--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:56:08 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1909/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -584.32 -591.59
2 -584.35 -588.16
--------------------------------------
TOTAL -584.33 -590.92
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902444 0.087321 0.373170 1.496193 0.872600 1349.52 1419.59 1.001
r(A<->C){all} 0.166410 0.022252 0.000008 0.467394 0.126188 146.78 147.13 1.000
r(A<->G){all} 0.173541 0.022932 0.000103 0.486675 0.130673 148.75 168.10 1.001
r(A<->T){all} 0.159929 0.020116 0.000015 0.447352 0.121189 228.61 256.86 1.001
r(C<->G){all} 0.171668 0.020605 0.000145 0.462179 0.134398 150.95 175.14 1.000
r(C<->T){all} 0.166236 0.019283 0.000057 0.446715 0.127252 111.80 168.73 1.000
r(G<->T){all} 0.162217 0.018945 0.000008 0.451252 0.125645 75.74 120.55 1.002
pi(A){all} 0.207577 0.000373 0.170134 0.246935 0.207146 1264.80 1348.30 1.000
pi(C){all} 0.248465 0.000424 0.208130 0.288527 0.247540 1186.57 1255.88 1.000
pi(G){all} 0.330404 0.000511 0.288920 0.377016 0.330343 928.46 1192.65 1.002
pi(T){all} 0.213553 0.000402 0.175119 0.251457 0.213099 1188.33 1189.75 1.000
alpha{1,2} 0.411753 0.226594 0.000269 1.410952 0.243729 1115.08 1130.49 1.000
alpha{3} 0.472470 0.271632 0.000145 1.562550 0.292935 1143.32 1190.90 1.000
pinvar{all} 0.996261 0.000021 0.987903 0.999996 0.997642 1149.54 1248.36 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -559.333184
Model 2: PositiveSelection -559.333146
Model 0: one-ratio -559.333169
Model 7: beta -559.333175
Model 8: beta&w>1 -559.333167
Model 0 vs 1 2.999999992425728E-5
Model 2 vs 1 7.599999980811845E-5
Model 8 vs 7 1.5999999959603883E-5
>C1
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C2
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C3
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C4
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C5
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C6
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=142
C1 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C2 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C3 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C4 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C5 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C6 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
**************************************************
C1 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C2 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C3 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C4 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C5 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C6 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
**************************************************
C1 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C2 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C3 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C4 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C5 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C6 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
******************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4260]--->[4260]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.465 Mb, Max= 30.674 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C2 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C3 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C4 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C5 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
C6 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
**************************************************
C1 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C2 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C3 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C4 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C5 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
C6 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
**************************************************
C1 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C2 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C3 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C4 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C5 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
C6 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
******************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
C2 ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
C3 ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
C4 ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
C5 ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
C6 ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
**************************************************
C1 AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
C2 AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
C3 AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
C4 AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
C5 AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
C6 AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
**************************************************
C1 CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
C2 CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
C3 CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
C4 CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
C5 CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
C6 CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
**************************************************
C1 GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
C2 GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
C3 GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
C4 GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
C5 GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
C6 GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
**************************************************
C1 CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
C2 CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
C3 CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
C4 CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
C5 CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
C6 CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
**************************************************
C1 ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
C2 ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
C3 ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
C4 ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
C5 ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
C6 ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
**************************************************
C1 GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
C2 GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
C3 GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
C4 GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
C5 GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
C6 GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
**************************************************
C1 GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
C2 GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
C3 GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
C4 GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
C5 GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
C6 GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
**************************************************
C1 GGGCTATCGCTTCAGCGAAACTGGCG
C2 GGGCTATCGCTTCAGCGAAACTGGCG
C3 GGGCTATCGCTTCAGCGAAACTGGCG
C4 GGGCTATCGCTTCAGCGAAACTGGCG
C5 GGGCTATCGCTTCAGCGAAACTGGCG
C6 GGGCTATCGCTTCAGCGAAACTGGCG
**************************
>C1
ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
GGGCTATCGCTTCAGCGAAACTGGCG
>C2
ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
GGGCTATCGCTTCAGCGAAACTGGCG
>C3
ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
GGGCTATCGCTTCAGCGAAACTGGCG
>C4
ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
GGGCTATCGCTTCAGCGAAACTGGCG
>C5
ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
GGGCTATCGCTTCAGCGAAACTGGCG
>C6
ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA
AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT
CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG
GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG
CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA
ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC
GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC
GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC
GGGCTATCGCTTCAGCGAAACTGGCG
>C1
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C2
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C3
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C4
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C5
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
>C6
MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 426 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579859682
Setting output file names to "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1464351786
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5105244773
Seed = 1145501786
Swapseed = 1579859682
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -953.408421 -- -24.965149
Chain 2 -- -953.408421 -- -24.965149
Chain 3 -- -953.408366 -- -24.965149
Chain 4 -- -953.408276 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -953.408366 -- -24.965149
Chain 2 -- -953.408421 -- -24.965149
Chain 3 -- -953.408276 -- -24.965149
Chain 4 -- -953.408421 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-953.408] (-953.408) (-953.408) (-953.408) * [-953.408] (-953.408) (-953.408) (-953.408)
500 -- (-591.268) (-598.573) [-595.875] (-591.217) * (-606.485) [-596.150] (-593.646) (-590.852) -- 0:00:00
1000 -- (-589.213) (-598.304) [-598.479] (-593.787) * (-597.930) [-593.470] (-595.348) (-602.786) -- 0:00:00
1500 -- (-595.755) (-595.816) (-588.457) [-599.542] * (-601.195) (-591.323) (-586.567) [-596.297] -- 0:00:00
2000 -- (-591.078) (-594.048) (-592.039) [-593.795] * (-602.351) [-589.306] (-597.421) (-591.388) -- 0:00:00
2500 -- (-594.882) (-592.667) [-596.576] (-599.103) * (-598.577) [-594.071] (-594.142) (-605.884) -- 0:00:00
3000 -- (-594.050) [-589.947] (-592.204) (-594.671) * [-591.337] (-592.805) (-598.598) (-593.969) -- 0:00:00
3500 -- (-597.219) (-596.964) (-592.708) [-596.195] * (-591.070) (-598.407) [-593.139] (-597.750) -- 0:00:00
4000 -- (-592.037) [-594.514] (-593.431) (-602.667) * [-590.086] (-595.337) (-600.651) (-590.707) -- 0:00:00
4500 -- [-589.775] (-592.833) (-600.873) (-593.209) * (-592.970) [-597.808] (-598.989) (-592.221) -- 0:00:00
5000 -- [-598.368] (-591.102) (-600.610) (-602.182) * (-593.556) [-590.004] (-597.605) (-596.563) -- 0:00:00
Average standard deviation of split frequencies: 0.088815
5500 -- (-599.933) [-591.874] (-604.842) (-594.305) * [-599.299] (-596.556) (-593.001) (-601.195) -- 0:00:00
6000 -- (-604.055) [-600.922] (-596.518) (-593.099) * (-597.001) (-597.933) [-592.510] (-590.047) -- 0:00:00
6500 -- [-600.789] (-594.743) (-605.483) (-594.982) * (-592.242) (-607.407) [-590.068] (-586.517) -- 0:00:00
7000 -- (-592.766) [-597.214] (-594.799) (-593.701) * [-596.897] (-594.259) (-595.247) (-595.183) -- 0:00:00
7500 -- [-595.730] (-603.791) (-598.985) (-596.130) * [-593.609] (-584.266) (-593.218) (-595.946) -- 0:00:00
8000 -- [-591.604] (-590.762) (-601.367) (-596.668) * [-589.133] (-583.262) (-589.674) (-597.428) -- 0:00:00
8500 -- (-598.534) (-595.275) [-586.431] (-590.804) * [-590.803] (-591.161) (-591.397) (-597.436) -- 0:00:00
9000 -- (-594.501) (-604.157) (-586.648) [-595.461] * [-593.480] (-587.281) (-596.434) (-589.755) -- 0:00:00
9500 -- (-588.221) [-591.000] (-583.534) (-595.263) * [-594.008] (-585.574) (-596.292) (-593.087) -- 0:00:00
10000 -- (-586.372) (-592.659) (-584.183) [-595.135] * [-593.171] (-583.626) (-593.282) (-593.325) -- 0:00:00
Average standard deviation of split frequencies: 0.079550
10500 -- (-585.389) [-590.456] (-590.135) (-603.113) * (-594.574) (-583.075) (-597.011) [-589.586] -- 0:00:00
11000 -- (-584.143) (-593.172) (-587.206) [-592.278] * [-591.694] (-585.821) (-589.938) (-595.964) -- 0:00:00
11500 -- [-584.240] (-591.028) (-586.724) (-596.219) * (-601.141) (-584.391) [-590.761] (-597.307) -- 0:00:00
12000 -- [-583.743] (-596.467) (-585.149) (-600.672) * [-590.418] (-585.118) (-594.525) (-590.579) -- 0:00:00
12500 -- (-583.349) [-594.470] (-584.959) (-591.167) * (-596.461) [-584.750] (-591.456) (-599.000) -- 0:00:00
13000 -- (-583.808) [-586.484] (-584.489) (-592.107) * (-589.239) [-584.764] (-596.337) (-593.311) -- 0:00:00
13500 -- (-585.787) (-591.043) [-589.286] (-594.094) * (-597.017) [-583.878] (-586.910) (-595.287) -- 0:00:00
14000 -- (-585.321) (-589.949) (-585.431) [-592.479] * (-593.167) [-583.189] (-596.054) (-590.859) -- 0:01:10
14500 -- (-583.762) [-588.770] (-582.817) (-590.206) * (-592.433) (-583.530) (-595.254) [-590.946] -- 0:01:07
15000 -- (-585.532) [-594.030] (-587.329) (-591.251) * (-591.467) (-585.756) [-593.588] (-594.958) -- 0:01:05
Average standard deviation of split frequencies: 0.066291
15500 -- (-585.446) [-588.744] (-587.111) (-591.144) * (-591.700) (-584.896) [-598.833] (-593.477) -- 0:01:03
16000 -- (-585.383) [-597.807] (-587.627) (-597.563) * (-598.223) (-584.665) [-592.437] (-595.168) -- 0:01:01
16500 -- (-588.501) [-592.433] (-590.338) (-587.922) * [-591.456] (-586.895) (-591.293) (-594.407) -- 0:00:59
17000 -- [-585.980] (-593.382) (-585.749) (-596.450) * (-590.058) [-586.229] (-594.257) (-589.640) -- 0:00:57
17500 -- (-584.227) (-597.213) [-583.618] (-589.686) * (-588.896) (-585.437) [-591.943] (-591.428) -- 0:00:56
18000 -- [-586.975] (-593.062) (-585.114) (-594.183) * (-597.564) (-585.661) (-593.253) [-590.997] -- 0:00:54
18500 -- (-584.413) [-590.484] (-584.367) (-591.876) * (-595.912) (-593.521) (-594.113) [-590.580] -- 0:00:53
19000 -- (-586.976) [-593.653] (-583.664) (-595.369) * (-587.715) (-587.717) [-590.837] (-596.151) -- 0:00:51
19500 -- (-587.547) (-589.836) [-585.363] (-592.429) * (-590.116) (-587.383) [-594.411] (-594.258) -- 0:00:50
20000 -- (-584.754) (-601.441) (-584.558) [-598.202] * (-595.477) (-591.298) (-594.454) [-590.759] -- 0:00:49
Average standard deviation of split frequencies: 0.050689
20500 -- [-586.109] (-590.020) (-583.768) (-593.888) * (-591.867) [-586.711] (-594.078) (-599.260) -- 0:00:47
21000 -- [-584.642] (-599.092) (-584.324) (-595.247) * [-594.085] (-585.984) (-604.454) (-596.608) -- 0:00:46
21500 -- (-583.370) (-600.819) [-584.480] (-599.987) * (-588.921) (-584.259) (-601.844) [-596.504] -- 0:00:45
22000 -- (-585.715) [-593.917] (-586.331) (-599.683) * [-599.125] (-584.612) (-597.990) (-599.472) -- 0:00:44
22500 -- [-588.051] (-597.474) (-583.024) (-594.009) * (-591.675) [-583.298] (-589.742) (-589.631) -- 0:00:43
23000 -- (-582.948) (-594.469) [-583.982] (-589.611) * [-594.963] (-584.917) (-592.931) (-587.577) -- 0:00:42
23500 -- [-588.143] (-596.564) (-585.181) (-595.379) * (-602.213) (-584.788) (-591.455) [-586.236] -- 0:00:41
24000 -- (-586.994) [-592.383] (-587.559) (-594.431) * (-599.866) (-586.393) [-593.799] (-589.298) -- 0:00:40
24500 -- [-585.000] (-593.824) (-584.175) (-600.362) * (-596.168) [-584.362] (-592.727) (-584.639) -- 0:00:39
25000 -- (-586.166) (-595.254) (-584.549) [-591.095] * (-587.932) [-586.180] (-590.613) (-585.700) -- 0:00:39
Average standard deviation of split frequencies: 0.037086
25500 -- (-583.131) (-598.896) [-583.288] (-589.787) * (-596.860) [-585.047] (-593.024) (-585.116) -- 0:00:38
26000 -- [-586.662] (-604.062) (-583.116) (-605.289) * (-593.882) [-586.340] (-610.422) (-585.043) -- 0:00:37
26500 -- [-585.837] (-599.272) (-584.126) (-599.641) * [-591.850] (-584.209) (-597.595) (-583.149) -- 0:00:36
27000 -- [-587.734] (-595.336) (-584.026) (-593.938) * [-593.681] (-584.109) (-610.594) (-588.556) -- 0:00:36
27500 -- [-583.686] (-593.594) (-583.537) (-600.425) * [-591.979] (-586.489) (-595.594) (-583.571) -- 0:00:35
28000 -- (-584.339) (-590.618) [-585.272] (-594.284) * (-594.908) (-589.930) (-586.931) [-586.788] -- 0:00:34
28500 -- [-587.707] (-598.444) (-585.804) (-592.941) * [-590.343] (-585.118) (-583.812) (-583.603) -- 0:00:34
29000 -- (-587.497) (-595.929) [-584.712] (-597.437) * (-604.764) (-584.679) [-583.648] (-587.671) -- 0:00:33
29500 -- (-584.048) (-598.621) [-583.550] (-595.735) * (-594.591) [-584.495] (-584.094) (-586.867) -- 0:00:32
30000 -- (-584.559) (-588.472) [-585.129] (-596.036) * (-593.921) (-584.948) (-586.762) [-585.374] -- 0:00:32
Average standard deviation of split frequencies: 0.033818
30500 -- [-584.569] (-584.826) (-585.472) (-596.070) * (-594.634) [-585.031] (-588.777) (-585.429) -- 0:01:03
31000 -- (-585.376) [-583.601] (-584.361) (-599.993) * [-591.383] (-585.825) (-589.461) (-586.794) -- 0:01:02
31500 -- [-583.514] (-588.146) (-584.800) (-604.060) * (-590.094) [-585.299] (-584.896) (-584.290) -- 0:01:01
32000 -- (-589.276) [-586.559] (-586.397) (-595.934) * (-592.671) [-583.943] (-589.026) (-586.120) -- 0:01:00
