14
      756500 -- (-583.736) (-583.518) [-585.384] (-583.658) * [-583.909] (-584.694) (-585.424) (-585.197) -- 0:00:14
      757000 -- (-593.254) [-586.481] (-585.667) (-586.059) * [-587.922] (-588.236) (-585.626) (-585.829) -- 0:00:14
      757500 -- (-586.690) (-583.250) [-588.911] (-588.268) * [-584.215] (-590.643) (-584.672) (-583.152) -- 0:00:14
      758000 -- (-583.567) [-584.148] (-585.252) (-586.246) * (-586.221) (-586.356) [-586.472] (-584.031) -- 0:00:14
      758500 -- (-585.252) (-587.028) (-584.323) [-588.210] * (-585.403) (-584.328) (-587.225) [-584.623] -- 0:00:14
      759000 -- (-583.962) (-587.871) [-585.427] (-586.126) * (-583.767) (-584.431) (-585.922) [-583.837] -- 0:00:14
      759500 -- (-583.514) (-587.583) [-583.320] (-585.526) * [-583.867] (-586.014) (-588.004) (-583.688) -- 0:00:14
      760000 -- (-585.330) [-584.136] (-584.208) (-584.972) * (-584.497) (-585.438) (-585.672) [-583.622] -- 0:00:14

      Average standard deviation of split frequencies: 0.007359

      760500 -- (-583.803) (-587.666) [-583.759] (-583.584) * (-583.691) (-586.356) [-583.592] (-586.393) -- 0:00:14
      761000 -- (-586.525) (-586.561) (-583.211) [-584.390] * (-587.750) (-584.051) [-585.615] (-584.586) -- 0:00:14
      761500 -- (-586.9