32500 -- (-588.406) [-586.263] (-584.256) (-592.183) * (-590.878) [-583.908] (-586.530) (-584.992) -- 0:00:59
33000 -- [-586.159] (-584.518) (-584.860) (-583.877) * (-601.890) (-584.520) (-583.619) [-589.339] -- 0:00:58
33500 -- [-586.124] (-584.994) (-583.725) (-586.833) * (-588.980) (-582.938) [-583.704] (-586.489) -- 0:00:57
34000 -- (-584.000) (-583.587) [-586.491] (-583.916) * (-599.092) (-584.243) (-585.606) [-585.153] -- 0:00:56
34500 -- (-587.286) (-586.249) [-585.573] (-584.491) * (-595.056) (-584.127) [-585.537] (-585.345) -- 0:00:55
35000 -- (-583.535) (-586.304) [-585.084] (-584.126) * (-596.778) [-586.884] (-586.748) (-587.212) -- 0:00:55
Average standard deviation of split frequencies: 0.038037
35500 -- (-585.757) (-589.828) (-591.614) [-586.178] * (-606.139) (-586.062) [-584.670] (-584.759) -- 0:00:54
36000 -- (-584.201) (-584.221) (-584.261) [-585.209] * (-602.770) (-585.063) (-583.425) [-583.276] -- 0:00:53
36500 -- (-586.380) [-584.035] (-584.160) (-583.488) * [-590.966] (-584.458) (-584.093) (-584.289) -- 0:00:52
37000 -- (-588.005) (-588.062) [-584.404] (-584.446) * (-602.724) (-590.850) [-585.622] (-585.113) -- 0:00:52
37500 -- (-593.560) (-585.751) [-584.252] (-585.140) * (-596.226) (-590.909) (-583.209) [-584.041] -- 0:00:51
38000 -- [-586.307] (-584.941) (-583.538) (-587.843) * (-592.564) [-584.370] (-584.973) (-584.360) -- 0:00:50
38500 -- (-589.429) [-586.474] (-583.597) (-585.223) * (-594.070) (-585.140) [-584.052] (-584.044) -- 0:00:49
39000 -- (-587.533) (-587.844) [-586.165] (-585.375) * [-600.483] (-584.569) (-587.131) (-585.157) -- 0:00:49
39500 -- (-583.026) [-584.470] (-586.771) (-590.601) * [-596.975] (-586.862) (-584.654) (-583.600) -- 0:00:48
40000 -- (-585.939) (-584.084) [-590.507] (-587.153) * (-592.373) (-584.280) [-585.319] (-584.366) -- 0:00:48
Average standard deviation of split frequencies: 0.035996
40500 -- (-587.673) [-582.897] (-583.770) (-586.307) * (-593.523) (-589.816) (-585.392) [-583.507] -- 0:00:47
41000 -- (-583.186) (-583.848) [-584.130] (-583.283) * [-589.793] (-585.624) (-584.522) (-590.535) -- 0:00:46
41500 -- [-585.044] (-586.498) (-585.724) (-583.501) * (-588.614) (-583.855) [-583.957] (-586.457) -- 0:00:46
42000 -- (-584.619) [-585.683] (-582.706) (-584.671) * (-599.293) (-584.940) (-585.747) [-586.481] -- 0:00:45
42500 -- [-584.596] (-587.046) (-583.740) (-583.613) * (-591.994) (-583.535) (-587.076) [-584.388] -- 0:00:45
43000 -- (-585.375) (-588.488) [-584.806] (-583.863) * (-592.742) (-585.065) (-587.215) [-584.939] -- 0:00:44
43500 -- (-587.025) (-584.116) [-584.811] (-591.270) * [-594.794] (-586.751) (-590.459) (-586.100) -- 0:00:43
44000 -- (-583.187) (-586.683) [-586.801] (-587.077) * (-594.958) (-586.157) (-587.271) [-584.284] -- 0:00:43
44500 -- (-583.186) [-586.248] (-587.757) (-585.266) * (-594.053) (-584.183) [-585.716] (-583.328) -- 0:00:42
45000 -- [-585.605] (-584.786) (-584.734) (-585.279) * (-593.113) (-584.899) (-588.497) [-583.106] -- 0:00:42
Average standard deviation of split frequencies: 0.038663
45500 -- (-582.901) (-584.284) [-586.348] (-585.325) * (-596.519) [-584.321] (-588.956) (-584.118) -- 0:00:41
46000 -- (-583.429) (-582.901) [-589.218] (-585.022) * (-594.873) [-584.683] (-585.364) (-582.775) -- 0:00:41
46500 -- [-583.519] (-583.323) (-588.304) (-585.304) * (-589.102) [-585.981] (-585.814) (-584.118) -- 0:01:01
47000 -- (-584.550) [-583.132] (-584.967) (-584.853) * [-600.016] (-586.729) (-587.675) (-584.628) -- 0:01:00
47500 -- (-584.854) [-585.393] (-584.497) (-586.288) * (-597.979) (-584.198) [-584.558] (-585.221) -- 0:01:00
48000 -- [-584.926] (-584.482) (-583.036) (-584.552) * [-593.652] (-584.019) (-584.241) (-585.844) -- 0:00:59
48500 -- (-584.714) (-583.894) [-584.056] (-584.413) * [-592.620] (-585.769) (-584.944) (-584.612) -- 0:00:58
49000 -- (-584.899) [-584.088] (-586.675) (-584.080) * (-597.059) [-583.794] (-585.305) (-584.271) -- 0:00:58
49500 -- [-584.068] (-586.451) (-587.247) (-584.165) * [-596.673] (-586.876) (-583.905) (-586.491) -- 0:00:57
50000 -- (-584.305) [-584.490] (-585.686) (-584.967) * (-600.047) (-584.231) [-584.558] (-587.396) -- 0:00:57
Average standard deviation of split frequencies: 0.037659
50500 -- [-584.416] (-584.806) (-583.738) (-585.374) * (-617.156) (-584.677) (-584.466) [-588.242] -- 0:00:56
51000 -- (-583.509) (-584.410) (-584.188) [-584.285] * (-604.109) [-584.716] (-583.102) (-587.828) -- 0:00:55
51500 -- (-585.170) (-586.735) (-584.668) [-586.841] * (-600.267) [-585.678] (-586.734) (-586.118) -- 0:00:55
52000 -- [-588.005] (-589.166) (-584.628) (-583.555) * (-596.648) (-584.534) (-583.536) [-585.276] -- 0:00:54
52500 -- (-585.908) (-585.237) (-586.277) [-585.194] * (-584.181) [-583.309] (-584.838) (-586.932) -- 0:00:54
53000 -- [-585.550] (-589.952) (-584.768) (-584.483) * (-586.628) (-584.933) (-588.759) [-587.589] -- 0:00:53
53500 -- (-583.790) (-586.347) (-585.073) [-583.432] * (-584.424) [-587.822] (-589.908) (-584.987) -- 0:00:53
54000 -- [-583.391] (-586.584) (-584.002) (-583.956) * [-583.868] (-583.720) (-586.329) (-586.504) -- 0:00:52
54500 -- (-583.914) (-585.382) [-584.464] (-585.763) * (-583.790) (-583.528) (-589.128) [-584.569] -- 0:00:52
55000 -- (-588.397) (-588.222) [-584.572] (-585.497) * [-587.521] (-585.196) (-587.071) (-586.702) -- 0:00:51
Average standard deviation of split frequencies: 0.034054
55500 -- (-585.751) [-586.233] (-585.869) (-583.762) * (-584.834) [-583.527] (-586.009) (-585.567) -- 0:00:51
56000 -- [-585.300] (-585.487) (-587.431) (-586.981) * (-584.774) (-584.447) [-583.625] (-586.414) -- 0:00:50
56500 -- [-583.688] (-587.276) (-584.733) (-585.131) * (-585.253) (-583.319) (-586.267) [-584.168] -- 0:00:50
57000 -- (-586.106) [-585.004] (-585.157) (-584.227) * (-587.811) [-588.061] (-584.405) (-584.959) -- 0:00:49
57500 -- (-585.613) [-584.684] (-584.210) (-584.540) * (-585.905) (-584.302) (-585.308) [-584.263] -- 0:00:49
58000 -- [-587.878] (-586.238) (-586.973) (-584.832) * [-583.290] (-583.903) (-583.753) (-585.867) -- 0:00:48
58500 -- (-586.480) (-585.480) (-587.856) [-584.212] * (-589.149) (-584.598) (-585.068) [-585.009] -- 0:00:48
59000 -- (-584.628) [-586.844] (-589.402) (-586.662) * [-586.011] (-584.465) (-584.694) (-585.300) -- 0:00:47
59500 -- (-584.554) [-583.754] (-589.718) (-586.044) * (-586.118) [-583.599] (-584.061) (-587.478) -- 0:00:47
60000 -- (-589.064) [-585.721] (-587.782) (-584.521) * (-590.008) (-584.985) [-586.073] (-586.559) -- 0:00:47
Average standard deviation of split frequencies: 0.031452
60500 -- (-586.338) [-586.864] (-585.031) (-584.072) * (-584.371) [-585.330] (-584.585) (-588.060) -- 0:00:46
61000 -- [-585.036] (-586.014) (-584.473) (-585.578) * [-586.547] (-583.204) (-585.591) (-586.434) -- 0:00:46
61500 -- (-585.796) (-584.782) [-583.068] (-584.726) * (-585.407) [-587.598] (-584.960) (-587.484) -- 0:00:45
62000 -- (-587.167) (-584.557) (-582.847) [-589.826] * [-585.779] (-588.553) (-585.730) (-582.720) -- 0:00:45
62500 -- (-588.980) (-583.834) [-583.887] (-584.577) * (-584.294) (-585.006) (-583.133) [-584.364] -- 0:00:45
63000 -- (-586.032) [-583.245] (-583.896) (-584.896) * (-588.242) (-589.510) [-582.962] (-583.430) -- 0:00:44
63500 -- (-588.902) (-583.443) [-585.803] (-587.241) * (-584.968) (-585.277) (-584.268) [-583.332] -- 0:00:58
64000 -- (-590.040) [-582.834] (-586.737) (-583.630) * [-586.663] (-587.279) (-583.197) (-583.302) -- 0:00:58
64500 -- (-585.656) [-582.695] (-587.091) (-586.971) * (-584.803) (-584.774) (-583.529) [-583.567] -- 0:00:58
65000 -- (-590.749) (-582.737) (-583.869) [-583.108] * (-587.222) (-583.291) [-585.285] (-584.041) -- 0:00:57
Average standard deviation of split frequencies: 0.029219
65500 -- (-587.536) [-583.185] (-588.299) (-587.499) * [-582.786] (-586.704) (-584.006) (-583.130) -- 0:00:57
66000 -- (-584.185) (-584.433) (-586.055) [-585.245] * [-584.710] (-583.513) (-583.654) (-584.796) -- 0:00:56
66500 -- (-584.369) [-585.047] (-584.610) (-584.177) * (-583.773) [-583.519] (-584.912) (-586.200) -- 0:00:56
67000 -- (-585.332) (-585.875) (-584.634) [-587.863] * [-585.093] (-586.107) (-586.207) (-590.279) -- 0:00:55
67500 -- (-583.920) [-585.311] (-586.930) (-587.580) * [-587.185] (-587.707) (-583.777) (-584.716) -- 0:00:55
68000 -- (-584.957) (-585.156) (-586.903) [-584.701] * [-587.467] (-586.271) (-584.778) (-587.523) -- 0:00:54
68500 -- (-587.431) [-583.960] (-585.272) (-585.785) * (-583.718) (-587.094) (-584.113) [-583.833] -- 0:00:54
69000 -- (-588.014) (-583.815) (-584.235) [-583.813] * [-583.918] (-587.280) (-585.585) (-585.862) -- 0:00:53
69500 -- (-585.586) [-586.520] (-584.649) (-584.029) * (-584.344) [-584.840] (-584.487) (-585.260) -- 0:00:53
70000 -- (-588.774) [-583.828] (-589.516) (-585.464) * [-583.557] (-583.196) (-585.183) (-589.320) -- 0:00:53
Average standard deviation of split frequencies: 0.030352
70500 -- (-590.330) (-585.019) (-586.312) [-583.643] * (-584.594) [-586.124] (-584.648) (-585.815) -- 0:00:52
71000 -- (-584.910) (-585.177) [-583.021] (-588.762) * (-583.796) [-584.941] (-585.861) (-586.214) -- 0:00:52
71500 -- [-586.374] (-587.583) (-583.639) (-594.784) * (-583.849) (-585.172) (-585.639) [-585.421] -- 0:00:51
72000 -- (-585.197) (-589.172) [-584.925] (-583.942) * (-589.852) (-583.788) (-585.484) [-584.028] -- 0:00:51
72500 -- [-583.250] (-589.488) (-583.917) (-584.043) * (-584.305) (-583.350) (-584.729) [-584.116] -- 0:00:51
73000 -- (-587.057) (-585.733) (-584.874) [-583.508] * (-584.962) [-583.368] (-583.597) (-585.834) -- 0:00:50
73500 -- (-586.593) (-584.284) [-585.220] (-585.101) * [-584.743] (-584.963) (-584.370) (-583.189) -- 0:00:50
74000 -- (-583.046) [-586.785] (-584.406) (-584.710) * (-584.389) (-583.914) [-583.944] (-583.458) -- 0:00:50
74500 -- (-582.829) (-586.424) (-588.130) [-584.953] * [-585.007] (-584.968) (-584.190) (-585.805) -- 0:00:49
75000 -- (-584.483) (-587.830) [-584.177] (-584.928) * [-587.474] (-588.662) (-586.974) (-587.795) -- 0:00:49
Average standard deviation of split frequencies: 0.028946
75500 -- (-587.926) (-585.832) [-584.236] (-584.883) * (-584.087) (-586.419) [-586.793] (-586.459) -- 0:00:48
76000 -- (-583.553) [-587.825] (-585.714) (-587.479) * (-583.035) (-585.490) [-584.388] (-586.785) -- 0:00:48
76500 -- (-587.159) (-583.785) [-583.911] (-584.172) * [-587.296] (-584.160) (-586.253) (-587.999) -- 0:00:48
77000 -- (-587.243) [-584.563] (-587.806) (-586.961) * (-585.150) (-587.268) [-585.582] (-587.940) -- 0:00:47
77500 -- (-583.167) (-589.315) [-584.327] (-583.762) * (-584.209) [-586.779] (-585.038) (-585.764) -- 0:00:47
78000 -- (-582.865) (-585.985) (-584.148) [-585.393] * (-584.116) (-585.005) (-584.315) [-588.720] -- 0:00:47
78500 -- (-587.541) (-586.506) [-583.707] (-587.034) * [-584.345] (-585.320) (-584.395) (-585.452) -- 0:00:46
79000 -- (-585.129) (-583.682) [-583.896] (-584.620) * (-586.447) [-584.693] (-590.213) (-586.808) -- 0:00:46
79500 -- (-587.027) [-586.164] (-586.977) (-583.171) * [-584.645] (-586.120) (-588.294) (-584.069) -- 0:00:57
80000 -- (-591.752) (-586.499) (-586.084) [-584.315] * (-583.551) (-583.454) (-588.353) [-583.693] -- 0:00:57
Average standard deviation of split frequencies: 0.026829
80500 -- (-587.423) [-585.901] (-584.731) (-587.616) * (-586.341) [-586.948] (-583.517) (-584.230) -- 0:00:57
81000 -- [-585.272] (-584.908) (-583.831) (-584.656) * (-583.978) (-585.737) (-583.370) [-584.106] -- 0:00:56
81500 -- (-589.703) (-590.357) [-583.437] (-590.805) * [-583.865] (-583.468) (-585.536) (-583.759) -- 0:00:56
82000 -- (-588.522) [-585.746] (-584.147) (-586.948) * (-585.052) [-583.228] (-590.030) (-585.445) -- 0:00:55
82500 -- (-584.772) (-585.733) (-584.209) [-585.047] * (-585.790) [-586.184] (-586.752) (-585.948) -- 0:00:55
83000 -- (-583.826) [-583.516] (-588.954) (-585.047) * [-585.853] (-587.052) (-585.219) (-583.595) -- 0:00:55
83500 -- [-584.901] (-584.063) (-585.085) (-583.594) * (-588.111) (-585.869) (-585.860) [-585.039] -- 0:00:54
84000 -- (-585.163) [-583.937] (-591.448) (-583.636) * (-586.608) (-582.692) (-585.903) [-585.389] -- 0:00:54
84500 -- (-585.925) (-584.664) (-586.855) [-583.744] * (-588.751) (-587.054) [-584.942] (-585.460) -- 0:00:54
85000 -- (-583.420) [-587.241] (-584.445) (-586.285) * (-590.105) (-583.673) (-584.084) [-585.161] -- 0:00:53
Average standard deviation of split frequencies: 0.025663
85500 -- (-586.948) [-586.940] (-583.353) (-584.949) * [-584.682] (-585.309) (-585.380) (-585.378) -- 0:00:53
86000 -- (-586.411) (-584.443) [-583.877] (-586.294) * [-588.382] (-584.220) (-586.870) (-583.712) -- 0:00:53
86500 -- [-585.995] (-585.267) (-588.346) (-588.561) * (-588.473) (-585.455) (-586.495) [-584.534] -- 0:00:52
87000 -- [-586.591] (-586.662) (-587.909) (-586.283) * (-587.710) (-587.724) (-585.829) [-584.277] -- 0:00:52
87500 -- [-584.628] (-585.202) (-587.916) (-584.589) * (-588.791) (-592.604) [-584.904] (-588.082) -- 0:00:52
88000 -- (-584.780) [-583.623] (-585.706) (-586.405) * [-584.544] (-583.183) (-588.173) (-586.045) -- 0:00:51
88500 -- (-584.934) (-585.870) (-586.700) [-584.411] * [-588.062] (-585.265) (-586.362) (-587.834) -- 0:00:51
89000 -- (-584.561) (-585.511) [-586.760] (-586.526) * [-587.100] (-586.503) (-588.603) (-589.855) -- 0:00:51
89500 -- [-584.658] (-585.708) (-589.832) (-583.341) * (-586.546) [-584.601] (-584.241) (-585.349) -- 0:00:50
90000 -- (-586.179) [-583.210] (-585.409) (-584.238) * [-586.697] (-585.901) (-586.799) (-586.697) -- 0:00:50
Average standard deviation of split frequencies: 0.023917
90500 -- (-588.804) (-583.287) [-585.371] (-585.762) * (-585.039) [-586.681] (-586.398) (-588.292) -- 0:00:50
91000 -- (-587.342) (-583.832) [-584.474] (-584.032) * (-590.289) [-586.007] (-584.980) (-587.024) -- 0:00:49
91500 -- (-585.469) (-585.222) [-582.856] (-584.785) * (-585.854) (-584.876) (-585.840) [-583.035] -- 0:00:49
92000 -- (-584.070) (-585.334) [-587.845] (-583.388) * (-584.997) [-585.458] (-587.285) (-583.380) -- 0:00:49
92500 -- (-586.671) (-589.100) [-591.550] (-584.701) * [-583.797] (-584.421) (-585.802) (-584.498) -- 0:00:49
93000 -- (-585.076) (-585.066) (-585.150) [-587.779] * (-586.682) (-586.208) [-585.582] (-584.429) -- 0:00:48
93500 -- (-588.078) (-584.419) [-588.488] (-587.711) * [-583.045] (-583.049) (-586.853) (-583.185) -- 0:00:48
94000 -- [-583.190] (-587.148) (-585.206) (-585.725) * (-585.162) [-587.697] (-586.935) (-585.745) -- 0:00:48
94500 -- (-585.303) (-584.889) [-584.899] (-585.115) * (-584.233) (-587.428) [-584.164] (-585.281) -- 0:00:47
95000 -- [-585.702] (-585.247) (-586.464) (-586.824) * [-586.228] (-588.087) (-584.140) (-586.203) -- 0:00:47
Average standard deviation of split frequencies: 0.022320
95500 -- (-584.021) (-585.187) [-588.536] (-586.814) * [-591.192] (-588.356) (-583.780) (-589.589) -- 0:00:56
96000 -- (-583.837) (-585.613) [-583.084] (-587.843) * [-586.385] (-584.629) (-582.901) (-588.265) -- 0:00:56
96500 -- (-583.701) (-587.122) [-585.913] (-584.233) * (-585.383) [-584.921] (-584.418) (-585.219) -- 0:00:56
97000 -- (-583.298) (-588.092) (-583.113) [-584.158] * (-586.311) (-585.914) (-586.040) [-589.411] -- 0:00:55
97500 -- [-583.715] (-583.733) (-584.049) (-586.562) * (-584.129) [-584.146] (-584.399) (-589.945) -- 0:00:55
98000 -- [-583.760] (-585.697) (-584.595) (-584.713) * (-584.769) [-584.244] (-585.242) (-585.981) -- 0:00:55
98500 -- (-584.933) (-583.956) [-585.397] (-585.019) * (-585.849) (-590.397) [-588.960] (-585.920) -- 0:00:54
99000 -- [-583.703] (-583.450) (-584.189) (-584.447) * [-584.097] (-585.946) (-589.318) (-587.029) -- 0:00:54
99500 -- (-584.385) (-585.948) [-584.499] (-586.455) * (-584.276) [-583.591] (-584.090) (-587.783) -- 0:00:54
100000 -- (-587.352) (-589.222) (-583.916) [-587.363] * [-585.721] (-584.713) (-584.358) (-588.265) -- 0:00:54
Average standard deviation of split frequencies: 0.024053
100500 -- (-589.421) (-583.492) [-587.708] (-583.051) * (-586.038) [-584.400] (-585.266) (-585.207) -- 0:00:53
101000 -- [-586.403] (-583.266) (-588.654) (-584.720) * (-586.376) [-586.764] (-583.655) (-586.478) -- 0:00:53
101500 -- (-585.936) (-583.570) [-592.159] (-585.317) * [-583.852] (-586.039) (-583.165) (-586.433) -- 0:00:53
102000 -- (-584.003) [-584.103] (-583.896) (-585.419) * (-583.332) [-585.634] (-587.417) (-582.623) -- 0:00:52
102500 -- (-584.667) (-583.810) [-583.554] (-583.770) * (-585.331) (-585.823) [-584.619] (-584.071) -- 0:00:52
103000 -- (-586.091) (-586.177) (-587.048) [-584.376] * (-589.151) (-584.199) [-583.906] (-587.327) -- 0:00:52
103500 -- (-589.152) (-583.803) [-586.682] (-584.383) * (-584.464) (-586.684) [-582.845] (-583.369) -- 0:00:51
104000 -- [-584.675] (-586.292) (-583.157) (-583.840) * (-584.580) (-584.214) [-583.706] (-589.142) -- 0:00:51
104500 -- (-587.389) [-586.090] (-582.980) (-584.050) * [-584.690] (-585.812) (-584.042) (-585.662) -- 0:00:51
105000 -- (-588.509) (-586.227) [-587.788] (-587.485) * [-585.072] (-587.814) (-586.873) (-585.538) -- 0:00:51
Average standard deviation of split frequencies: 0.022236
105500 -- [-586.026] (-584.161) (-585.403) (-587.070) * (-583.061) (-587.607) [-584.050] (-585.865) -- 0:00:50
106000 -- (-585.970) (-585.402) [-584.458] (-586.159) * (-584.973) (-583.817) (-584.282) [-584.159] -- 0:00:50
106500 -- [-586.125] (-583.634) (-585.354) (-583.807) * (-586.800) (-583.128) [-586.665] (-584.016) -- 0:00:50
107000 -- [-584.916] (-583.389) (-585.776) (-584.287) * (-585.382) (-583.411) [-588.305] (-585.264) -- 0:00:50
107500 -- [-583.486] (-585.671) (-586.493) (-586.808) * (-585.665) (-584.233) [-586.379] (-583.993) -- 0:00:49
108000 -- (-583.653) (-583.611) [-583.376] (-589.946) * (-592.634) (-583.452) [-585.601] (-583.468) -- 0:00:49
108500 -- (-585.774) (-583.422) [-585.577] (-590.140) * (-588.754) (-585.612) (-585.333) [-583.884] -- 0:00:49
109000 -- (-583.714) (-585.745) (-585.628) [-585.033] * (-584.852) (-585.250) [-583.704] (-586.333) -- 0:00:49
109500 -- (-584.963) [-585.056] (-585.672) (-582.957) * [-584.466] (-585.618) (-584.516) (-585.511) -- 0:00:48
110000 -- (-590.307) (-586.247) [-585.317] (-583.589) * (-583.867) (-584.517) [-584.131] (-585.194) -- 0:00:48
Average standard deviation of split frequencies: 0.017242
110500 -- (-586.979) [-584.833] (-586.395) (-583.453) * [-584.834] (-591.953) (-586.029) (-584.281) -- 0:00:48
111000 -- [-589.592] (-586.527) (-589.205) (-586.146) * (-585.508) (-586.022) [-591.471] (-584.272) -- 0:00:48
111500 -- (-583.370) (-583.978) [-586.823] (-587.488) * (-584.724) (-588.302) [-585.108] (-583.962) -- 0:00:55
112000 -- (-583.553) [-585.937] (-583.930) (-588.632) * [-586.226] (-587.405) (-583.532) (-585.854) -- 0:00:55
112500 -- [-583.112] (-584.970) (-584.475) (-583.981) * (-585.793) (-585.587) [-585.939] (-584.090) -- 0:00:55
113000 -- [-586.725] (-585.671) (-585.478) (-587.707) * (-587.256) [-585.806] (-587.465) (-584.111) -- 0:00:54
113500 -- (-586.339) [-583.520] (-583.262) (-586.888) * [-585.096] (-589.354) (-584.312) (-584.206) -- 0:00:54
114000 -- (-585.863) (-584.433) [-586.174] (-585.922) * (-586.051) [-587.826] (-585.806) (-585.647) -- 0:00:54
114500 -- (-586.316) (-584.222) (-583.342) [-585.968] * (-585.693) (-583.840) (-587.888) [-586.909] -- 0:00:54
115000 -- (-584.899) (-586.513) [-584.794] (-582.888) * (-586.190) (-584.370) [-588.065] (-586.458) -- 0:00:53
Average standard deviation of split frequencies: 0.021026
115500 -- (-584.718) (-584.031) [-583.350] (-585.793) * (-589.493) [-584.739] (-584.798) (-586.623) -- 0:00:53
116000 -- (-585.990) (-585.316) (-588.259) [-584.416] * (-586.553) [-584.760] (-583.725) (-585.908) -- 0:00:53
116500 -- (-583.706) (-586.366) (-586.168) [-584.617] * (-584.599) (-585.007) (-588.298) [-584.302] -- 0:00:53
117000 -- (-587.519) (-585.391) (-584.764) [-583.926] * (-583.968) [-583.764] (-585.603) (-584.306) -- 0:00:52
117500 -- (-586.618) (-587.277) [-584.672] (-584.149) * [-583.129] (-584.438) (-586.768) (-584.858) -- 0:00:52
118000 -- (-585.273) (-585.558) [-585.193] (-584.641) * (-584.552) (-585.734) [-586.282] (-587.708) -- 0:00:52
118500 -- [-584.393] (-586.429) (-583.285) (-589.424) * (-584.466) (-585.529) (-589.937) [-584.330] -- 0:00:52
119000 -- (-584.355) [-584.660] (-582.994) (-586.759) * (-583.337) (-583.245) [-584.458] (-584.240) -- 0:00:51
119500 -- [-586.447] (-587.571) (-586.016) (-586.791) * (-587.766) (-589.721) (-586.137) [-586.837] -- 0:00:51
120000 -- [-583.370] (-585.009) (-584.941) (-584.058) * (-585.926) (-586.637) (-586.161) [-585.809] -- 0:00:51
Average standard deviation of split frequencies: 0.022907
120500 -- (-584.933) (-584.956) [-583.702] (-583.654) * (-587.030) (-586.529) [-587.186] (-584.063) -- 0:00:51
121000 -- (-586.185) [-584.528] (-584.230) (-584.488) * (-588.714) [-586.522] (-591.031) (-584.025) -- 0:00:50
121500 -- [-584.338] (-586.553) (-582.712) (-583.099) * (-587.641) (-584.095) [-588.607] (-583.560) -- 0:00:50
122000 -- [-582.938] (-584.789) (-583.458) (-586.202) * (-588.977) [-585.112] (-588.057) (-583.762) -- 0:00:50
122500 -- [-590.572] (-589.576) (-585.467) (-587.399) * (-585.231) [-585.553] (-584.351) (-583.770) -- 0:00:50
123000 -- (-584.665) (-585.276) [-584.598] (-585.182) * [-585.306] (-586.369) (-590.183) (-585.024) -- 0:00:49
123500 -- (-586.492) (-587.900) (-588.437) [-583.062] * [-583.947] (-584.106) (-586.012) (-583.917) -- 0:00:49
124000 -- (-594.545) (-584.018) (-586.581) [-583.688] * (-584.310) [-583.606] (-583.520) (-584.897) -- 0:00:49
124500 -- (-589.239) (-585.322) (-584.065) [-589.101] * (-587.758) (-582.939) (-586.664) [-586.305] -- 0:00:49
125000 -- [-583.498] (-584.455) (-583.959) (-587.800) * (-586.896) [-582.995] (-586.741) (-583.720) -- 0:00:49
Average standard deviation of split frequencies: 0.022285
125500 -- (-582.851) [-584.354] (-585.977) (-587.762) * [-584.371] (-586.288) (-582.964) (-587.855) -- 0:00:48
126000 -- (-589.533) (-587.348) [-584.281] (-588.043) * (-584.873) (-584.495) [-587.995] (-586.756) -- 0:00:48
126500 -- (-585.120) (-587.012) (-585.138) [-589.032] * (-585.086) [-585.552] (-589.293) (-584.257) -- 0:00:48
127000 -- (-584.327) [-588.553] (-585.191) (-584.539) * [-587.618] (-584.458) (-586.333) (-584.766) -- 0:00:48
127500 -- (-586.299) (-587.286) (-585.496) [-585.132] * [-583.881] (-583.183) (-584.227) (-586.409) -- 0:00:47
128000 -- [-584.255] (-585.661) (-587.080) (-586.203) * (-584.284) (-582.851) (-588.010) [-586.678] -- 0:00:54
128500 -- (-583.830) [-586.918] (-588.102) (-586.531) * (-586.178) (-586.225) (-587.166) [-585.534] -- 0:00:54
129000 -- [-586.865] (-588.621) (-585.305) (-585.634) * [-583.930] (-586.178) (-585.436) (-586.754) -- 0:00:54
129500 -- (-583.594) (-583.575) [-583.646] (-583.075) * [-583.469] (-584.081) (-585.778) (-583.756) -- 0:00:53
130000 -- [-587.029] (-585.099) (-583.270) (-587.164) * (-583.030) (-585.940) [-583.908] (-591.826) -- 0:00:53
Average standard deviation of split frequencies: 0.021646
130500 -- (-582.989) (-586.565) (-588.611) [-591.881] * [-584.028] (-589.038) (-586.413) (-590.784) -- 0:00:53
131000 -- (-583.186) (-583.912) (-588.193) [-583.287] * (-583.134) (-587.845) [-585.534] (-586.454) -- 0:00:53
131500 -- (-584.163) (-583.348) (-588.886) [-582.943] * (-584.345) [-585.441] (-584.045) (-584.006) -- 0:00:52
132000 -- (-584.190) (-586.449) [-584.825] (-584.031) * (-586.733) [-583.490] (-584.162) (-586.693) -- 0:00:52
132500 -- [-584.577] (-584.800) (-584.917) (-586.428) * (-585.068) (-586.780) (-587.863) [-586.979] -- 0:00:52
133000 -- (-584.514) [-584.169] (-583.712) (-584.881) * (-584.974) (-585.096) [-585.986] (-585.425) -- 0:00:52
133500 -- (-587.054) [-586.185] (-583.758) (-585.570) * (-585.727) (-588.598) [-583.620] (-587.831) -- 0:00:51
134000 -- (-584.650) [-589.828] (-583.800) (-587.429) * (-583.988) (-593.507) [-586.619] (-585.814) -- 0:00:51
134500 -- [-585.269] (-584.346) (-583.804) (-584.274) * [-588.233] (-584.692) (-584.533) (-586.231) -- 0:00:51
135000 -- [-588.590] (-585.085) (-583.509) (-586.544) * (-586.636) (-590.406) (-585.813) [-583.179] -- 0:00:51
Average standard deviation of split frequencies: 0.020009
135500 -- [-584.112] (-586.071) (-584.078) (-586.681) * [-584.418] (-583.601) (-588.227) (-592.761) -- 0:00:51
136000 -- (-584.182) [-585.394] (-583.642) (-583.581) * (-583.363) (-585.320) (-583.962) [-584.477] -- 0:00:50
136500 -- (-587.210) (-584.097) [-583.740] (-586.307) * [-584.203] (-586.422) (-584.715) (-583.941) -- 0:00:50
137000 -- (-587.702) [-584.316] (-584.671) (-589.453) * (-582.877) [-584.832] (-585.454) (-583.782) -- 0:00:50
137500 -- (-585.631) (-585.444) [-585.291] (-586.720) * (-584.012) (-584.002) [-587.494] (-589.707) -- 0:00:50
138000 -- [-584.293] (-583.220) (-589.294) (-585.272) * (-584.361) [-583.407] (-586.121) (-584.881) -- 0:00:49
138500 -- [-583.145] (-584.051) (-584.766) (-585.537) * (-583.605) (-584.625) (-587.503) [-584.067] -- 0:00:49
139000 -- (-586.021) (-584.267) (-586.143) [-586.057] * (-583.607) (-588.135) (-589.207) [-584.730] -- 0:00:49
139500 -- (-585.659) [-583.094] (-588.294) (-583.504) * [-585.109] (-587.600) (-589.695) (-584.554) -- 0:00:49
140000 -- [-585.406] (-583.854) (-585.165) (-584.511) * [-584.832] (-584.199) (-589.857) (-585.589) -- 0:00:49
Average standard deviation of split frequencies: 0.017594
140500 -- (-583.494) (-583.746) [-587.576] (-583.943) * [-585.764] (-584.928) (-586.148) (-583.311) -- 0:00:48
141000 -- (-583.134) (-584.997) (-584.949) [-583.392] * (-585.848) (-588.837) [-585.799] (-585.383) -- 0:00:48
141500 -- [-583.409] (-586.705) (-586.971) (-585.134) * (-584.829) (-583.537) [-583.957] (-585.840) -- 0:00:48
142000 -- (-586.327) (-585.253) [-583.327] (-584.603) * (-582.946) [-586.743] (-583.939) (-584.249) -- 0:00:48
142500 -- (-584.332) (-585.682) (-584.957) [-584.202] * (-585.971) (-583.914) [-585.906] (-585.717) -- 0:00:48
143000 -- [-585.163] (-588.024) (-583.459) (-583.336) * (-586.148) (-587.111) (-585.741) [-583.703] -- 0:00:47
143500 -- (-583.804) (-584.303) (-585.762) [-583.098] * (-584.008) (-587.917) [-586.445] (-584.309) -- 0:00:47
144000 -- (-586.235) (-583.833) (-587.108) [-586.024] * (-583.393) (-587.857) (-583.947) [-586.371] -- 0:00:47
144500 -- (-584.134) (-583.712) (-583.685) [-584.961] * [-583.563] (-584.637) (-584.175) (-588.237) -- 0:00:53
145000 -- (-584.342) (-584.002) [-586.182] (-584.349) * [-584.768] (-585.565) (-585.056) (-583.032) -- 0:00:53
Average standard deviation of split frequencies: 0.017612
145500 -- [-584.188] (-588.677) (-583.293) (-585.969) * (-583.733) [-583.533] (-586.346) (-584.432) -- 0:00:52
146000 -- (-583.937) (-585.717) (-588.354) [-585.951] * [-584.370] (-583.159) (-585.766) (-585.326) -- 0:00:52
146500 -- (-586.875) (-585.648) [-588.339] (-585.857) * (-584.198) (-584.277) [-584.261] (-583.706) -- 0:00:52
147000 -- (-587.991) (-587.935) (-586.768) [-590.376] * (-585.519) (-593.703) (-585.760) [-584.146] -- 0:00:52
147500 -- (-585.117) (-584.760) (-590.552) [-583.917] * (-583.318) [-586.104] (-583.436) (-582.713) -- 0:00:52
148000 -- (-583.291) (-584.023) (-583.946) [-584.138] * (-583.022) [-584.107] (-585.035) (-583.664) -- 0:00:51
148500 -- (-587.975) (-587.533) (-585.757) [-586.138] * (-589.719) [-585.361] (-585.390) (-589.286) -- 0:00:51
149000 -- [-588.158] (-584.596) (-585.064) (-589.179) * (-584.705) (-585.978) (-586.089) [-583.921] -- 0:00:51
149500 -- (-586.138) (-584.052) [-582.758] (-584.891) * (-584.049) (-584.472) [-588.175] (-586.898) -- 0:00:51
150000 -- (-585.563) [-584.188] (-582.858) (-583.313) * (-584.652) [-588.910] (-585.493) (-589.595) -- 0:00:51
Average standard deviation of split frequencies: 0.018773
150500 -- (-584.519) (-585.167) (-583.390) [-585.445] * [-584.134] (-587.384) (-585.506) (-587.042) -- 0:00:50
151000 -- (-583.212) [-585.341] (-583.005) (-585.501) * (-588.014) (-583.279) (-583.847) [-584.554] -- 0:00:50
151500 -- (-586.952) (-586.316) [-583.719] (-585.363) * (-589.078) (-584.119) [-583.393] (-583.697) -- 0:00:50
152000 -- (-586.733) (-583.334) [-584.277] (-585.503) * (-585.049) [-584.573] (-583.073) (-584.130) -- 0:00:50
152500 -- (-587.029) (-585.463) (-585.796) [-584.611] * (-587.804) (-586.916) (-589.066) [-585.533] -- 0:00:50
153000 -- (-583.156) (-585.115) [-585.954] (-591.547) * [-585.387] (-585.526) (-589.922) (-588.182) -- 0:00:49
153500 -- (-583.001) [-585.342] (-586.355) (-586.333) * (-587.911) (-584.110) [-584.603] (-586.559) -- 0:00:49
154000 -- (-583.972) [-585.282] (-584.691) (-584.433) * (-585.668) (-588.446) [-584.562] (-585.447) -- 0:00:49
154500 -- (-584.122) (-586.214) (-585.425) [-585.210] * [-584.528] (-585.072) (-584.670) (-583.136) -- 0:00:49
155000 -- (-589.435) (-586.845) (-586.295) [-583.926] * [-583.003] (-587.030) (-583.725) (-586.209) -- 0:00:49
Average standard deviation of split frequencies: 0.019721
155500 -- (-585.998) [-583.723] (-585.665) (-587.986) * (-583.831) (-592.401) [-588.724] (-585.277) -- 0:00:48
156000 -- [-585.253] (-583.459) (-585.025) (-584.431) * [-585.944] (-588.272) (-583.286) (-585.392) -- 0:00:48
156500 -- [-584.741] (-584.772) (-587.303) (-587.458) * (-587.483) [-584.163] (-584.938) (-583.593) -- 0:00:48
157000 -- (-583.903) (-585.686) (-584.496) [-590.101] * [-588.379] (-584.298) (-585.163) (-583.380) -- 0:00:48
157500 -- (-585.952) (-585.107) (-587.900) [-585.871] * (-585.071) (-586.301) [-583.548] (-585.279) -- 0:00:48
158000 -- (-583.048) (-583.081) [-585.264] (-584.635) * (-583.547) (-592.517) (-584.419) [-584.986] -- 0:00:47
158500 -- (-583.892) (-583.817) [-585.462] (-586.910) * (-583.681) (-588.659) (-586.043) [-584.891] -- 0:00:47
159000 -- [-583.496] (-583.812) (-582.951) (-589.283) * (-588.319) (-585.608) [-586.265] (-584.812) -- 0:00:47
159500 -- [-583.263] (-591.063) (-585.439) (-589.626) * (-586.676) [-587.549] (-584.130) (-583.969) -- 0:00:47
160000 -- (-583.884) (-587.195) [-583.846] (-584.333) * (-586.310) [-586.265] (-585.388) (-584.936) -- 0:00:47
Average standard deviation of split frequencies: 0.019612
160500 -- [-583.144] (-583.740) (-583.461) (-586.948) * (-584.223) [-585.443] (-585.927) (-583.920) -- 0:00:47
161000 -- (-582.802) (-585.176) [-583.675] (-585.093) * (-583.745) (-585.116) [-583.688] (-584.861) -- 0:00:52
161500 -- (-583.796) [-585.900] (-582.918) (-586.825) * (-589.030) [-585.084] (-582.683) (-586.679) -- 0:00:51
162000 -- (-584.362) (-586.680) (-587.763) [-587.807] * (-586.858) (-588.759) (-586.725) [-584.700] -- 0:00:51
162500 -- (-584.415) (-584.272) [-583.728] (-586.716) * (-584.637) (-587.823) [-584.050] (-583.614) -- 0:00:51
163000 -- [-583.187] (-584.944) (-586.757) (-588.473) * (-586.335) [-584.660] (-586.300) (-583.894) -- 0:00:51
163500 -- [-584.673] (-583.773) (-583.381) (-584.323) * (-585.805) (-583.488) (-583.674) [-584.348] -- 0:00:51
164000 -- (-586.041) [-586.883] (-585.725) (-584.384) * (-586.082) [-586.022] (-585.945) (-584.483) -- 0:00:50
164500 -- [-585.359] (-584.990) (-583.383) (-584.366) * (-585.400) (-584.522) [-587.527] (-583.327) -- 0:00:50
165000 -- (-585.808) (-583.129) (-584.736) [-583.312] * (-583.836) [-584.687] (-586.604) (-584.807) -- 0:00:50
Average standard deviation of split frequencies: 0.018982
165500 -- [-585.984] (-588.351) (-587.792) (-585.252) * [-585.724] (-585.387) (-584.576) (-584.503) -- 0:00:50
166000 -- (-583.246) (-585.472) (-585.892) [-587.578] * (-583.501) [-585.370] (-584.262) (-587.674) -- 0:00:50
166500 -- (-583.179) (-584.984) [-584.275] (-584.639) * [-583.229] (-584.065) (-583.620) (-584.417) -- 0:00:50
167000 -- [-584.144] (-590.552) (-583.420) (-584.684) * (-584.751) [-585.313] (-584.500) (-584.210) -- 0:00:49
167500 -- [-587.639] (-584.816) (-584.124) (-585.405) * (-584.324) [-591.354] (-584.792) (-585.435) -- 0:00:49
168000 -- (-586.568) (-587.717) (-584.408) [-585.063] * (-584.229) [-587.164] (-584.495) (-586.481) -- 0:00:49
168500 -- [-584.040] (-586.229) (-583.514) (-584.269) * (-583.570) (-586.826) [-584.602] (-585.949) -- 0:00:49
169000 -- (-589.141) [-584.863] (-584.418) (-584.416) * (-583.918) (-590.133) [-587.482] (-586.820) -- 0:00:49
169500 -- [-586.940] (-584.718) (-583.873) (-584.795) * [-584.549] (-586.218) (-587.909) (-585.689) -- 0:00:48
170000 -- (-584.484) (-583.561) (-585.568) [-586.633] * (-584.033) [-583.454] (-583.871) (-585.280) -- 0:00:48
Average standard deviation of split frequencies: 0.018092
170500 -- (-584.076) (-584.278) (-585.009) [-584.109] * (-584.719) (-584.305) (-586.929) [-584.777] -- 0:00:48
171000 -- [-585.112] (-584.773) (-582.838) (-587.909) * (-585.149) [-585.647] (-585.384) (-588.666) -- 0:00:48
171500 -- (-586.619) (-584.990) [-584.072] (-583.870) * [-584.788] (-584.355) (-587.337) (-586.103) -- 0:00:48
172000 -- (-587.361) (-586.846) (-585.671) [-586.174] * (-584.567) [-584.141] (-585.350) (-589.747) -- 0:00:48
172500 -- (-584.569) (-585.043) (-585.972) [-585.705] * (-584.515) (-583.701) [-588.103] (-589.664) -- 0:00:47
173000 -- (-584.133) [-585.508] (-584.380) (-583.201) * [-583.247] (-585.245) (-584.415) (-584.559) -- 0:00:47
173500 -- [-586.289] (-583.885) (-584.945) (-583.856) * (-583.723) [-584.720] (-587.147) (-583.990) -- 0:00:47
174000 -- (-586.351) (-584.076) (-594.533) [-585.844] * (-583.477) [-585.961] (-583.994) (-583.470) -- 0:00:47
174500 -- [-586.180] (-583.622) (-587.403) (-583.894) * (-585.274) [-583.880] (-583.574) (-583.512) -- 0:00:47
175000 -- (-585.876) (-589.524) [-583.734] (-584.902) * (-586.343) [-584.750] (-586.238) (-587.852) -- 0:00:47
Average standard deviation of split frequencies: 0.016071
175500 -- (-585.490) (-588.229) (-585.292) [-584.280] * [-584.532] (-587.241) (-585.404) (-587.349) -- 0:00:46
176000 -- (-587.576) (-586.749) (-590.636) [-583.141] * (-586.424) [-586.239] (-583.895) (-592.451) -- 0:00:46
176500 -- (-588.411) (-586.462) (-585.686) [-582.823] * [-585.373] (-584.009) (-589.728) (-585.654) -- 0:00:46
177000 -- (-583.486) [-584.884] (-583.783) (-584.620) * (-583.888) [-584.788] (-583.809) (-584.521) -- 0:00:51
177500 -- (-583.211) (-586.350) [-586.998] (-585.685) * (-584.603) (-583.504) (-584.573) [-584.126] -- 0:00:50
178000 -- [-585.351] (-583.886) (-586.152) (-583.903) * (-583.306) (-584.732) [-583.210] (-586.592) -- 0:00:50
178500 -- [-583.372] (-583.699) (-588.737) (-583.713) * (-586.307) [-586.531] (-588.205) (-591.344) -- 0:00:50
179000 -- [-584.240] (-585.323) (-591.748) (-584.516) * (-587.171) (-583.897) (-587.034) [-585.087] -- 0:00:50
179500 -- [-585.411] (-584.699) (-590.226) (-585.754) * [-584.478] (-585.665) (-586.868) (-586.136) -- 0:00:50
180000 -- (-584.709) (-585.360) (-586.247) [-587.150] * (-587.422) [-583.911] (-587.968) (-584.991) -- 0:00:50
Average standard deviation of split frequencies: 0.015945
180500 -- (-586.499) (-587.007) (-583.420) [-585.085] * (-585.576) (-583.591) [-588.154] (-584.658) -- 0:00:49
181000 -- (-585.308) (-585.407) (-583.751) [-585.612] * (-586.669) [-585.480] (-589.189) (-587.291) -- 0:00:49
181500 -- [-585.726] (-588.994) (-586.535) (-584.001) * (-588.408) (-584.849) (-587.985) [-584.593] -- 0:00:49
182000 -- (-585.545) (-584.994) (-585.434) [-584.390] * [-586.364] (-585.295) (-586.864) (-583.289) -- 0:00:49
182500 -- (-586.765) [-583.505] (-583.461) (-585.975) * (-584.867) (-586.360) [-583.748] (-584.477) -- 0:00:49
183000 -- (-584.292) [-583.874] (-584.583) (-584.548) * (-588.394) (-587.701) (-588.632) [-583.430] -- 0:00:49
183500 -- [-584.280] (-586.010) (-584.545) (-597.944) * [-584.078] (-587.817) (-586.171) (-587.697) -- 0:00:48
184000 -- (-583.642) (-585.322) [-585.172] (-585.266) * (-585.544) (-586.385) [-585.382] (-584.568) -- 0:00:48
184500 -- (-585.121) [-585.388] (-588.541) (-587.667) * (-588.667) (-584.096) (-587.641) [-584.618] -- 0:00:48
185000 -- (-584.548) [-587.128] (-586.672) (-584.775) * (-586.334) (-585.110) [-585.235] (-583.839) -- 0:00:48
Average standard deviation of split frequencies: 0.017234
185500 -- (-583.957) (-584.035) [-582.993] (-584.848) * (-586.187) (-584.517) [-586.245] (-588.742) -- 0:00:48
186000 -- (-583.813) [-583.794] (-582.988) (-587.844) * (-586.069) [-584.094] (-584.596) (-583.920) -- 0:00:48
186500 -- (-587.170) (-583.270) [-583.361] (-584.226) * (-585.250) [-586.150] (-584.808) (-587.922) -- 0:00:47
187000 -- (-583.814) (-585.730) (-584.953) [-584.289] * (-587.522) (-585.865) (-584.340) [-585.912] -- 0:00:47
187500 -- [-584.609] (-583.919) (-585.725) (-588.004) * (-585.431) (-584.677) (-584.130) [-585.408] -- 0:00:47
188000 -- [-583.902] (-586.619) (-585.773) (-588.266) * (-584.045) [-585.597] (-584.534) (-585.774) -- 0:00:47
188500 -- (-582.855) [-583.874] (-585.217) (-589.761) * [-583.761] (-585.760) (-587.969) (-587.546) -- 0:00:47
189000 -- [-584.002] (-585.292) (-585.052) (-591.884) * [-583.086] (-585.497) (-585.149) (-588.239) -- 0:00:47
189500 -- [-586.563] (-590.686) (-586.860) (-593.880) * (-584.575) [-583.230] (-584.358) (-591.916) -- 0:00:47
190000 -- [-585.862] (-592.935) (-585.159) (-587.986) * (-584.063) (-585.939) (-584.300) [-586.260] -- 0:00:46
Average standard deviation of split frequencies: 0.016266
190500 -- (-586.989) (-585.089) (-586.999) [-584.391] * (-583.243) (-585.361) [-584.585] (-586.923) -- 0:00:46
191000 -- (-586.995) (-587.751) (-585.244) [-584.558] * (-586.404) (-584.535) (-593.091) [-584.945] -- 0:00:46
191500 -- (-587.318) [-584.155] (-584.196) (-586.592) * (-587.220) (-583.674) (-591.415) [-585.245] -- 0:00:46
192000 -- (-585.136) (-588.971) (-584.489) [-582.994] * (-585.930) [-583.492] (-587.394) (-586.323) -- 0:00:46
192500 -- [-583.350] (-587.644) (-586.630) (-583.554) * (-582.896) (-583.698) [-586.234] (-586.102) -- 0:00:46
193000 -- (-584.004) (-584.785) (-587.614) [-582.988] * (-585.121) (-586.554) [-588.027] (-586.723) -- 0:00:45
193500 -- (-583.558) [-584.828] (-592.179) (-585.537) * (-584.302) (-584.893) (-584.185) [-589.436] -- 0:00:50
194000 -- (-583.906) [-585.674] (-586.431) (-589.562) * (-584.760) (-584.517) [-586.171] (-584.430) -- 0:00:49
194500 -- [-584.290] (-585.522) (-585.952) (-587.243) * [-585.712] (-588.395) (-585.701) (-583.137) -- 0:00:49
195000 -- [-583.861] (-585.218) (-586.395) (-590.611) * (-586.190) (-587.134) (-584.536) [-584.397] -- 0:00:49
Average standard deviation of split frequencies: 0.016969
195500 -- (-584.511) (-583.607) [-585.736] (-584.807) * (-584.591) [-584.234] (-585.098) (-583.080) -- 0:00:49
196000 -- (-583.642) [-584.116] (-586.305) (-587.778) * [-587.171] (-583.397) (-585.562) (-583.666) -- 0:00:49
196500 -- (-586.048) (-583.554) (-583.310) [-587.055] * (-584.699) (-587.697) [-583.055] (-588.600) -- 0:00:49
197000 -- [-584.068] (-586.123) (-584.776) (-584.133) * (-585.644) [-585.272] (-583.061) (-585.727) -- 0:00:48
197500 -- (-585.600) (-583.270) (-584.564) [-588.148] * (-583.615) (-583.346) (-583.960) [-583.986] -- 0:00:48
198000 -- (-583.104) (-583.459) [-587.985] (-588.484) * (-585.018) (-584.201) (-587.669) [-583.503] -- 0:00:48
198500 -- (-582.894) (-586.491) [-584.122] (-586.236) * (-585.058) (-584.458) [-583.412] (-585.107) -- 0:00:48
199000 -- [-584.108] (-589.541) (-583.669) (-586.432) * [-583.141] (-585.975) (-585.202) (-584.457) -- 0:00:48
199500 -- [-584.669] (-588.435) (-586.863) (-589.800) * [-583.101] (-589.536) (-583.640) (-585.260) -- 0:00:48
200000 -- (-587.615) (-589.374) (-584.654) [-585.482] * [-583.896] (-586.835) (-584.719) (-585.339) -- 0:00:48
Average standard deviation of split frequencies: 0.015615
200500 -- (-586.969) [-585.999] (-588.894) (-586.476) * (-584.064) (-586.599) [-584.228] (-584.816) -- 0:00:47
201000 -- (-586.799) [-583.367] (-588.352) (-590.282) * (-589.047) [-585.253] (-587.744) (-584.680) -- 0:00:47
201500 -- (-585.430) [-583.519] (-584.727) (-585.942) * [-586.683] (-584.186) (-585.523) (-593.520) -- 0:00:47
202000 -- (-584.757) [-587.045] (-586.093) (-588.069) * (-588.410) [-583.707] (-583.844) (-588.417) -- 0:00:47
202500 -- (-584.724) (-589.725) (-585.683) [-584.834] * (-596.103) (-583.815) (-585.268) [-585.314] -- 0:00:47
203000 -- (-588.728) [-583.693] (-586.976) (-587.445) * (-585.581) (-586.297) (-584.280) [-585.232] -- 0:00:47
203500 -- [-584.958] (-584.132) (-583.939) (-590.758) * (-584.582) (-587.572) [-584.007] (-595.594) -- 0:00:46
204000 -- [-582.821] (-584.039) (-583.743) (-585.185) * (-584.274) (-588.171) [-583.277] (-585.661) -- 0:00:46
204500 -- (-582.739) (-586.735) [-586.214] (-584.279) * [-583.554] (-590.606) (-584.261) (-585.116) -- 0:00:46
205000 -- (-586.185) (-583.688) [-582.735] (-585.613) * (-585.203) (-589.475) (-586.865) [-587.238] -- 0:00:46
Average standard deviation of split frequencies: 0.014366
205500 -- (-586.864) (-589.038) (-584.884) [-583.430] * [-585.679] (-587.623) (-587.268) (-588.364) -- 0:00:46
206000 -- (-587.862) [-583.001] (-589.957) (-585.474) * (-584.350) (-585.142) [-587.125] (-586.022) -- 0:00:46
206500 -- [-586.609] (-584.223) (-586.088) (-587.042) * (-585.256) (-584.669) [-584.327] (-590.642) -- 0:00:46
207000 -- (-584.718) (-585.600) [-588.063] (-586.813) * (-586.966) (-586.116) (-583.983) [-583.091] -- 0:00:45
207500 -- (-584.506) (-584.826) (-584.608) [-586.246] * (-587.040) (-588.025) [-583.957] (-584.128) -- 0:00:45
208000 -- (-584.822) (-585.257) [-584.143] (-588.411) * [-586.011] (-584.330) (-584.035) (-583.991) -- 0:00:45
208500 -- (-585.023) [-585.185] (-587.438) (-585.841) * (-584.074) (-584.655) (-586.468) [-586.362] -- 0:00:45
209000 -- [-582.857] (-586.828) (-586.344) (-587.336) * (-584.689) [-583.961] (-588.831) (-584.157) -- 0:00:45
209500 -- [-583.001] (-586.640) (-589.500) (-588.310) * (-585.143) (-586.212) (-585.534) [-584.817] -- 0:00:45
210000 -- (-585.194) (-588.010) [-584.780] (-586.955) * (-594.149) (-587.421) (-585.915) [-584.386] -- 0:00:48
Average standard deviation of split frequencies: 0.013294
210500 -- (-583.300) (-587.539) (-590.910) [-584.337] * [-585.832] (-587.895) (-584.368) (-589.743) -- 0:00:48
211000 -- (-584.810) (-586.579) (-586.525) [-585.624] * (-587.572) (-586.840) [-583.597] (-587.744) -- 0:00:48
211500 -- (-587.872) (-583.894) (-585.364) [-585.471] * [-586.572] (-589.480) (-586.281) (-586.741) -- 0:00:48
212000 -- (-584.088) [-585.335] (-583.513) (-584.253) * [-583.805] (-586.378) (-587.437) (-589.295) -- 0:00:48
212500 -- (-586.107) [-584.612] (-583.856) (-584.667) * (-583.905) (-584.543) (-587.608) [-585.221] -- 0:00:48
213000 -- (-588.229) [-585.936] (-585.687) (-584.623) * (-591.091) [-583.825] (-586.637) (-582.882) -- 0:00:48
213500 -- (-591.224) (-585.886) [-584.594] (-586.287) * (-584.025) (-584.058) (-584.507) [-583.751] -- 0:00:47
214000 -- [-588.356] (-587.656) (-591.889) (-584.293) * [-583.303] (-583.434) (-584.984) (-585.507) -- 0:00:47
214500 -- [-585.687] (-584.336) (-587.028) (-584.528) * (-584.214) (-584.995) [-584.170] (-585.388) -- 0:00:47
215000 -- (-584.820) (-583.501) [-583.215] (-584.910) * [-585.614] (-583.737) (-586.537) (-591.523) -- 0:00:47
Average standard deviation of split frequencies: 0.011731
215500 -- (-588.689) (-586.183) [-585.354] (-588.991) * [-585.582] (-586.086) (-586.740) (-589.528) -- 0:00:47
216000 -- (-585.321) [-585.225] (-586.360) (-586.598) * [-584.960] (-583.887) (-588.888) (-586.574) -- 0:00:47
216500 -- [-588.186] (-586.423) (-584.482) (-585.518) * (-584.316) [-584.862] (-586.250) (-585.497) -- 0:00:47
217000 -- [-584.030] (-585.305) (-586.888) (-585.850) * (-587.171) (-585.819) (-585.013) [-587.217] -- 0:00:46
217500 -- (-585.441) [-587.285] (-588.167) (-586.753) * [-586.701] (-587.094) (-585.086) (-587.523) -- 0:00:46
218000 -- [-587.490] (-586.484) (-586.278) (-585.808) * [-588.995] (-584.223) (-584.058) (-584.775) -- 0:00:46
218500 -- (-586.346) [-585.018] (-585.176) (-586.729) * (-584.645) [-584.247] (-583.968) (-590.246) -- 0:00:46
219000 -- (-585.569) (-584.891) (-584.480) [-585.573] * (-584.598) (-584.212) [-586.256] (-588.236) -- 0:00:46
219500 -- (-587.663) [-586.353] (-585.557) (-584.787) * [-585.035] (-586.609) (-587.916) (-588.359) -- 0:00:46
220000 -- (-587.924) (-587.113) (-584.091) [-586.339] * [-585.442] (-587.427) (-583.415) (-586.691) -- 0:00:46
Average standard deviation of split frequencies: 0.012284
220500 -- (-584.223) [-587.006] (-584.209) (-583.093) * [-587.937] (-583.635) (-582.951) (-583.809) -- 0:00:45
221000 -- (-584.134) [-586.432] (-583.257) (-583.822) * [-589.041] (-585.394) (-583.931) (-582.835) -- 0:00:45
221500 -- (-586.348) [-585.686] (-583.247) (-586.448) * [-587.050] (-588.813) (-583.736) (-585.942) -- 0:00:45
222000 -- (-585.602) (-587.957) (-585.417) [-585.975] * (-587.219) (-584.615) (-582.967) [-584.452] -- 0:00:45
222500 -- (-583.879) (-584.396) (-583.438) [-588.123] * (-589.744) [-584.166] (-586.872) (-585.124) -- 0:00:45
223000 -- [-583.699] (-586.264) (-589.242) (-584.445) * (-590.593) [-583.775] (-583.079) (-586.828) -- 0:00:45
223500 -- [-583.596] (-585.112) (-586.729) (-584.254) * (-583.763) (-583.842) [-586.111] (-586.302) -- 0:00:45
224000 -- (-583.328) [-583.312] (-587.156) (-584.081) * (-586.509) [-587.284] (-584.714) (-586.005) -- 0:00:45
224500 -- [-585.545] (-585.491) (-585.103) (-585.513) * [-584.878] (-587.722) (-585.724) (-584.681) -- 0:00:44
225000 -- (-584.861) (-585.034) [-585.494] (-583.267) * (-584.998) (-584.635) (-589.876) [-583.990] -- 0:00:44
Average standard deviation of split frequencies: 0.013674
225500 -- (-585.227) [-584.888] (-583.881) (-585.193) * (-590.818) (-583.988) [-586.798] (-586.524) -- 0:00:44
226000 -- (-586.132) (-583.222) (-585.063) [-584.246] * [-584.380] (-584.842) (-591.249) (-586.294) -- 0:00:44
226500 -- (-584.255) (-584.492) [-587.905] (-583.708) * (-584.322) [-585.547] (-587.214) (-584.436) -- 0:00:47
227000 -- (-586.649) [-584.360] (-584.822) (-584.948) * (-583.290) (-588.411) [-584.049] (-586.243) -- 0:00:47
227500 -- (-590.319) (-585.828) [-585.485] (-585.451) * (-585.532) (-583.333) (-584.018) [-585.515] -- 0:00:47
228000 -- [-584.052] (-584.959) (-585.684) (-585.999) * (-585.728) (-583.505) (-585.987) [-583.579] -- 0:00:47
228500 -- (-587.804) [-584.901] (-584.962) (-584.209) * (-587.862) (-583.901) (-587.509) [-584.484] -- 0:00:47
229000 -- (-583.495) (-586.597) [-584.125] (-584.593) * (-587.744) (-588.683) (-584.942) [-583.836] -- 0:00:47
229500 -- (-582.862) (-586.034) (-584.500) [-584.343] * (-587.066) (-583.612) (-585.169) [-587.010] -- 0:00:47
230000 -- (-583.415) (-583.930) [-583.580] (-589.548) * (-590.697) (-584.731) (-587.818) [-584.351] -- 0:00:46
Average standard deviation of split frequencies: 0.013284
230500 -- (-586.889) (-585.167) [-584.043] (-587.567) * (-583.527) [-585.859] (-585.267) (-585.992) -- 0:00:46
231000 -- [-586.299] (-584.392) (-586.991) (-587.631) * (-588.774) [-585.610] (-584.905) (-584.622) -- 0:00:46
231500 -- (-584.776) (-584.546) (-585.199) [-586.255] * (-585.772) (-589.479) (-585.592) [-584.449] -- 0:00:46
232000 -- (-585.438) [-583.972] (-586.297) (-583.799) * (-585.143) [-587.329] (-587.969) (-586.375) -- 0:00:46
232500 -- (-588.451) (-583.808) (-583.835) [-584.194] * (-585.259) (-585.235) (-588.267) [-585.698] -- 0:00:46
233000 -- [-584.221] (-588.888) (-588.160) (-587.149) * (-585.353) (-584.353) (-586.038) [-583.692] -- 0:00:46
233500 -- (-584.873) (-593.232) (-585.952) [-584.689] * (-585.448) (-583.689) (-584.936) [-588.890] -- 0:00:45
234000 -- (-585.861) [-591.958] (-585.019) (-584.212) * (-583.448) (-583.380) (-584.740) [-588.030] -- 0:00:45
234500 -- (-587.407) (-585.168) (-585.311) [-584.576] * (-583.672) (-583.138) [-584.869] (-587.395) -- 0:00:45
235000 -- (-585.226) (-585.071) [-588.499] (-587.132) * (-586.227) [-582.801] (-585.417) (-587.307) -- 0:00:45
Average standard deviation of split frequencies: 0.013630
235500 -- [-584.768] (-586.329) (-584.214) (-588.520) * (-585.310) [-585.519] (-584.772) (-587.442) -- 0:00:45
236000 -- [-584.025] (-584.997) (-587.213) (-588.107) * [-585.277] (-585.764) (-585.638) (-584.030) -- 0:00:45
236500 -- (-585.459) [-585.272] (-584.056) (-585.737) * (-586.443) (-585.042) (-582.872) [-587.781] -- 0:00:45
237000 -- (-584.758) (-584.522) [-584.373] (-585.697) * [-584.909] (-585.031) (-583.443) (-585.244) -- 0:00:45
237500 -- (-584.326) (-584.165) [-582.957] (-585.434) * (-584.207) (-584.828) [-583.217] (-583.602) -- 0:00:44
238000 -- (-583.083) (-585.683) [-585.196] (-584.810) * [-584.929] (-584.155) (-588.581) (-583.404) -- 0:00:44
238500 -- [-584.106] (-584.354) (-590.003) (-585.246) * (-586.293) [-583.847] (-584.201) (-585.061) -- 0:00:44
239000 -- (-587.328) (-584.267) [-586.038] (-585.897) * (-584.724) [-586.404] (-583.757) (-584.083) -- 0:00:44
239500 -- [-587.519] (-589.223) (-583.477) (-584.570) * (-584.625) [-583.613] (-590.941) (-588.361) -- 0:00:44
240000 -- (-584.955) (-585.300) [-585.635] (-586.170) * (-584.948) [-584.364] (-592.400) (-588.144) -- 0:00:44
Average standard deviation of split frequencies: 0.014446
240500 -- (-585.093) (-585.418) [-585.236] (-586.659) * (-586.289) [-583.314] (-584.455) (-583.890) -- 0:00:44
241000 -- (-588.037) (-587.121) (-584.191) [-585.235] * (-586.606) [-584.547] (-586.209) (-583.055) -- 0:00:44
241500 -- (-586.160) (-588.212) [-583.332] (-585.222) * [-585.108] (-585.635) (-587.244) (-585.636) -- 0:00:43
242000 -- [-583.516] (-583.985) (-583.805) (-585.853) * (-585.572) [-585.654] (-588.161) (-584.753) -- 0:00:43
242500 -- (-584.477) (-585.017) [-583.380] (-585.852) * (-583.495) (-585.129) (-583.873) [-584.836] -- 0:00:46
243000 -- (-583.469) (-586.902) [-584.222] (-585.833) * (-584.270) (-588.066) (-583.728) [-584.099] -- 0:00:46
243500 -- [-586.977] (-586.508) (-585.705) (-586.544) * (-584.574) (-588.046) (-586.817) [-585.076] -- 0:00:46
244000 -- (-585.811) (-584.487) (-584.849) [-587.826] * (-589.799) (-585.231) (-586.543) [-583.742] -- 0:00:46
244500 -- (-586.675) (-583.957) (-590.326) [-583.155] * (-584.317) (-586.603) [-586.670] (-585.065) -- 0:00:46
245000 -- (-585.249) [-584.020] (-586.460) (-583.536) * (-584.994) (-585.501) (-585.785) [-583.600] -- 0:00:46
Average standard deviation of split frequencies: 0.013189
245500 -- (-586.890) (-585.379) [-585.026] (-586.794) * (-585.273) [-588.112] (-586.745) (-587.036) -- 0:00:46
246000 -- (-586.452) [-586.536] (-585.627) (-589.369) * [-583.599] (-590.065) (-587.868) (-585.712) -- 0:00:45
246500 -- (-587.016) [-585.674] (-585.661) (-584.871) * (-584.588) (-583.866) (-585.695) [-583.279] -- 0:00:45
247000 -- [-585.594] (-583.466) (-588.085) (-583.249) * [-586.223] (-584.958) (-584.662) (-585.387) -- 0:00:45
247500 -- (-582.670) (-587.435) [-584.488] (-584.930) * (-584.606) (-585.578) (-584.199) [-584.915] -- 0:00:45
248000 -- (-583.677) (-588.978) (-584.142) [-583.388] * (-586.735) [-584.947] (-585.016) (-585.120) -- 0:00:45
248500 -- (-588.341) [-583.725] (-585.379) (-583.771) * (-586.775) [-584.345] (-582.807) (-588.359) -- 0:00:45
249000 -- [-583.386] (-585.960) (-584.428) (-585.979) * (-585.441) (-585.648) [-585.029] (-585.084) -- 0:00:45
249500 -- (-583.925) (-589.116) (-587.381) [-587.301] * (-588.679) (-587.330) [-585.085] (-586.755) -- 0:00:45
250000 -- [-586.795] (-587.540) (-583.686) (-586.806) * (-585.547) (-588.759) (-586.883) [-584.454] -- 0:00:45
Average standard deviation of split frequencies: 0.013282
250500 -- (-585.565) [-584.031] (-587.969) (-586.283) * (-585.804) (-586.958) (-585.311) [-584.111] -- 0:00:44
251000 -- (-585.263) (-583.002) [-584.778] (-588.865) * (-586.758) (-583.814) [-584.816] (-585.453) -- 0:00:44
251500 -- (-584.889) (-584.468) (-583.437) [-584.925] * (-588.963) (-585.167) (-585.569) [-583.518] -- 0:00:44
252000 -- [-583.477] (-585.910) (-583.532) (-589.805) * (-591.824) [-584.733] (-585.412) (-591.570) -- 0:00:44
252500 -- (-588.250) [-585.356] (-585.301) (-589.303) * (-590.489) (-586.513) [-585.456] (-584.595) -- 0:00:44
253000 -- (-590.513) [-588.184] (-583.903) (-585.168) * (-583.494) (-583.624) [-585.056] (-583.364) -- 0:00:44
253500 -- (-588.103) [-585.015] (-585.976) (-583.327) * [-584.826] (-586.425) (-583.481) (-583.617) -- 0:00:44
254000 -- (-585.486) [-583.594] (-586.700) (-583.497) * (-587.553) [-585.798] (-584.114) (-585.242) -- 0:00:44
254500 -- [-585.807] (-584.145) (-584.821) (-585.197) * (-583.772) (-587.822) [-583.082] (-585.459) -- 0:00:43
255000 -- [-584.659] (-583.813) (-583.745) (-584.965) * [-583.835] (-584.409) (-587.712) (-586.698) -- 0:00:43
Average standard deviation of split frequencies: 0.012315
255500 -- (-585.424) (-583.830) [-584.617] (-584.410) * (-583.052) (-585.792) [-586.680] (-584.569) -- 0:00:43
256000 -- [-588.764] (-585.052) (-588.445) (-583.847) * (-583.507) (-584.655) [-586.739] (-583.535) -- 0:00:43
256500 -- (-584.820) (-589.226) (-588.037) [-586.232] * (-587.211) (-585.762) [-583.523] (-586.076) -- 0:00:43
257000 -- (-584.519) [-588.894] (-585.898) (-586.285) * [-584.940] (-584.713) (-584.576) (-587.878) -- 0:00:43
257500 -- (-583.114) (-583.932) [-585.547] (-587.387) * (-584.859) (-584.506) [-587.705] (-584.471) -- 0:00:43
258000 -- (-583.402) (-584.845) (-585.722) [-584.661] * (-586.613) (-585.373) [-582.963] (-584.282) -- 0:00:43
258500 -- (-584.844) (-584.308) [-586.142] (-586.284) * (-588.986) (-585.919) (-585.093) [-585.736] -- 0:00:43
259000 -- [-586.000] (-583.539) (-585.951) (-584.424) * (-587.525) (-587.715) (-584.440) [-585.958] -- 0:00:42
259500 -- (-584.115) (-585.101) (-586.682) [-586.594] * (-588.066) [-587.536] (-587.028) (-586.751) -- 0:00:45
260000 -- [-585.765] (-584.870) (-588.140) (-587.378) * (-594.560) [-583.657] (-583.985) (-584.067) -- 0:00:45
Average standard deviation of split frequencies: 0.013903
260500 -- (-586.796) [-584.619] (-589.358) (-585.546) * (-587.456) [-583.327] (-584.125) (-584.652) -- 0:00:45
261000 -- (-585.349) [-585.156] (-588.338) (-585.067) * [-585.224] (-583.851) (-584.664) (-584.003) -- 0:00:45
261500 -- (-588.277) [-586.280] (-585.212) (-586.768) * (-584.590) (-584.326) (-588.037) [-583.952] -- 0:00:45
262000 -- (-584.389) (-583.862) (-587.042) [-583.696] * (-584.328) (-586.356) (-583.868) [-584.546] -- 0:00:45
262500 -- (-588.779) [-584.523] (-587.809) (-585.200) * (-585.668) (-585.822) (-585.736) [-586.592] -- 0:00:44
263000 -- [-586.613] (-583.042) (-587.280) (-589.343) * (-585.888) [-584.433] (-583.879) (-586.158) -- 0:00:44
263500 -- (-583.813) [-584.294] (-589.543) (-585.825) * (-583.430) [-586.622] (-585.566) (-583.756) -- 0:00:44
264000 -- (-584.025) (-586.954) [-590.401] (-583.020) * (-584.606) (-586.327) [-585.162] (-583.947) -- 0:00:44
264500 -- (-585.809) (-584.892) (-586.657) [-583.552] * (-586.486) (-584.057) (-586.680) [-583.676] -- 0:00:44
265000 -- (-585.115) (-583.827) (-586.003) [-584.820] * (-583.511) (-583.826) (-583.389) [-582.987] -- 0:00:44
Average standard deviation of split frequencies: 0.013865
265500 -- (-591.945) [-583.868] (-584.722) (-583.386) * (-585.955) (-584.006) (-585.584) [-583.780] -- 0:00:44
266000 -- (-589.803) (-582.808) [-584.178] (-585.617) * (-589.839) (-585.564) (-584.295) [-584.946] -- 0:00:44
266500 -- (-584.695) [-583.688] (-589.847) (-589.311) * (-589.032) (-584.083) (-583.161) [-583.838] -- 0:00:44
267000 -- [-583.943] (-583.730) (-585.764) (-587.225) * (-584.756) (-585.111) (-583.764) [-585.638] -- 0:00:43
267500 -- (-589.147) (-587.190) (-584.958) [-584.040] * (-584.304) [-585.637] (-587.597) (-583.591) -- 0:00:43
268000 -- (-585.082) (-583.730) (-586.144) [-585.938] * (-588.039) [-584.270] (-587.827) (-584.467) -- 0:00:43
268500 -- (-589.194) (-584.548) (-588.072) [-587.024] * (-583.876) (-586.767) [-586.021] (-583.420) -- 0:00:43
269000 -- (-586.601) (-586.036) (-584.057) [-584.401] * (-585.402) (-585.505) (-584.526) [-583.991] -- 0:00:43
269500 -- (-583.561) (-584.409) [-583.715] (-584.408) * (-587.336) (-584.138) [-585.635] (-585.274) -- 0:00:43
270000 -- (-588.999) [-585.032] (-587.446) (-585.013) * (-584.227) [-584.936] (-586.447) (-584.112) -- 0:00:43
Average standard deviation of split frequencies: 0.014958
270500 -- (-587.620) (-587.617) [-584.452] (-585.408) * (-583.586) (-583.021) (-585.295) [-585.941] -- 0:00:43
271000 -- [-584.408] (-584.421) (-584.278) (-583.201) * (-584.892) (-583.761) (-583.722) [-585.191] -- 0:00:43
271500 -- [-584.478] (-584.386) (-583.251) (-590.867) * (-587.787) (-584.572) [-583.783] (-584.068) -- 0:00:42
272000 -- (-584.836) (-586.910) (-583.826) [-586.516] * (-585.420) (-584.082) [-585.175] (-585.153) -- 0:00:42
272500 -- (-586.109) (-585.415) [-586.218] (-589.356) * [-589.239] (-585.733) (-584.371) (-586.345) -- 0:00:42
273000 -- (-584.713) (-584.468) (-586.186) [-587.964] * (-587.496) [-584.547] (-588.154) (-585.040) -- 0:00:42
273500 -- (-587.431) (-586.222) [-585.880] (-583.121) * (-585.198) (-584.963) [-583.193] (-586.562) -- 0:00:42
274000 -- [-585.226] (-583.457) (-584.647) (-585.083) * [-584.016] (-584.735) (-585.814) (-586.729) -- 0:00:42
274500 -- [-583.359] (-584.982) (-583.574) (-584.003) * (-591.164) [-583.623] (-585.575) (-586.346) -- 0:00:42
275000 -- (-582.866) [-584.763] (-585.515) (-582.869) * [-585.960] (-584.251) (-583.750) (-586.027) -- 0:00:42
Average standard deviation of split frequencies: 0.013557
275500 -- (-585.775) (-583.710) (-591.612) [-585.939] * (-583.377) (-588.799) [-583.660] (-589.871) -- 0:00:42
276000 -- (-587.474) [-583.437] (-586.776) (-590.586) * [-584.609] (-583.716) (-584.886) (-585.155) -- 0:00:44
276500 -- (-583.918) [-587.034] (-587.668) (-586.048) * (-587.700) [-585.765] (-586.423) (-586.594) -- 0:00:44
277000 -- [-585.975] (-584.733) (-585.945) (-584.090) * (-585.509) (-587.139) [-588.378] (-586.318) -- 0:00:44
277500 -- [-585.918] (-586.001) (-584.057) (-586.139) * [-584.046] (-585.196) (-588.922) (-588.676) -- 0:00:44
278000 -- (-594.996) [-584.775] (-587.070) (-583.710) * (-585.388) [-587.515] (-584.370) (-587.980) -- 0:00:44
278500 -- [-583.953] (-584.158) (-586.530) (-583.878) * (-588.539) (-586.664) [-589.012] (-585.071) -- 0:00:44
279000 -- (-587.170) (-584.724) [-583.106] (-583.823) * (-584.797) (-585.645) [-584.430] (-585.503) -- 0:00:43
279500 -- (-583.524) (-583.372) (-584.998) [-585.598] * (-585.352) (-583.637) (-586.501) [-586.791] -- 0:00:43
280000 -- (-585.094) (-586.962) [-585.340] (-586.077) * (-583.953) [-583.436] (-584.533) (-587.363) -- 0:00:43
Average standard deviation of split frequencies: 0.013962
280500 -- (-583.716) (-587.840) (-586.625) [-586.187] * (-586.238) (-584.791) [-583.890] (-587.702) -- 0:00:43
281000 -- (-583.216) [-585.048] (-584.630) (-586.791) * [-582.893] (-583.697) (-584.784) (-584.503) -- 0:00:43
281500 -- (-585.373) (-587.545) [-586.150] (-583.430) * (-583.121) (-585.938) (-584.460) [-583.160] -- 0:00:43
282000 -- [-585.552] (-586.230) (-586.178) (-583.223) * (-585.053) (-585.318) (-584.205) [-587.876] -- 0:00:43
282500 -- [-584.082] (-587.562) (-583.601) (-584.181) * [-584.206] (-584.760) (-583.436) (-587.993) -- 0:00:43
283000 -- [-585.908] (-584.009) (-583.047) (-585.631) * (-593.800) (-584.056) [-583.894] (-583.229) -- 0:00:43
283500 -- (-586.560) (-583.869) [-583.982] (-584.860) * [-584.329] (-584.596) (-583.469) (-587.988) -- 0:00:42
284000 -- [-584.718] (-586.363) (-584.835) (-585.996) * [-583.646] (-594.608) (-583.158) (-584.159) -- 0:00:42
284500 -- (-583.500) [-585.920] (-585.366) (-587.134) * (-584.529) (-589.686) (-588.717) [-586.550] -- 0:00:42
285000 -- (-583.633) (-585.639) (-587.735) [-584.264] * (-587.484) (-586.446) [-586.554] (-584.660) -- 0:00:42
Average standard deviation of split frequencies: 0.013574
285500 -- [-583.846] (-584.938) (-584.201) (-584.606) * (-585.879) (-584.935) (-585.643) [-584.491] -- 0:00:42
286000 -- [-584.667] (-585.517) (-583.190) (-585.614) * (-587.126) (-584.318) (-585.639) [-588.669] -- 0:00:42
286500 -- (-584.357) (-583.913) [-586.243] (-585.904) * (-586.112) (-586.281) [-584.729] (-591.410) -- 0:00:42
287000 -- (-585.155) (-585.954) [-584.568] (-584.055) * [-585.191] (-583.607) (-585.542) (-587.393) -- 0:00:42
287500 -- (-586.186) (-584.073) (-588.460) [-583.930] * (-587.653) (-583.356) (-582.735) [-585.263] -- 0:00:42
288000 -- (-587.917) (-587.903) (-584.199) [-584.382] * [-586.674] (-588.465) (-584.015) (-593.717) -- 0:00:42
288500 -- [-585.826] (-585.208) (-585.268) (-582.949) * (-589.722) (-587.648) [-583.525] (-585.579) -- 0:00:41
289000 -- (-586.312) (-584.822) (-587.369) [-583.432] * (-585.488) [-586.278] (-583.788) (-586.013) -- 0:00:41
289500 -- (-586.858) [-586.708] (-586.824) (-586.323) * (-585.121) [-587.371] (-584.436) (-584.480) -- 0:00:41
290000 -- [-587.953] (-584.190) (-588.405) (-585.643) * [-584.753] (-586.199) (-584.508) (-589.957) -- 0:00:41
Average standard deviation of split frequencies: 0.013451
290500 -- (-590.775) [-584.139] (-583.553) (-584.176) * (-584.262) [-586.002] (-585.932) (-585.470) -- 0:00:41
291000 -- (-588.888) (-585.614) (-587.107) [-585.343] * (-585.018) [-585.318] (-583.973) (-585.260) -- 0:00:41
291500 -- [-584.094] (-586.243) (-583.024) (-583.957) * [-587.601] (-586.160) (-583.386) (-585.304) -- 0:00:41
292000 -- (-584.057) (-586.150) (-583.358) [-586.330] * (-587.835) [-583.676] (-585.104) (-583.623) -- 0:00:41
292500 -- (-583.955) (-583.513) (-585.537) [-584.507] * [-586.442] (-587.254) (-585.122) (-583.252) -- 0:00:41
293000 -- (-586.239) [-584.037] (-586.399) (-585.413) * (-585.821) (-586.461) [-584.756] (-586.251) -- 0:00:43
293500 -- (-584.528) [-583.003] (-584.977) (-583.539) * [-584.738] (-583.909) (-587.105) (-583.149) -- 0:00:43
294000 -- (-585.640) [-586.814] (-584.464) (-590.080) * (-587.882) (-584.163) (-586.524) [-584.767] -- 0:00:43
294500 -- (-588.189) (-585.693) [-583.684] (-585.981) * (-587.622) (-585.777) [-583.622] (-587.318) -- 0:00:43
295000 -- (-589.631) (-586.918) (-586.741) [-584.990] * (-583.162) (-588.005) (-583.610) [-583.607] -- 0:00:43
Average standard deviation of split frequencies: 0.014146
295500 -- (-587.206) (-588.117) (-584.732) [-587.442] * [-583.162] (-584.268) (-584.391) (-584.433) -- 0:00:42
296000 -- (-588.447) (-586.569) [-584.066] (-592.572) * (-586.828) (-584.135) (-587.603) [-584.755] -- 0:00:42
296500 -- [-584.421] (-584.372) (-589.376) (-588.160) * (-583.805) [-582.863] (-587.098) (-585.223) -- 0:00:42
297000 -- (-587.152) (-587.756) (-587.006) [-586.847] * (-586.291) (-584.046) (-585.049) [-586.309] -- 0:00:42
297500 -- (-585.289) (-583.938) [-585.536] (-584.320) * (-584.191) (-582.770) (-586.897) [-589.972] -- 0:00:42
298000 -- (-586.557) [-584.356] (-585.733) (-584.635) * (-584.954) [-584.669] (-585.144) (-587.001) -- 0:00:42
298500 -- [-585.417] (-583.287) (-588.630) (-583.327) * [-589.439] (-587.972) (-583.579) (-584.404) -- 0:00:42
299000 -- (-584.914) [-584.976] (-589.227) (-583.729) * (-582.943) (-589.990) [-584.154] (-583.376) -- 0:00:42
299500 -- (-595.889) [-589.767] (-583.239) (-589.037) * (-585.515) (-588.403) (-584.157) [-583.282] -- 0:00:42
300000 -- (-585.827) [-583.669] (-583.352) (-586.357) * (-583.911) (-585.197) (-583.780) [-584.994] -- 0:00:42
Average standard deviation of split frequencies: 0.014572
300500 -- [-586.277] (-587.621) (-587.780) (-583.058) * (-583.529) (-585.813) (-585.139) [-585.371] -- 0:00:41
301000 -- (-588.303) (-585.847) (-584.309) [-583.594] * (-589.117) (-586.601) (-584.387) [-585.983] -- 0:00:41
301500 -- (-584.314) (-583.975) [-585.221] (-582.758) * (-585.141) (-587.502) [-584.342] (-585.407) -- 0:00:41
302000 -- (-584.865) (-583.907) (-585.542) [-585.111] * [-583.301] (-586.108) (-584.668) (-585.199) -- 0:00:41
302500 -- [-584.355] (-585.386) (-588.150) (-586.128) * (-583.582) [-587.770] (-585.621) (-583.422) -- 0:00:41
303000 -- (-584.211) (-589.665) [-583.090] (-586.200) * (-584.973) [-585.940] (-584.090) (-584.904) -- 0:00:41
303500 -- (-585.336) (-587.961) (-583.895) [-584.266] * (-585.325) [-584.086] (-585.999) (-583.861) -- 0:00:41
304000 -- (-584.189) (-585.955) [-585.161] (-589.156) * (-589.501) [-586.843] (-588.723) (-583.823) -- 0:00:41
304500 -- (-586.321) (-585.837) [-585.328] (-583.538) * [-588.972] (-584.798) (-588.807) (-584.523) -- 0:00:41
305000 -- (-583.487) (-585.501) (-591.645) [-584.052] * (-585.210) (-584.044) (-583.898) [-584.892] -- 0:00:41
Average standard deviation of split frequencies: 0.014046
305500 -- [-583.788] (-590.491) (-584.851) (-585.147) * [-584.575] (-589.742) (-584.358) (-586.712) -- 0:00:40
306000 -- [-584.150] (-585.356) (-588.527) (-583.785) * (-586.803) (-589.292) (-584.187) [-585.021] -- 0:00:40
306500 -- [-584.184] (-584.220) (-585.851) (-584.332) * [-584.629] (-585.152) (-585.014) (-583.672) -- 0:00:40
307000 -- [-584.081] (-584.791) (-584.366) (-584.964) * (-585.564) (-586.901) [-583.736] (-584.471) -- 0:00:40
307500 -- (-585.280) [-589.296] (-583.936) (-584.225) * (-586.749) (-588.009) [-584.116] (-584.929) -- 0:00:40
308000 -- (-584.745) (-590.090) [-583.901] (-584.969) * (-582.991) (-587.499) [-583.318] (-584.793) -- 0:00:40
308500 -- [-585.769] (-584.594) (-583.470) (-583.742) * [-583.463] (-585.109) (-583.826) (-583.984) -- 0:00:40
309000 -- (-585.551) (-585.394) (-584.442) [-583.159] * (-586.628) (-586.253) [-586.090] (-584.501) -- 0:00:40
309500 -- (-584.403) (-583.658) [-584.411] (-583.161) * (-585.597) [-590.672] (-583.633) (-585.957) -- 0:00:42
310000 -- [-585.040] (-588.521) (-587.754) (-583.274) * [-583.723] (-587.064) (-583.207) (-585.296) -- 0:00:42
Average standard deviation of split frequencies: 0.012729
310500 -- (-586.436) (-584.612) (-585.289) [-584.413] * (-584.710) [-583.654] (-584.801) (-583.335) -- 0:00:42
311000 -- (-587.474) [-583.346] (-584.258) (-585.081) * (-585.252) [-585.816] (-583.444) (-587.199) -- 0:00:42
311500 -- [-584.735] (-584.057) (-587.581) (-586.920) * [-584.496] (-586.427) (-584.058) (-583.250) -- 0:00:41
312000 -- [-585.026] (-586.695) (-586.814) (-585.175) * (-586.325) [-586.029] (-586.693) (-590.412) -- 0:00:41
312500 -- (-584.144) (-585.344) (-585.081) [-583.787] * [-583.598] (-585.299) (-583.978) (-589.407) -- 0:00:41
313000 -- (-591.373) (-586.899) [-588.259] (-588.376) * (-585.539) [-583.952] (-585.530) (-587.883) -- 0:00:41
313500 -- (-583.508) (-588.012) [-584.834] (-588.876) * [-584.240] (-590.794) (-583.812) (-589.636) -- 0:00:41
314000 -- [-583.876] (-583.334) (-583.931) (-587.301) * [-587.762] (-588.943) (-583.888) (-591.145) -- 0:00:41
314500 -- [-584.861] (-584.481) (-589.992) (-583.950) * [-588.115] (-584.617) (-585.307) (-585.568) -- 0:00:41
315000 -- [-585.936] (-584.895) (-586.007) (-583.582) * [-586.666] (-583.996) (-585.947) (-585.742) -- 0:00:41
Average standard deviation of split frequencies: 0.012929
315500 -- (-585.480) (-584.589) (-584.908) [-582.910] * (-583.360) (-585.450) [-585.610] (-584.670) -- 0:00:41
316000 -- (-583.022) (-583.309) [-584.279] (-584.899) * [-583.124] (-584.293) (-583.946) (-584.820) -- 0:00:41
316500 -- (-584.679) (-584.133) (-584.009) [-585.197] * (-583.653) [-584.658] (-586.518) (-583.798) -- 0:00:41
317000 -- (-586.713) [-583.245] (-586.611) (-586.523) * (-589.541) (-585.384) [-586.298] (-588.380) -- 0:00:40
317500 -- [-584.003] (-584.692) (-585.956) (-584.168) * (-583.151) [-589.696] (-589.207) (-583.704) -- 0:00:40
318000 -- [-584.001] (-585.664) (-591.780) (-590.451) * [-583.137] (-592.323) (-587.836) (-585.105) -- 0:00:40
318500 -- (-583.369) (-583.999) (-588.652) [-593.194] * (-582.983) [-585.536] (-586.738) (-588.046) -- 0:00:40
319000 -- (-591.085) [-585.399] (-584.219) (-588.311) * (-589.825) (-583.978) [-585.890] (-594.121) -- 0:00:40
319500 -- (-583.694) (-584.081) [-586.232] (-586.541) * (-586.305) (-584.384) (-586.593) [-587.020] -- 0:00:40
320000 -- [-587.576] (-586.118) (-585.221) (-586.778) * (-585.255) (-584.716) [-583.740] (-583.973) -- 0:00:40
Average standard deviation of split frequencies: 0.013966
320500 -- (-584.639) (-583.989) (-586.129) [-584.900] * (-586.478) (-584.354) (-584.188) [-587.157] -- 0:00:40
321000 -- [-584.465] (-584.851) (-588.836) (-583.832) * (-586.087) [-583.731] (-584.408) (-587.659) -- 0:00:40
321500 -- [-583.406] (-584.694) (-584.364) (-586.841) * (-587.635) (-585.341) [-585.249] (-583.972) -- 0:00:40
322000 -- [-587.475] (-583.379) (-583.928) (-584.420) * (-586.933) (-586.622) (-584.201) [-582.855] -- 0:00:40
322500 -- (-585.398) (-586.653) [-586.256] (-587.988) * (-585.790) [-583.416] (-584.644) (-584.784) -- 0:00:39
323000 -- (-585.997) (-585.191) [-584.703] (-590.073) * [-584.164] (-584.814) (-586.985) (-586.791) -- 0:00:39
323500 -- [-584.672] (-583.193) (-584.897) (-590.487) * (-587.775) [-586.336] (-589.540) (-585.265) -- 0:00:39
324000 -- [-583.502] (-584.025) (-584.286) (-587.255) * [-584.583] (-587.415) (-587.129) (-585.653) -- 0:00:39
324500 -- [-583.550] (-589.444) (-586.110) (-584.737) * (-584.150) [-584.794] (-585.304) (-584.053) -- 0:00:39
325000 -- [-583.661] (-586.428) (-586.859) (-585.840) * [-584.940] (-585.480) (-586.112) (-585.442) -- 0:00:39
Average standard deviation of split frequencies: 0.014059
325500 -- (-583.551) [-587.112] (-582.894) (-585.805) * (-585.646) (-584.884) (-583.508) [-585.492] -- 0:00:39
326000 -- [-584.225] (-584.248) (-584.585) (-583.136) * [-585.361] (-583.288) (-584.213) (-584.744) -- 0:00:41
326500 -- (-584.548) [-584.967] (-584.192) (-586.723) * (-588.614) (-584.209) (-584.482) [-585.136] -- 0:00:41
327000 -- (-586.496) (-584.752) [-584.810] (-585.594) * (-588.512) (-587.286) (-585.189) [-584.460] -- 0:00:41
327500 -- (-586.913) [-586.904] (-585.416) (-583.861) * (-587.154) (-592.950) [-583.996] (-586.046) -- 0:00:41
328000 -- (-590.483) (-588.350) [-583.460] (-584.327) * (-584.187) [-584.267] (-587.465) (-586.641) -- 0:00:40
328500 -- (-585.800) [-584.966] (-583.404) (-586.539) * (-585.019) [-588.837] (-583.542) (-588.961) -- 0:00:40
329000 -- (-586.767) (-583.327) [-585.163] (-584.527) * [-585.538] (-586.924) (-587.427) (-587.894) -- 0:00:40
329500 -- (-586.198) (-588.511) (-591.240) [-584.861] * [-583.171] (-586.109) (-585.175) (-584.333) -- 0:00:40
330000 -- (-589.872) (-587.272) (-584.311) [-584.610] * [-584.698] (-583.317) (-586.763) (-584.883) -- 0:00:40
Average standard deviation of split frequencies: 0.014556
330500 -- (-585.524) [-584.940] (-588.596) (-583.053) * (-595.502) (-585.156) [-584.238] (-584.467) -- 0:00:40
331000 -- (-589.757) (-584.876) (-585.062) [-585.842] * (-584.019) [-583.154] (-584.965) (-585.464) -- 0:00:40
331500 -- (-586.579) (-588.473) [-583.913] (-585.131) * (-584.102) (-583.983) (-584.879) [-583.921] -- 0:00:40
332000 -- (-583.691) (-583.500) [-584.718] (-586.785) * (-584.288) [-583.748] (-586.154) (-586.646) -- 0:00:40
332500 -- (-583.685) (-585.115) [-586.795] (-583.872) * (-584.368) [-585.172] (-584.815) (-584.926) -- 0:00:40
333000 -- (-585.633) (-584.795) (-588.806) [-583.806] * (-585.717) (-582.975) (-585.493) [-589.697] -- 0:00:40
333500 -- (-585.209) (-584.227) (-585.069) [-586.206] * (-588.654) (-584.794) (-586.868) [-588.072] -- 0:00:39
334000 -- (-584.338) (-584.969) [-585.724] (-586.808) * (-582.992) (-585.193) [-585.481] (-583.535) -- 0:00:39
334500 -- [-585.631] (-583.379) (-584.636) (-587.134) * [-584.340] (-584.123) (-584.027) (-583.337) -- 0:00:39
335000 -- (-587.280) (-584.419) [-584.571] (-587.947) * (-583.282) [-587.102] (-584.675) (-585.316) -- 0:00:39
Average standard deviation of split frequencies: 0.013640
335500 -- (-584.588) (-585.625) [-584.232] (-583.106) * (-583.030) (-588.863) [-585.814] (-590.162) -- 0:00:39
336000 -- (-589.918) (-583.779) [-585.358] (-584.752) * (-585.653) (-586.782) [-584.634] (-584.972) -- 0:00:39
336500 -- (-587.291) (-586.546) (-586.152) [-583.899] * (-583.025) (-587.662) [-586.695] (-584.611) -- 0:00:39
337000 -- (-584.316) (-586.186) (-587.579) [-583.370] * (-585.806) [-584.896] (-586.349) (-587.063) -- 0:00:39
337500 -- (-591.138) (-585.170) [-584.715] (-583.631) * (-586.551) (-592.992) [-583.598] (-585.501) -- 0:00:39
338000 -- (-584.607) (-585.165) [-586.395] (-584.279) * (-583.825) [-583.777] (-584.057) (-584.149) -- 0:00:39
338500 -- [-584.766] (-583.836) (-583.931) (-586.234) * (-584.029) (-582.700) [-588.179] (-588.234) -- 0:00:39
339000 -- (-589.757) [-583.762] (-584.008) (-588.729) * (-585.303) (-583.481) (-583.458) [-585.447] -- 0:00:38
339500 -- (-585.238) (-584.887) (-583.691) [-583.715] * [-584.258] (-587.926) (-585.013) (-587.217) -- 0:00:38
340000 -- (-583.962) (-583.297) (-588.551) [-582.871] * (-585.915) [-584.406] (-587.380) (-583.657) -- 0:00:38
Average standard deviation of split frequencies: 0.013675
340500 -- [-585.999] (-583.433) (-587.918) (-582.870) * (-583.448) (-587.416) [-585.431] (-584.733) -- 0:00:38
341000 -- (-589.233) [-585.346] (-584.685) (-583.988) * (-583.619) [-585.754] (-583.579) (-583.471) -- 0:00:38
341500 -- (-584.482) (-589.340) [-582.931] (-585.360) * [-584.689] (-585.078) (-588.852) (-583.940) -- 0:00:38
342000 -- (-583.327) [-585.471] (-583.012) (-585.176) * [-584.971] (-585.903) (-584.625) (-584.424) -- 0:00:38
342500 -- (-584.473) (-585.304) (-584.042) [-584.027] * (-585.204) [-583.327] (-585.172) (-583.675) -- 0:00:40
343000 -- (-584.506) [-585.285] (-586.214) (-583.224) * (-585.616) [-586.748] (-585.513) (-584.155) -- 0:00:40
343500 -- [-584.721] (-586.025) (-585.267) (-584.830) * (-583.331) [-584.095] (-587.615) (-583.262) -- 0:00:40
344000 -- (-583.483) (-584.986) (-585.802) [-584.705] * (-583.335) (-584.034) (-583.801) [-583.126] -- 0:00:40
344500 -- (-590.269) (-587.130) [-583.406] (-584.209) * (-583.723) [-583.859] (-583.713) (-583.496) -- 0:00:39
345000 -- (-585.773) (-584.811) [-583.087] (-584.881) * (-587.290) [-584.069] (-583.985) (-586.055) -- 0:00:39
Average standard deviation of split frequencies: 0.012903
345500 -- (-583.558) (-585.183) (-588.746) [-583.434] * (-584.145) (-584.869) [-583.381] (-589.627) -- 0:00:39
346000 -- (-583.870) (-583.639) (-583.726) [-584.384] * (-585.369) (-586.475) [-585.342] (-584.318) -- 0:00:39
346500 -- (-584.731) (-587.042) [-586.224] (-584.955) * [-584.573] (-586.400) (-583.649) (-586.383) -- 0:00:39
347000 -- [-585.535] (-586.852) (-584.787) (-584.145) * (-583.013) (-586.641) (-586.434) [-588.276] -- 0:00:39
347500 -- (-586.008) (-584.815) [-587.176] (-586.087) * (-585.876) (-589.316) (-586.068) [-585.554] -- 0:00:39
348000 -- (-588.059) (-584.942) (-583.680) [-583.835] * (-585.590) [-585.805] (-584.275) (-585.921) -- 0:00:39
348500 -- (-586.983) (-584.803) (-585.812) [-583.932] * (-588.357) (-588.458) (-585.955) [-585.054] -- 0:00:39
349000 -- (-583.918) [-585.471] (-584.683) (-583.660) * (-586.078) [-584.036] (-586.036) (-587.604) -- 0:00:39
349500 -- (-584.305) (-586.204) (-585.582) [-584.264] * [-585.768] (-585.623) (-587.778) (-588.652) -- 0:00:39
350000 -- (-583.999) (-585.644) [-584.012] (-585.013) * [-584.536] (-585.157) (-588.727) (-585.612) -- 0:00:39
Average standard deviation of split frequencies: 0.013918
350500 -- [-584.695] (-584.075) (-583.176) (-583.706) * (-584.091) [-584.934] (-585.166) (-585.026) -- 0:00:38
351000 -- (-590.298) (-587.933) [-583.024] (-584.905) * [-584.147] (-585.454) (-586.233) (-586.263) -- 0:00:38
351500 -- (-584.709) (-584.550) [-585.167] (-583.583) * [-583.069] (-586.426) (-584.092) (-585.587) -- 0:00:38
352000 -- (-586.274) [-584.831] (-585.965) (-585.470) * (-583.533) (-583.292) (-584.518) [-585.563] -- 0:00:38
352500 -- (-583.551) [-584.597] (-585.048) (-583.522) * (-586.034) [-586.022] (-591.082) (-587.136) -- 0:00:38
353000 -- (-584.768) [-586.266] (-591.309) (-585.955) * (-584.398) [-584.660] (-590.281) (-584.456) -- 0:00:38
353500 -- (-584.612) (-588.463) (-585.142) [-585.120] * (-586.160) (-584.660) [-587.169] (-587.131) -- 0:00:38
354000 -- (-583.458) (-584.864) [-584.876] (-590.457) * (-588.041) (-585.533) (-591.732) [-584.644] -- 0:00:38
354500 -- (-585.297) (-585.501) (-585.334) [-585.487] * (-583.971) (-586.853) (-590.747) [-583.955] -- 0:00:38
355000 -- [-585.099] (-584.961) (-586.402) (-587.768) * [-584.108] (-583.132) (-583.163) (-586.986) -- 0:00:38
Average standard deviation of split frequencies: 0.012285
355500 -- (-586.195) [-584.533] (-584.388) (-584.592) * (-583.894) (-585.605) (-583.900) [-585.063] -- 0:00:38
356000 -- (-587.872) (-589.586) (-586.454) [-584.367] * [-583.692] (-584.937) (-584.600) (-588.349) -- 0:00:37
356500 -- (-585.478) (-589.376) (-585.859) [-583.676] * [-583.081] (-588.690) (-586.311) (-586.634) -- 0:00:37
357000 -- (-584.914) (-591.540) (-585.928) [-585.377] * (-585.030) (-586.119) (-588.367) [-586.739] -- 0:00:37
357500 -- [-587.012] (-588.285) (-586.122) (-585.071) * (-584.990) [-586.030] (-590.582) (-587.526) -- 0:00:37
358000 -- (-586.747) (-585.053) (-585.666) [-583.981] * (-583.539) (-583.819) [-586.548] (-591.466) -- 0:00:37
358500 -- [-583.010] (-585.386) (-585.259) (-588.643) * (-583.957) (-587.222) [-585.245] (-585.631) -- 0:00:37
359000 -- (-586.387) [-586.252] (-583.385) (-583.608) * (-586.276) [-584.407] (-589.052) (-583.579) -- 0:00:37
359500 -- (-589.060) (-587.351) (-584.221) [-584.677] * (-583.937) [-585.503] (-585.517) (-583.562) -- 0:00:39
360000 -- (-586.681) [-583.310] (-585.286) (-586.619) * (-582.825) [-586.267] (-585.408) (-583.555) -- 0:00:39
Average standard deviation of split frequencies: 0.011473
360500 -- (-584.861) (-584.617) (-583.594) [-583.865] * [-582.827] (-586.864) (-585.415) (-583.438) -- 0:00:39
361000 -- (-583.871) (-584.174) (-584.054) [-583.399] * [-583.763] (-584.838) (-584.319) (-586.957) -- 0:00:38
361500 -- (-585.488) [-584.375] (-586.520) (-584.721) * (-583.481) [-587.626] (-588.192) (-585.269) -- 0:00:38
362000 -- (-588.231) [-583.696] (-585.537) (-586.589) * (-588.284) [-582.828] (-583.305) (-584.068) -- 0:00:38
362500 -- (-583.899) [-585.091] (-583.717) (-586.118) * (-585.664) (-583.741) [-583.627] (-584.339) -- 0:00:38
363000 -- (-587.826) (-583.743) [-587.855] (-587.302) * (-585.280) [-584.778] (-586.778) (-586.670) -- 0:00:38
363500 -- [-583.598] (-587.110) (-584.582) (-584.570) * (-586.924) (-592.501) (-584.718) [-587.205] -- 0:00:38
364000 -- (-583.670) [-586.327] (-585.131) (-585.526) * (-586.278) [-584.026] (-584.316) (-586.354) -- 0:00:38
364500 -- [-583.376] (-584.919) (-584.310) (-583.522) * (-588.293) (-584.057) [-585.001] (-584.449) -- 0:00:38
365000 -- (-583.765) [-584.637] (-584.254) (-585.642) * [-589.477] (-585.015) (-585.086) (-586.237) -- 0:00:38
Average standard deviation of split frequencies: 0.011735
365500 -- (-585.878) (-585.778) [-587.075] (-584.852) * (-587.783) (-582.945) (-584.952) [-583.637] -- 0:00:38
366000 -- (-584.701) (-584.867) (-585.592) [-585.142] * (-584.377) (-583.941) (-584.293) [-584.877] -- 0:00:38
366500 -- (-584.112) (-584.404) [-588.415] (-584.780) * (-584.034) [-583.054] (-583.330) (-584.979) -- 0:00:38
367000 -- [-583.255] (-584.554) (-584.338) (-585.838) * (-584.433) [-587.304] (-583.795) (-588.784) -- 0:00:37
367500 -- [-585.402] (-585.363) (-586.695) (-583.371) * (-588.827) (-588.548) [-585.434] (-583.249) -- 0:00:37
368000 -- [-584.905] (-583.699) (-587.696) (-584.244) * [-587.198] (-590.239) (-587.766) (-585.542) -- 0:00:37
368500 -- [-586.645] (-586.459) (-583.492) (-586.706) * (-586.094) [-583.367] (-585.742) (-586.391) -- 0:00:37
369000 -- (-584.735) [-584.299] (-583.286) (-585.846) * (-588.502) [-583.701] (-585.455) (-587.921) -- 0:00:37
369500 -- [-583.066] (-585.030) (-584.175) (-583.703) * (-586.923) [-584.696] (-584.776) (-587.553) -- 0:00:37
370000 -- (-583.360) (-589.245) (-585.189) [-584.228] * [-585.913] (-588.051) (-587.889) (-584.873) -- 0:00:37
Average standard deviation of split frequencies: 0.012493
370500 -- (-584.089) [-583.456] (-583.920) (-583.610) * (-588.130) (-584.503) (-585.348) [-587.382] -- 0:00:37
371000 -- (-585.355) [-584.076] (-585.045) (-583.398) * (-585.011) (-583.362) (-584.459) [-585.243] -- 0:00:37
371500 -- (-585.270) (-584.732) (-584.046) [-583.216] * (-583.907) (-583.148) [-588.023] (-585.313) -- 0:00:37
372000 -- (-584.986) (-584.004) [-582.784] (-589.124) * (-588.587) [-584.319] (-588.255) (-585.907) -- 0:00:37
372500 -- [-585.174] (-585.786) (-583.755) (-583.225) * [-586.241] (-584.098) (-584.444) (-586.280) -- 0:00:37
373000 -- (-584.979) (-582.993) (-583.739) [-584.034] * (-585.388) [-584.632] (-588.669) (-582.938) -- 0:00:36
373500 -- (-583.920) (-584.792) (-589.358) [-585.213] * (-583.771) (-584.198) (-588.159) [-583.774] -- 0:00:36
374000 -- (-583.983) (-586.565) (-585.459) [-584.447] * (-585.795) [-583.406] (-585.798) (-583.318) -- 0:00:36
374500 -- (-584.968) (-584.000) [-584.346] (-587.614) * (-584.826) [-583.595] (-586.284) (-584.014) -- 0:00:36
375000 -- (-585.119) (-586.986) [-583.464] (-584.003) * [-584.313] (-583.642) (-586.732) (-584.565) -- 0:00:36
Average standard deviation of split frequencies: 0.011841
375500 -- (-585.135) (-585.065) (-587.629) [-583.890] * (-584.654) (-583.995) [-585.043] (-583.936) -- 0:00:36
376000 -- (-583.987) [-584.212] (-588.558) (-591.747) * (-583.971) (-583.627) [-586.041] (-586.724) -- 0:00:36
376500 -- (-582.984) (-585.855) (-585.837) [-589.970] * (-584.615) [-583.525] (-585.472) (-583.568) -- 0:00:38
377000 -- [-585.222] (-585.991) (-583.952) (-584.883) * [-582.983] (-585.767) (-584.620) (-584.512) -- 0:00:38
377500 -- [-583.659] (-586.154) (-585.533) (-586.291) * (-586.452) [-584.995] (-584.053) (-582.983) -- 0:00:37
378000 -- (-583.861) [-584.210] (-583.422) (-586.685) * (-586.613) (-587.681) [-585.466] (-583.585) -- 0:00:37
378500 -- [-586.811] (-586.916) (-583.664) (-586.951) * (-583.656) (-587.655) [-584.322] (-583.473) -- 0:00:37
379000 -- (-586.162) (-586.316) [-590.012] (-587.557) * (-585.143) (-584.141) [-584.222] (-584.105) -- 0:00:37
379500 -- (-588.261) [-589.169] (-589.985) (-583.958) * [-583.451] (-585.431) (-585.056) (-587.192) -- 0:00:37
380000 -- (-582.900) (-583.710) [-588.147] (-584.393) * (-583.773) (-584.470) [-584.012] (-587.718) -- 0:00:37
Average standard deviation of split frequencies: 0.011902
380500 -- (-585.558) (-584.779) [-585.154] (-586.552) * (-586.755) (-583.861) (-583.561) [-584.987] -- 0:00:37
381000 -- (-585.286) (-583.846) (-586.069) [-584.825] * (-587.118) [-583.922] (-583.945) (-585.129) -- 0:00:37
381500 -- (-587.172) (-588.982) (-586.888) [-585.525] * (-584.106) [-587.653] (-583.691) (-585.966) -- 0:00:37
382000 -- (-585.422) (-584.391) [-587.558] (-587.124) * (-584.420) [-583.923] (-584.161) (-583.760) -- 0:00:37
382500 -- (-583.920) (-583.597) (-584.424) [-587.069] * (-583.441) (-586.634) (-586.528) [-583.293] -- 0:00:37
383000 -- [-583.603] (-586.641) (-585.169) (-584.182) * [-585.770] (-583.800) (-585.775) (-583.635) -- 0:00:37
383500 -- (-583.489) (-585.618) (-587.684) [-588.173] * (-585.246) (-584.171) (-588.413) [-584.104] -- 0:00:36
384000 -- (-587.062) (-585.362) (-587.605) [-583.492] * (-588.135) [-584.410] (-586.029) (-585.647) -- 0:00:36
384500 -- (-588.181) (-584.618) (-589.090) [-584.055] * (-585.775) [-584.249] (-585.612) (-586.219) -- 0:00:36
385000 -- (-584.524) (-584.371) (-584.172) [-584.240] * (-583.753) [-586.613] (-584.783) (-584.905) -- 0:00:36
Average standard deviation of split frequencies: 0.011873
385500 -- [-585.683] (-586.326) (-583.754) (-584.456) * (-583.676) [-585.197] (-585.112) (-585.652) -- 0:00:36
386000 -- (-587.341) [-586.861] (-584.460) (-583.562) * [-584.462] (-586.503) (-588.804) (-588.321) -- 0:00:36
386500 -- (-584.866) (-586.696) (-585.478) [-589.075] * (-586.580) [-584.339] (-587.424) (-588.174) -- 0:00:36
387000 -- (-584.744) [-587.113] (-587.096) (-588.282) * [-586.548] (-585.159) (-586.983) (-584.928) -- 0:00:36
387500 -- (-586.654) (-585.486) (-585.671) [-585.244] * (-585.589) (-585.010) [-585.961] (-583.934) -- 0:00:36
388000 -- (-585.726) (-585.902) (-583.783) [-583.666] * (-588.199) (-585.933) [-583.069] (-584.464) -- 0:00:36
388500 -- (-585.737) (-585.823) [-585.538] (-588.818) * (-583.018) (-585.871) [-585.985] (-584.550) -- 0:00:36
389000 -- (-585.642) [-585.556] (-583.996) (-585.519) * (-591.955) (-585.933) (-586.306) [-584.120] -- 0:00:36
389500 -- (-585.673) (-589.393) (-583.581) [-584.589] * (-585.050) [-583.544] (-585.583) (-583.383) -- 0:00:36
390000 -- (-585.534) (-585.139) (-585.110) [-583.394] * (-584.962) [-584.357] (-591.514) (-583.299) -- 0:00:35
Average standard deviation of split frequencies: 0.012989
390500 -- (-584.791) [-584.459] (-584.182) (-587.676) * [-586.090] (-587.950) (-584.357) (-584.956) -- 0:00:35
391000 -- (-585.778) (-584.790) (-584.192) [-587.097] * (-586.151) (-585.491) [-583.909] (-593.392) -- 0:00:35
391500 -- (-582.848) (-583.991) (-583.363) [-585.588] * [-583.569] (-584.094) (-584.739) (-584.688) -- 0:00:35
392000 -- (-582.853) (-586.788) [-583.583] (-584.057) * [-583.458] (-585.601) (-583.397) (-585.527) -- 0:00:35
392500 -- (-584.609) (-585.298) [-583.772] (-584.406) * (-584.860) (-591.608) [-585.306] (-584.995) -- 0:00:35
393000 -- (-585.262) (-585.219) [-584.352] (-583.507) * (-584.022) [-589.164] (-584.522) (-586.967) -- 0:00:35
393500 -- (-587.081) (-584.860) [-584.273] (-584.630) * (-583.270) (-586.993) (-584.103) [-586.785] -- 0:00:36
394000 -- (-586.117) (-586.907) (-587.172) [-585.195] * (-584.115) (-584.203) [-584.523] (-584.832) -- 0:00:36
394500 -- (-585.886) (-586.644) (-584.126) [-584.929] * [-585.010] (-584.401) (-584.556) (-584.621) -- 0:00:36
395000 -- (-586.587) (-585.249) [-583.983] (-584.716) * (-586.730) (-583.671) (-584.714) [-584.419] -- 0:00:36
Average standard deviation of split frequencies: 0.013161
395500 -- (-585.698) (-585.629) (-583.457) [-583.960] * (-585.238) [-583.716] (-584.260) (-586.387) -- 0:00:36
396000 -- (-585.437) (-585.076) (-584.991) [-584.320] * (-584.681) (-583.689) (-584.295) [-586.136] -- 0:00:36
396500 -- (-588.212) (-584.301) [-582.927] (-586.404) * [-587.908] (-585.647) (-585.502) (-587.020) -- 0:00:36
397000 -- (-586.656) (-584.991) [-585.534] (-586.416) * (-584.297) (-589.648) (-586.611) [-586.451] -- 0:00:36
397500 -- [-589.540] (-585.083) (-583.941) (-586.370) * (-585.696) (-584.045) (-586.786) [-585.594] -- 0:00:36
398000 -- (-586.757) (-585.654) [-584.188] (-588.457) * [-584.362] (-585.268) (-585.981) (-587.355) -- 0:00:36
398500 -- [-585.038] (-583.997) (-587.089) (-583.640) * [-585.061] (-584.640) (-586.271) (-597.654) -- 0:00:36
399000 -- [-583.219] (-583.498) (-584.764) (-584.712) * (-584.694) [-587.185] (-584.607) (-594.694) -- 0:00:36
399500 -- (-583.482) (-585.471) (-585.206) [-584.088] * (-588.060) (-586.690) (-586.369) [-585.639] -- 0:00:36
400000 -- [-583.113] (-584.306) (-585.460) (-584.100) * (-583.995) (-587.020) (-587.435) [-584.493] -- 0:00:36
Average standard deviation of split frequencies: 0.013269
400500 -- (-584.818) (-586.197) [-583.476] (-584.440) * [-585.011] (-584.730) (-586.070) (-586.258) -- 0:00:35
401000 -- (-584.190) [-586.464] (-583.702) (-583.297) * (-586.327) (-586.934) (-584.775) [-584.359] -- 0:00:35
401500 -- (-582.892) [-583.390] (-584.422) (-583.502) * (-585.902) (-585.309) (-584.083) [-583.747] -- 0:00:35
402000 -- (-585.023) (-583.851) (-584.866) [-584.440] * (-584.995) [-583.474] (-585.930) (-583.395) -- 0:00:35
402500 -- (-584.474) [-585.623] (-587.379) (-588.048) * (-584.878) (-583.184) [-583.574] (-583.708) -- 0:00:35
403000 -- [-584.595] (-584.494) (-583.677) (-584.559) * (-583.725) (-584.809) [-585.447] (-586.014) -- 0:00:35
403500 -- (-586.588) (-584.111) [-588.504] (-584.513) * (-584.042) (-587.035) [-587.917] (-582.968) -- 0:00:35
404000 -- (-586.307) (-588.382) [-585.058] (-583.429) * [-585.359] (-587.606) (-586.656) (-585.006) -- 0:00:35
404500 -- [-588.651] (-587.903) (-586.552) (-584.484) * [-585.851] (-586.346) (-586.533) (-585.594) -- 0:00:35
405000 -- (-584.469) (-585.810) (-585.058) [-583.321] * (-583.565) (-584.316) [-584.733] (-584.561) -- 0:00:35
Average standard deviation of split frequencies: 0.013095
405500 -- [-587.333] (-584.740) (-585.327) (-584.829) * [-583.417] (-588.453) (-585.823) (-583.255) -- 0:00:35
406000 -- (-583.544) (-585.701) (-589.031) [-585.544] * [-584.336] (-586.534) (-585.686) (-583.287) -- 0:00:35
406500 -- [-589.615] (-586.926) (-584.044) (-583.138) * (-586.872) (-584.751) [-585.860] (-587.311) -- 0:00:35
407000 -- [-586.330] (-583.599) (-584.641) (-585.032) * [-586.103] (-584.115) (-585.462) (-587.144) -- 0:00:34
407500 -- [-584.292] (-586.552) (-585.488) (-587.024) * [-584.771] (-584.695) (-586.425) (-587.624) -- 0:00:34
408000 -- (-585.175) (-584.716) (-586.190) [-584.686] * [-584.974] (-585.425) (-585.532) (-585.177) -- 0:00:34
408500 -- (-585.157) (-586.316) [-584.455] (-585.426) * (-583.915) (-587.287) [-584.283] (-584.188) -- 0:00:34
409000 -- (-584.463) [-584.896] (-583.660) (-583.205) * (-583.252) [-585.436] (-589.428) (-589.909) -- 0:00:34
409500 -- [-585.703] (-586.467) (-588.439) (-583.351) * (-588.259) (-589.913) [-586.677] (-584.501) -- 0:00:34
410000 -- (-584.355) [-588.370] (-586.921) (-583.351) * (-586.339) (-586.666) (-586.135) [-583.592] -- 0:00:35
Average standard deviation of split frequencies: 0.013505
410500 -- (-585.464) [-584.145] (-586.352) (-585.247) * (-583.570) (-587.147) (-584.158) [-583.823] -- 0:00:35
411000 -- (-583.282) [-584.276] (-588.961) (-585.791) * [-583.234] (-587.273) (-586.553) (-585.677) -- 0:00:35
411500 -- (-585.427) [-583.572] (-583.907) (-587.087) * [-585.262] (-586.373) (-586.251) (-585.877) -- 0:00:35
412000 -- (-584.021) (-586.639) [-582.881] (-585.494) * [-586.530] (-585.853) (-585.234) (-582.772) -- 0:00:35
412500 -- (-584.217) (-585.013) (-583.406) [-585.956] * (-589.784) [-583.655] (-584.918) (-583.799) -- 0:00:35
413000 -- (-586.336) [-585.579] (-586.528) (-586.251) * (-587.193) (-584.689) [-586.203] (-583.576) -- 0:00:35
413500 -- [-584.149] (-584.098) (-585.413) (-589.506) * (-583.056) [-583.792] (-593.079) (-583.196) -- 0:00:35
414000 -- [-584.659] (-587.281) (-586.428) (-584.755) * [-585.781] (-584.724) (-584.423) (-583.361) -- 0:00:35
414500 -- [-583.863] (-584.167) (-589.184) (-584.692) * [-584.507] (-584.629) (-584.912) (-587.964) -- 0:00:35
415000 -- (-583.882) [-586.791] (-585.577) (-586.297) * (-589.031) [-587.832] (-583.637) (-584.848) -- 0:00:35
Average standard deviation of split frequencies: 0.013265
415500 -- [-583.856] (-587.969) (-585.436) (-582.878) * [-585.202] (-583.908) (-584.300) (-583.035) -- 0:00:35
416000 -- (-588.144) [-588.034] (-585.709) (-584.162) * (-586.277) (-589.867) [-585.205] (-586.194) -- 0:00:35
416500 -- (-588.286) [-586.292] (-583.064) (-585.084) * (-585.544) (-586.269) [-585.738] (-583.458) -- 0:00:35
417000 -- [-589.161] (-585.831) (-583.663) (-590.530) * [-583.887] (-586.561) (-583.975) (-587.745) -- 0:00:34
417500 -- [-584.117] (-583.869) (-583.475) (-585.416) * (-584.415) (-585.041) (-583.817) [-585.221] -- 0:00:34
418000 -- (-583.985) [-583.596] (-583.326) (-585.062) * (-583.930) (-584.837) [-585.671] (-585.514) -- 0:00:34
418500 -- (-583.894) [-584.576] (-585.825) (-584.796) * (-583.848) (-584.983) [-584.590] (-585.575) -- 0:00:34
419000 -- (-588.223) (-585.324) [-584.686] (-584.194) * (-588.503) (-585.360) [-583.039] (-585.242) -- 0:00:34
419500 -- (-584.497) (-585.494) (-583.598) [-585.580] * (-588.196) [-584.730] (-584.627) (-584.073) -- 0:00:34
420000 -- (-588.503) [-583.431] (-583.704) (-584.723) * [-585.581] (-584.699) (-586.105) (-587.215) -- 0:00:34
Average standard deviation of split frequencies: 0.013136
420500 -- (-584.571) (-586.168) (-584.233) [-587.484] * (-584.164) (-585.406) [-586.572] (-588.254) -- 0:00:34
421000 -- (-587.445) [-584.620] (-588.107) (-588.859) * (-584.307) (-583.209) [-585.650] (-584.615) -- 0:00:34
421500 -- (-583.531) [-584.961] (-585.844) (-586.693) * [-586.663] (-584.172) (-584.811) (-587.162) -- 0:00:34
422000 -- (-583.612) [-584.584] (-583.911) (-583.674) * [-586.168] (-584.251) (-586.550) (-586.416) -- 0:00:34
422500 -- (-585.374) (-583.247) [-584.776] (-583.283) * (-585.433) (-586.334) (-584.351) [-584.480] -- 0:00:34
423000 -- (-584.643) (-584.335) (-583.908) [-583.531] * [-584.501] (-587.856) (-584.105) (-589.335) -- 0:00:34
423500 -- (-584.010) [-588.023] (-584.602) (-583.838) * [-587.772] (-585.643) (-583.851) (-587.622) -- 0:00:34
424000 -- (-584.740) (-585.713) [-583.888] (-584.646) * (-586.582) (-584.522) [-584.713] (-583.612) -- 0:00:33
424500 -- [-585.045] (-584.942) (-585.630) (-586.509) * (-584.596) (-583.460) [-584.543] (-585.606) -- 0:00:33
425000 -- (-583.109) [-585.701] (-586.958) (-588.168) * (-583.778) (-583.094) [-585.183] (-584.124) -- 0:00:33
Average standard deviation of split frequencies: 0.013771
425500 -- (-589.542) (-585.367) [-585.019] (-590.125) * [-584.794] (-585.084) (-585.476) (-584.216) -- 0:00:33
426000 -- (-583.972) (-583.354) (-586.494) [-588.040] * (-587.050) [-585.586] (-585.117) (-583.509) -- 0:00:33
426500 -- (-583.306) (-584.736) [-585.761] (-584.372) * (-584.737) [-583.631] (-589.600) (-584.434) -- 0:00:33
427000 -- (-586.779) (-585.626) (-585.616) [-583.181] * [-585.086] (-585.601) (-587.330) (-588.354) -- 0:00:34
427500 -- [-585.220] (-584.131) (-584.804) (-584.189) * (-589.792) [-584.542] (-586.759) (-584.096) -- 0:00:34
428000 -- (-584.378) [-589.662] (-584.433) (-587.171) * [-587.245] (-583.767) (-584.040) (-584.049) -- 0:00:34
428500 -- (-584.208) (-588.017) (-583.104) [-588.650] * (-585.054) (-585.857) [-583.930] (-584.421) -- 0:00:34
429000 -- (-586.619) (-585.755) [-587.131] (-587.338) * [-584.581] (-585.339) (-583.581) (-584.128) -- 0:00:34
429500 -- (-584.556) [-584.460] (-583.713) (-584.001) * [-583.524] (-584.738) (-584.262) (-592.234) -- 0:00:34
430000 -- (-584.938) [-587.146] (-587.253) (-585.117) * (-584.937) (-583.555) [-585.161] (-587.482) -- 0:00:34
Average standard deviation of split frequencies: 0.014595
430500 -- (-586.280) (-586.542) (-585.617) [-583.568] * [-584.038] (-583.235) (-588.032) (-585.587) -- 0:00:34
431000 -- (-590.413) (-587.177) [-583.646] (-584.138) * (-584.061) [-583.707] (-585.489) (-583.258) -- 0:00:34
431500 -- (-584.254) (-583.721) [-584.537] (-586.720) * [-583.986] (-584.397) (-590.386) (-589.670) -- 0:00:34
432000 -- [-583.588] (-584.000) (-585.918) (-583.251) * [-589.122] (-586.605) (-590.331) (-586.405) -- 0:00:34
432500 -- [-588.287] (-584.647) (-589.489) (-587.206) * [-582.849] (-586.089) (-586.160) (-583.882) -- 0:00:34
433000 -- (-583.709) (-585.674) [-585.645] (-585.684) * (-585.675) (-584.762) [-585.916] (-585.664) -- 0:00:34
433500 -- (-584.211) (-584.377) [-584.293] (-586.339) * (-583.416) (-585.704) [-589.584] (-584.019) -- 0:00:33
434000 -- (-584.760) [-584.885] (-584.024) (-585.429) * (-584.578) (-583.626) [-583.226] (-584.108) -- 0:00:33
434500 -- [-585.577] (-585.778) (-584.797) (-584.686) * (-585.824) (-583.891) (-584.318) [-584.666] -- 0:00:33
435000 -- (-584.807) [-584.713] (-590.060) (-586.940) * [-585.161] (-586.751) (-584.716) (-583.887) -- 0:00:33
Average standard deviation of split frequencies: 0.014716
435500 -- (-585.357) (-584.428) [-587.323] (-586.736) * [-584.955] (-587.287) (-587.907) (-583.607) -- 0:00:33
436000 -- (-583.045) (-589.051) [-583.131] (-585.275) * (-584.672) [-585.835] (-588.212) (-584.691) -- 0:00:33
436500 -- (-587.694) (-594.215) [-583.992] (-586.104) * (-584.526) (-587.852) [-586.252] (-583.945) -- 0:00:33
437000 -- (-585.483) [-584.995] (-584.958) (-584.074) * (-584.323) [-588.215] (-589.809) (-587.193) -- 0:00:33
437500 -- (-584.749) (-584.868) [-587.262] (-584.544) * (-586.135) (-584.535) (-585.314) [-583.548] -- 0:00:33
438000 -- (-585.038) (-584.875) [-584.544] (-585.186) * (-583.445) [-585.094] (-583.799) (-586.577) -- 0:00:33
438500 -- (-585.893) [-583.426] (-583.922) (-586.145) * (-583.185) [-583.696] (-585.918) (-588.500) -- 0:00:33
439000 -- (-584.133) (-585.206) [-584.581] (-584.943) * (-584.591) (-583.080) (-583.916) [-584.830] -- 0:00:33
439500 -- (-584.076) (-584.280) [-583.945] (-582.952) * (-587.889) (-582.843) (-583.857) [-583.732] -- 0:00:33
440000 -- [-585.041] (-584.230) (-584.901) (-583.647) * (-582.992) (-584.864) (-585.216) [-586.709] -- 0:00:33
Average standard deviation of split frequencies: 0.015795
440500 -- (-586.344) (-584.442) [-584.600] (-586.729) * (-582.950) [-584.569] (-587.266) (-583.293) -- 0:00:33
441000 -- (-589.528) (-587.882) [-587.841] (-588.968) * [-586.311] (-584.620) (-586.543) (-589.764) -- 0:00:32
441500 -- (-585.520) (-583.559) [-584.152] (-590.950) * (-587.767) (-586.962) (-584.162) [-583.265] -- 0:00:32
442000 -- [-586.632] (-584.123) (-583.425) (-584.134) * (-585.201) [-588.013] (-587.063) (-585.213) -- 0:00:32
442500 -- (-584.865) (-585.499) [-584.074] (-584.972) * (-583.335) (-586.444) [-585.813] (-585.352) -- 0:00:32
443000 -- (-585.610) (-587.036) (-582.943) [-587.208] * (-589.993) (-586.269) (-584.852) [-585.259] -- 0:00:32
443500 -- (-585.384) (-588.620) [-583.564] (-587.880) * (-583.298) (-585.167) [-583.912] (-582.895) -- 0:00:32
444000 -- (-584.702) [-585.755] (-583.555) (-588.520) * (-591.635) [-585.239] (-587.532) (-584.207) -- 0:00:33
444500 -- (-585.433) (-588.831) (-585.864) [-583.273] * [-584.137] (-583.828) (-585.186) (-583.219) -- 0:00:33
445000 -- (-585.779) [-585.712] (-586.063) (-584.088) * (-586.591) (-583.441) [-586.322] (-584.529) -- 0:00:33
Average standard deviation of split frequencies: 0.014856
445500 -- (-584.238) (-584.078) [-584.881] (-583.510) * (-584.605) [-584.161] (-586.353) (-584.127) -- 0:00:33
446000 -- (-584.017) [-584.257] (-584.949) (-584.252) * [-584.675] (-585.784) (-584.915) (-585.741) -- 0:00:33
446500 -- (-586.434) [-584.699] (-591.445) (-590.346) * (-584.255) (-586.661) [-583.979] (-583.702) -- 0:00:33
447000 -- (-584.752) [-587.879] (-586.678) (-588.708) * (-584.482) [-585.709] (-584.833) (-585.529) -- 0:00:33
447500 -- (-584.790) [-589.119] (-585.521) (-584.198) * (-583.737) (-585.991) (-586.904) [-584.593] -- 0:00:33
448000 -- (-584.228) [-586.962] (-584.836) (-585.262) * (-583.204) (-584.362) [-583.687] (-586.499) -- 0:00:33
448500 -- [-586.336] (-584.720) (-587.126) (-586.364) * (-583.760) (-583.500) [-585.679] (-586.878) -- 0:00:33
449000 -- (-584.904) (-587.105) [-586.818] (-588.606) * (-585.258) [-584.377] (-584.083) (-584.930) -- 0:00:33
449500 -- (-585.623) (-584.013) [-588.019] (-583.788) * (-583.535) [-585.567] (-587.769) (-586.345) -- 0:00:33
450000 -- (-584.817) [-584.296] (-588.086) (-585.561) * (-589.659) [-583.585] (-585.708) (-586.004) -- 0:00:33
Average standard deviation of split frequencies: 0.014829
450500 -- (-584.793) (-584.593) (-585.794) [-584.654] * [-583.966] (-583.943) (-586.652) (-583.715) -- 0:00:32
451000 -- (-585.213) [-587.497] (-584.032) (-586.618) * (-583.612) (-584.418) [-584.549] (-587.581) -- 0:00:32
451500 -- [-585.004] (-586.559) (-584.437) (-588.358) * (-583.634) (-584.285) [-583.908] (-584.411) -- 0:00:32
452000 -- (-585.544) (-585.491) [-584.178] (-583.488) * (-587.182) (-585.418) [-584.554] (-584.695) -- 0:00:32
452500 -- [-585.926] (-584.386) (-586.061) (-583.810) * (-587.889) [-584.782] (-583.274) (-583.629) -- 0:00:32
453000 -- (-583.609) (-584.155) [-586.597] (-586.961) * [-587.394] (-585.006) (-586.268) (-585.553) -- 0:00:32
453500 -- (-585.226) (-584.998) [-586.724] (-586.375) * (-587.443) (-585.205) [-587.282] (-585.638) -- 0:00:32
454000 -- (-587.956) (-584.290) [-583.424] (-586.788) * (-587.939) [-583.289] (-585.906) (-583.264) -- 0:00:32
454500 -- (-586.262) (-584.083) (-584.047) [-585.233] * (-585.094) [-585.620] (-584.394) (-584.780) -- 0:00:32
455000 -- (-583.680) (-584.322) (-583.641) [-582.847] * (-586.203) (-585.178) [-587.377] (-582.943) -- 0:00:32
Average standard deviation of split frequencies: 0.014534
455500 -- (-584.938) (-583.884) (-584.923) [-582.841] * [-584.108] (-584.820) (-583.869) (-586.564) -- 0:00:32
456000 -- [-586.693] (-584.212) (-587.597) (-585.906) * (-586.171) (-584.595) [-583.561] (-584.084) -- 0:00:32
456500 -- (-586.189) (-584.173) (-588.638) [-584.576] * (-588.837) (-585.968) (-583.876) [-583.739] -- 0:00:32
457000 -- (-586.874) (-583.859) (-585.035) [-583.283] * (-586.416) (-586.939) [-585.960] (-584.077) -- 0:00:32
457500 -- (-586.536) (-587.578) (-586.801) [-585.175] * (-584.003) [-584.785] (-585.295) (-586.075) -- 0:00:32
458000 -- (-584.793) (-591.310) (-585.974) [-583.496] * [-584.110] (-586.686) (-585.161) (-583.911) -- 0:00:31
458500 -- (-587.351) [-585.743] (-584.496) (-588.734) * (-584.240) (-585.418) [-583.413] (-586.492) -- 0:00:31
459000 -- (-586.633) [-588.572] (-586.845) (-586.345) * (-587.410) (-585.001) (-583.184) [-585.815] -- 0:00:31
459500 -- (-585.105) (-585.691) (-584.106) [-584.302] * (-583.586) [-586.774] (-583.903) (-589.588) -- 0:00:31
460000 -- (-584.442) [-586.400] (-589.132) (-584.535) * [-585.091] (-590.346) (-587.145) (-584.297) -- 0:00:31
Average standard deviation of split frequencies: 0.013664
460500 -- (-584.063) (-584.801) [-587.931] (-585.499) * (-584.592) (-584.952) [-585.375] (-583.252) -- 0:00:32
461000 -- (-583.794) (-584.091) (-586.994) [-585.185] * (-589.085) [-586.566] (-592.090) (-585.146) -- 0:00:32
461500 -- (-583.310) [-586.167] (-586.080) (-583.442) * (-585.294) (-585.042) [-584.082] (-584.167) -- 0:00:32
462000 -- (-591.580) (-585.994) [-585.613] (-584.147) * (-585.120) (-585.366) [-583.998] (-582.690) -- 0:00:32
462500 -- (-586.726) (-589.666) [-583.401] (-584.669) * [-583.513] (-583.753) (-585.447) (-585.689) -- 0:00:32
463000 -- (-585.849) (-587.463) [-583.742] (-591.774) * (-587.370) [-584.702] (-585.569) (-584.418) -- 0:00:32
463500 -- (-586.768) [-585.712] (-584.399) (-584.695) * (-584.378) [-583.281] (-583.523) (-583.563) -- 0:00:32
464000 -- (-585.191) [-588.110] (-585.928) (-582.941) * (-584.589) (-584.823) [-582.854] (-586.427) -- 0:00:32
464500 -- (-583.259) (-585.016) [-587.235] (-585.805) * (-587.665) (-583.191) (-587.187) [-583.550] -- 0:00:32
465000 -- [-586.775] (-586.356) (-585.858) (-585.450) * (-586.076) (-582.869) (-583.517) [-585.535] -- 0:00:32
Average standard deviation of split frequencies: 0.012645
465500 -- (-587.460) (-584.736) [-585.140] (-583.511) * (-583.497) [-589.980] (-583.823) (-586.943) -- 0:00:32
466000 -- (-591.339) (-584.332) [-584.895] (-584.839) * (-586.055) [-585.950] (-583.799) (-587.381) -- 0:00:32
466500 -- (-583.497) (-584.158) (-584.939) [-584.644] * (-586.135) (-583.968) [-583.312] (-587.270) -- 0:00:32
467000 -- [-585.400] (-585.311) (-586.014) (-587.982) * (-585.760) (-587.636) [-583.933] (-586.962) -- 0:00:31
467500 -- (-584.740) (-584.498) (-584.681) [-586.928] * (-589.610) [-586.053] (-584.059) (-586.199) -- 0:00:31
468000 -- (-584.060) (-586.294) [-588.313] (-590.306) * (-588.127) [-585.251] (-583.472) (-586.531) -- 0:00:31
468500 -- (-583.889) (-589.914) [-586.520] (-583.532) * (-588.080) (-585.488) [-584.366] (-586.138) -- 0:00:31
469000 -- (-583.253) (-585.716) (-586.734) [-584.523] * (-588.263) (-585.959) [-583.270] (-584.520) -- 0:00:31
469500 -- (-584.462) (-583.762) [-587.304] (-584.647) * (-584.725) (-586.332) [-584.371] (-583.140) -- 0:00:31
470000 -- (-583.923) (-585.155) [-584.791] (-584.079) * (-583.348) [-585.090] (-585.818) (-585.974) -- 0:00:31
Average standard deviation of split frequencies: 0.012078
470500 -- (-585.360) [-589.248] (-587.269) (-583.467) * (-584.640) (-583.777) (-584.755) [-587.036] -- 0:00:31
471000 -- (-587.033) (-584.565) (-583.529) [-586.982] * (-585.243) [-584.615] (-584.428) (-587.860) -- 0:00:31
471500 -- (-584.512) (-585.701) [-583.057] (-586.480) * [-584.825] (-585.343) (-583.343) (-586.710) -- 0:00:31
472000 -- (-582.996) (-583.248) (-585.896) [-584.721] * (-587.526) [-586.017] (-586.217) (-583.842) -- 0:00:31
472500 -- (-584.994) (-585.041) (-584.756) [-584.475] * (-588.350) (-589.168) [-586.317] (-590.380) -- 0:00:31
473000 -- [-583.117] (-587.085) (-586.623) (-586.647) * (-585.586) (-590.048) [-584.252] (-586.950) -- 0:00:31
473500 -- (-584.110) [-587.625] (-583.738) (-584.612) * [-582.966] (-586.830) (-586.087) (-584.073) -- 0:00:31
474000 -- (-583.612) (-586.851) (-586.246) [-585.846] * (-586.593) (-587.758) (-586.639) [-583.828] -- 0:00:31
474500 -- (-585.332) (-589.302) (-591.767) [-583.009] * (-585.146) (-586.552) (-583.224) [-584.916] -- 0:00:31
475000 -- (-584.951) (-587.317) (-584.460) [-582.872] * (-584.504) [-589.728] (-585.777) (-587.391) -- 0:00:30
Average standard deviation of split frequencies: 0.011593
475500 -- [-584.761] (-583.510) (-585.267) (-586.888) * [-586.055] (-586.693) (-584.899) (-585.932) -- 0:00:30
476000 -- (-586.454) (-583.330) (-587.199) [-583.206] * (-587.264) [-583.884] (-584.895) (-585.991) -- 0:00:30
476500 -- (-586.091) [-583.523] (-583.970) (-583.955) * (-588.386) (-584.146) (-585.346) [-583.886] -- 0:00:30
477000 -- [-584.641] (-587.114) (-586.208) (-584.182) * (-583.163) (-585.317) (-583.474) [-584.196] -- 0:00:30
477500 -- (-585.848) (-586.602) [-583.531] (-586.934) * (-584.520) [-585.325] (-583.416) (-588.382) -- 0:00:31
478000 -- (-585.124) [-583.322] (-583.195) (-588.356) * (-585.037) [-585.327] (-583.561) (-590.031) -- 0:00:31
478500 -- (-584.310) [-583.273] (-583.502) (-585.259) * (-584.922) [-586.417] (-587.082) (-589.262) -- 0:00:31
479000 -- (-583.814) [-584.570] (-582.942) (-583.588) * [-583.116] (-589.686) (-586.988) (-586.312) -- 0:00:31
479500 -- (-584.847) [-584.331] (-582.783) (-583.234) * (-583.210) (-588.681) (-589.622) [-585.510] -- 0:00:31
480000 -- (-586.293) [-583.490] (-583.043) (-590.368) * (-584.770) (-583.760) (-584.540) [-585.595] -- 0:00:31
Average standard deviation of split frequencies: 0.011033
480500 -- (-584.092) [-583.489] (-591.483) (-588.112) * (-585.681) (-586.677) (-584.008) [-584.698] -- 0:00:31
481000 -- [-584.494] (-585.410) (-583.681) (-585.752) * [-587.041] (-586.068) (-584.852) (-584.997) -- 0:00:31
481500 -- (-584.416) [-583.957] (-583.681) (-584.128) * [-583.923] (-586.119) (-583.861) (-586.264) -- 0:00:31
482000 -- (-584.577) (-587.962) [-584.179] (-584.771) * (-590.140) (-585.266) (-588.742) [-585.037] -- 0:00:31
482500 -- (-587.181) (-586.904) (-585.787) [-587.100] * (-585.112) (-586.845) [-586.516] (-586.742) -- 0:00:31
483000 -- (-585.711) [-583.698] (-588.968) (-585.039) * (-588.016) [-589.098] (-586.339) (-589.906) -- 0:00:31
483500 -- [-585.546] (-596.781) (-584.408) (-586.027) * (-583.123) (-585.029) [-587.211] (-585.015) -- 0:00:30
484000 -- [-585.985] (-587.145) (-584.590) (-583.869) * (-585.717) (-587.456) [-584.734] (-584.470) -- 0:00:30
484500 -- (-587.211) (-583.976) [-583.337] (-584.082) * (-585.414) (-583.786) [-585.715] (-584.890) -- 0:00:30
485000 -- (-586.201) [-584.733] (-589.106) (-586.912) * (-583.596) (-584.185) (-585.972) [-584.517] -- 0:00:30
Average standard deviation of split frequencies: 0.011518
485500 -- (-584.978) (-585.526) (-586.173) [-585.828] * (-585.910) [-584.201] (-585.679) (-583.249) -- 0:00:30
486000 -- (-587.627) (-585.753) (-584.442) [-583.051] * [-583.676] (-583.598) (-584.457) (-586.476) -- 0:00:30
486500 -- (-584.948) (-586.766) [-584.105] (-583.477) * (-585.606) (-583.313) (-586.147) [-586.803] -- 0:00:30
487000 -- (-583.481) (-585.633) [-583.933] (-588.933) * [-585.078] (-583.313) (-587.635) (-583.670) -- 0:00:30
487500 -- [-584.671] (-585.841) (-584.529) (-583.791) * (-585.793) (-583.214) (-586.265) [-586.051] -- 0:00:30
488000 -- (-585.038) [-586.430] (-590.664) (-586.591) * (-584.775) (-583.458) (-586.134) [-585.356] -- 0:00:30
488500 -- [-584.203] (-583.235) (-584.402) (-586.723) * (-585.060) [-583.511] (-584.293) (-586.257) -- 0:00:30
489000 -- (-586.120) (-582.969) [-583.593] (-585.209) * [-583.660] (-583.328) (-583.298) (-584.527) -- 0:00:30
489500 -- (-588.509) (-586.143) (-588.166) [-584.876] * (-583.855) [-582.927] (-583.805) (-586.570) -- 0:00:30
490000 -- [-584.506] (-586.571) (-583.605) (-584.314) * (-586.980) (-585.516) (-585.608) [-584.386] -- 0:00:30
Average standard deviation of split frequencies: 0.010568
490500 -- (-585.075) (-587.870) (-585.037) [-584.035] * (-587.356) (-585.469) [-584.569] (-584.751) -- 0:00:30
491000 -- [-587.144] (-586.746) (-585.889) (-584.984) * (-584.621) (-586.099) (-591.699) [-584.414] -- 0:00:30
491500 -- (-583.816) (-585.256) [-584.352] (-585.781) * [-584.283] (-583.777) (-586.540) (-584.182) -- 0:00:30
492000 -- (-586.272) (-585.797) [-585.975] (-585.299) * [-587.576] (-587.914) (-590.993) (-583.788) -- 0:00:29
492500 -- (-583.575) (-582.919) (-589.722) [-586.274] * [-589.904] (-584.794) (-588.402) (-585.157) -- 0:00:29
493000 -- (-584.075) (-583.272) (-590.081) [-584.370] * (-583.624) (-583.528) (-584.633) [-585.892] -- 0:00:29
493500 -- (-584.770) (-585.561) (-587.805) [-583.322] * (-590.494) [-583.826] (-583.543) (-584.861) -- 0:00:29
494000 -- (-588.364) (-585.560) (-586.208) [-583.634] * (-585.032) (-583.898) [-583.351] (-584.727) -- 0:00:29
494500 -- (-587.310) (-585.054) [-585.106] (-585.376) * (-588.606) (-585.728) (-583.334) [-588.926] -- 0:00:30
495000 -- [-590.425] (-584.834) (-586.617) (-588.885) * (-583.516) (-585.995) [-585.600] (-586.285) -- 0:00:30
Average standard deviation of split frequencies: 0.010518
495500 -- [-586.290] (-584.252) (-587.079) (-587.119) * (-583.738) [-583.865] (-583.815) (-586.455) -- 0:00:30
496000 -- (-584.294) (-585.927) (-587.405) [-584.977] * (-587.817) (-586.466) [-583.791] (-585.281) -- 0:00:30
496500 -- (-586.396) (-587.545) [-584.924] (-585.378) * (-585.019) [-585.986] (-586.991) (-585.614) -- 0:00:30
497000 -- [-585.649] (-586.945) (-583.592) (-584.264) * (-584.619) [-584.014] (-586.419) (-587.823) -- 0:00:30
497500 -- (-585.123) [-583.375] (-584.537) (-585.641) * (-586.918) [-584.172] (-586.218) (-584.340) -- 0:00:30
498000 -- (-584.343) (-584.603) [-587.113] (-585.304) * [-583.490] (-586.149) (-583.459) (-583.243) -- 0:00:30
498500 -- (-585.228) [-583.094] (-586.538) (-586.424) * (-585.395) [-583.580] (-586.467) (-583.647) -- 0:00:30
499000 -- (-586.305) [-585.256] (-585.433) (-583.411) * (-586.536) (-585.121) (-590.841) [-584.471] -- 0:00:30
499500 -- (-589.161) (-585.561) (-584.904) [-587.146] * [-585.310] (-585.495) (-587.215) (-588.598) -- 0:00:30
500000 -- (-584.105) (-584.526) (-586.917) [-586.327] * (-583.246) (-583.915) (-588.051) [-584.671] -- 0:00:30
Average standard deviation of split frequencies: 0.009980
500500 -- (-585.700) [-584.445] (-583.129) (-584.462) * [-583.818] (-587.152) (-584.288) (-585.765) -- 0:00:29
501000 -- (-586.074) [-585.354] (-583.907) (-585.158) * [-585.112] (-583.540) (-588.909) (-585.709) -- 0:00:29
501500 -- (-586.488) (-587.618) [-584.343] (-588.001) * [-585.657] (-583.549) (-584.629) (-584.671) -- 0:00:29
502000 -- (-583.293) [-585.277] (-584.709) (-586.509) * [-585.298] (-583.654) (-588.465) (-583.586) -- 0:00:29
502500 -- (-584.692) (-592.198) (-585.148) [-585.490] * [-584.897] (-583.854) (-588.069) (-586.013) -- 0:00:29
503000 -- (-586.847) (-587.407) [-584.078] (-586.964) * (-594.935) [-584.152] (-589.812) (-585.496) -- 0:00:29
503500 -- (-585.697) (-585.036) [-583.971] (-583.040) * (-587.804) [-586.155] (-584.714) (-584.029) -- 0:00:29
504000 -- (-586.213) (-585.515) (-586.882) [-584.772] * (-583.973) [-584.130] (-584.082) (-583.694) -- 0:00:29
504500 -- (-585.104) (-585.597) [-582.950] (-587.994) * [-583.702] (-585.031) (-585.814) (-584.645) -- 0:00:29
505000 -- (-584.547) [-584.514] (-583.633) (-584.803) * (-583.517) (-584.292) [-587.040] (-583.818) -- 0:00:29
Average standard deviation of split frequencies: 0.009083
505500 -- (-583.050) (-588.587) [-587.245] (-584.605) * (-586.696) (-583.894) [-586.855] (-583.978) -- 0:00:29
506000 -- (-583.195) (-586.067) [-584.816] (-584.163) * [-586.800] (-586.836) (-584.370) (-585.167) -- 0:00:29
506500 -- (-583.372) [-586.979] (-584.518) (-586.053) * (-583.327) [-583.572] (-586.117) (-584.162) -- 0:00:29
507000 -- (-584.901) (-583.941) (-585.020) [-584.743] * [-587.133] (-583.671) (-584.344) (-584.884) -- 0:00:29
507500 -- (-587.815) (-584.795) (-587.209) [-582.901] * (-584.234) [-585.518] (-586.565) (-583.841) -- 0:00:29
508000 -- (-587.085) (-584.692) (-587.054) [-583.522] * (-585.154) (-585.763) [-583.894] (-584.164) -- 0:00:29
508500 -- (-589.128) (-582.834) [-583.863] (-585.388) * (-583.019) (-584.453) [-583.326] (-584.422) -- 0:00:28
509000 -- (-586.355) (-584.612) [-584.477] (-585.879) * (-584.687) [-582.963] (-583.837) (-594.773) -- 0:00:28
509500 -- (-589.752) (-584.162) (-584.639) [-587.998] * (-584.040) (-585.388) (-585.632) [-586.723] -- 0:00:28
510000 -- (-585.332) (-586.345) [-588.050] (-586.831) * [-585.612] (-583.357) (-585.663) (-585.356) -- 0:00:28
Average standard deviation of split frequencies: 0.010277
510500 -- (-583.715) [-585.091] (-583.483) (-585.013) * (-583.950) [-585.292] (-589.995) (-587.198) -- 0:00:28
511000 -- (-586.845) (-583.672) [-584.409] (-585.917) * (-588.376) (-585.703) [-588.237] (-583.851) -- 0:00:29
511500 -- (-585.365) [-586.541] (-586.872) (-587.180) * (-588.395) (-589.032) [-586.688] (-589.238) -- 0:00:29
512000 -- [-584.165] (-585.893) (-585.397) (-584.312) * (-585.410) (-589.997) [-587.481] (-584.560) -- 0:00:29
512500 -- [-586.540] (-589.060) (-585.176) (-584.211) * [-586.349] (-590.948) (-585.600) (-584.071) -- 0:00:29
513000 -- [-585.479] (-587.165) (-590.982) (-585.852) * (-586.061) (-588.629) (-585.508) [-585.497] -- 0:00:29
513500 -- (-586.549) (-583.011) [-587.711] (-585.128) * (-585.928) (-586.763) [-586.771] (-586.211) -- 0:00:29
514000 -- (-585.297) [-584.525] (-587.059) (-587.819) * (-584.871) (-585.225) [-586.750] (-583.902) -- 0:00:29
514500 -- (-583.637) (-584.188) (-583.837) [-583.560] * (-587.179) (-583.525) (-584.345) [-588.241] -- 0:00:29
515000 -- (-584.113) (-584.935) [-584.146] (-583.995) * (-586.220) (-584.061) (-582.932) [-587.114] -- 0:00:29
Average standard deviation of split frequencies: 0.010049
515500 -- (-585.644) [-587.855] (-586.403) (-584.109) * (-583.125) (-583.291) [-583.117] (-588.819) -- 0:00:29
516000 -- (-585.460) (-584.969) (-585.793) [-585.571] * (-584.690) (-584.076) [-586.520] (-584.510) -- 0:00:29
516500 -- (-583.209) (-584.834) (-586.597) [-583.400] * (-586.119) (-584.351) (-584.592) [-583.609] -- 0:00:29
517000 -- (-586.445) (-585.805) [-583.941] (-584.271) * (-583.997) (-584.551) [-584.088] (-582.954) -- 0:00:28
517500 -- (-584.717) [-586.779] (-582.930) (-585.858) * [-584.990] (-584.708) (-584.147) (-586.584) -- 0:00:28
518000 -- (-585.762) [-584.362] (-583.819) (-588.577) * (-586.343) [-584.629] (-586.023) (-587.868) -- 0:00:28
518500 -- (-584.398) (-585.525) (-587.518) [-585.652] * (-584.436) [-585.058] (-588.559) (-585.057) -- 0:00:28
519000 -- [-583.581] (-584.681) (-584.884) (-584.111) * (-589.376) (-586.279) (-585.815) [-583.609] -- 0:00:28
519500 -- (-584.600) (-583.671) (-585.721) [-585.416] * (-590.389) (-583.700) (-587.879) [-586.549] -- 0:00:28
520000 -- (-583.899) (-587.031) [-585.774] (-586.920) * (-583.948) [-584.547] (-583.055) (-590.125) -- 0:00:28
Average standard deviation of split frequencies: 0.010525
520500 -- [-583.000] (-583.868) (-587.433) (-586.794) * (-583.304) (-586.137) [-582.952] (-588.059) -- 0:00:28
521000 -- (-588.025) (-584.363) (-585.566) [-584.002] * [-583.676] (-586.739) (-582.733) (-583.790) -- 0:00:28
521500 -- [-586.106] (-585.315) (-583.960) (-584.574) * (-584.102) (-584.202) (-583.437) [-584.163] -- 0:00:28
522000 -- [-584.491] (-584.021) (-584.858) (-583.283) * [-583.784] (-584.822) (-588.436) (-588.263) -- 0:00:28
522500 -- (-583.633) (-583.406) [-584.189] (-590.543) * (-588.603) (-585.338) (-588.306) [-588.371] -- 0:00:28
523000 -- [-583.843] (-584.252) (-585.864) (-584.111) * [-586.865] (-583.911) (-585.821) (-584.618) -- 0:00:28
523500 -- (-583.718) (-583.443) (-585.231) [-583.191] * (-587.355) [-584.740] (-586.651) (-587.939) -- 0:00:28
524000 -- (-585.573) [-583.529] (-596.441) (-585.554) * (-585.259) [-584.498] (-584.855) (-589.197) -- 0:00:28
524500 -- [-583.563] (-585.717) (-583.759) (-582.939) * [-586.799] (-583.961) (-587.615) (-585.801) -- 0:00:28
525000 -- [-586.072] (-584.703) (-583.614) (-588.391) * (-585.080) (-585.451) (-584.103) [-585.301] -- 0:00:28
Average standard deviation of split frequencies: 0.010026
525500 -- (-586.591) (-583.032) [-585.981] (-583.905) * [-585.325] (-585.108) (-586.319) (-583.362) -- 0:00:27
526000 -- (-585.107) (-585.385) (-586.965) [-588.080] * [-584.614] (-586.006) (-586.336) (-584.218) -- 0:00:27
526500 -- (-584.771) [-584.843] (-587.693) (-584.836) * (-584.937) (-585.161) [-586.304] (-583.583) -- 0:00:28
527000 -- (-584.245) (-589.044) [-583.502] (-583.085) * (-586.424) [-583.867] (-588.168) (-586.281) -- 0:00:28
527500 -- (-583.380) (-585.960) (-584.785) [-586.664] * [-585.546] (-583.607) (-584.598) (-584.998) -- 0:00:28
528000 -- (-583.693) [-583.991] (-584.763) (-585.700) * [-584.492] (-583.931) (-587.206) (-584.511) -- 0:00:28
528500 -- (-585.273) (-586.384) (-583.884) [-586.196] * (-583.654) (-588.356) [-591.703] (-584.256) -- 0:00:28
529000 -- (-589.681) (-584.621) [-586.132] (-583.428) * [-583.285] (-584.905) (-588.926) (-583.098) -- 0:00:28
529500 -- (-589.139) [-584.722] (-584.152) (-586.668) * (-588.652) (-584.286) [-584.027] (-585.628) -- 0:00:28
530000 -- (-586.482) (-584.806) [-584.289] (-585.614) * (-588.713) (-585.712) [-586.089] (-586.483) -- 0:00:28
Average standard deviation of split frequencies: 0.009327
530500 -- (-583.592) [-587.982] (-584.821) (-583.504) * (-587.072) (-586.887) (-583.650) [-584.570] -- 0:00:28
531000 -- (-587.406) (-589.540) (-584.971) [-587.340] * (-584.877) (-584.615) [-587.268] (-587.367) -- 0:00:28
531500 -- (-587.186) (-587.466) (-587.412) [-584.182] * [-585.411] (-589.602) (-587.690) (-587.004) -- 0:00:28
532000 -- (-589.338) (-585.701) (-587.297) [-584.018] * (-586.976) (-586.573) [-583.915] (-590.502) -- 0:00:28
532500 -- (-584.019) [-584.147] (-584.767) (-587.185) * (-588.373) [-584.817] (-586.245) (-583.354) -- 0:00:28
533000 -- (-583.892) [-585.897] (-584.155) (-587.153) * [-585.744] (-585.302) (-584.035) (-584.132) -- 0:00:28
533500 -- [-585.347] (-587.963) (-587.967) (-583.771) * (-585.440) (-587.511) (-589.082) [-582.853] -- 0:00:27
534000 -- (-585.328) (-584.863) [-583.775] (-588.758) * (-586.427) (-586.909) (-587.524) [-588.316] -- 0:00:27
534500 -- (-584.624) (-586.014) (-584.280) [-582.924] * [-587.273] (-588.612) (-588.460) (-584.788) -- 0:00:27
535000 -- [-583.527] (-584.946) (-584.854) (-584.514) * (-589.279) (-587.871) [-582.889] (-586.422) -- 0:00:27
Average standard deviation of split frequencies: 0.009235
535500 -- (-584.975) [-585.792] (-588.506) (-583.959) * (-584.992) [-583.408] (-583.525) (-584.066) -- 0:00:27
536000 -- (-583.134) (-583.521) [-585.913] (-585.619) * (-587.317) [-585.416] (-584.130) (-587.078) -- 0:00:27
536500 -- (-585.224) [-583.180] (-584.524) (-586.383) * (-585.715) (-586.607) (-584.690) [-583.869] -- 0:00:27
537000 -- (-584.469) (-588.319) (-583.601) [-583.585] * (-584.460) (-584.702) [-586.858] (-586.348) -- 0:00:27
537500 -- (-590.631) (-585.074) [-589.011] (-583.615) * (-587.388) [-584.514] (-586.584) (-583.762) -- 0:00:27
538000 -- (-588.769) (-588.931) [-585.890] (-588.392) * (-583.153) (-584.542) [-584.045] (-585.785) -- 0:00:27
538500 -- (-584.866) [-584.821] (-583.360) (-588.472) * [-582.908] (-593.033) (-584.455) (-583.932) -- 0:00:27
539000 -- (-583.412) (-588.591) (-585.344) [-590.629] * (-582.845) [-585.748] (-590.758) (-585.419) -- 0:00:27
539500 -- (-584.370) [-585.075] (-584.691) (-586.803) * (-583.444) (-589.042) (-587.285) [-584.173] -- 0:00:27
540000 -- [-584.589] (-585.374) (-585.738) (-585.840) * [-583.872] (-584.696) (-584.592) (-583.646) -- 0:00:27
Average standard deviation of split frequencies: 0.008882
540500 -- (-585.163) [-585.165] (-584.958) (-588.153) * (-583.556) [-584.506] (-586.551) (-584.697) -- 0:00:27
541000 -- [-584.237] (-585.072) (-586.366) (-583.080) * (-591.637) [-589.242] (-587.198) (-584.187) -- 0:00:27
541500 -- (-590.350) [-584.926] (-584.611) (-585.319) * (-583.414) [-586.129] (-585.519) (-583.776) -- 0:00:27
542000 -- (-583.377) [-583.428] (-584.432) (-584.506) * (-584.948) [-584.371] (-585.198) (-585.973) -- 0:00:27
542500 -- (-584.305) [-583.228] (-588.544) (-585.303) * (-585.974) (-590.228) [-586.533] (-583.709) -- 0:00:27
543000 -- (-585.414) [-587.865] (-588.431) (-584.063) * [-585.884] (-583.210) (-585.023) (-587.517) -- 0:00:27
543500 -- [-583.104] (-585.205) (-585.704) (-583.330) * [-584.484] (-585.332) (-585.425) (-585.968) -- 0:00:27
544000 -- (-586.707) [-585.021] (-587.582) (-584.975) * (-584.007) [-584.705] (-584.292) (-584.347) -- 0:00:27
544500 -- [-584.821] (-584.224) (-587.774) (-586.825) * (-584.581) (-584.441) (-583.482) [-586.117] -- 0:00:27
545000 -- (-583.597) (-587.245) (-586.786) [-586.849] * [-584.299] (-583.106) (-584.442) (-585.363) -- 0:00:27
Average standard deviation of split frequencies: 0.009335
545500 -- [-586.301] (-586.390) (-587.292) (-583.052) * (-584.578) [-583.224] (-583.212) (-584.609) -- 0:00:27
546000 -- (-587.480) [-583.247] (-584.827) (-584.146) * (-585.315) (-583.180) (-589.485) [-584.358] -- 0:00:27
546500 -- (-583.582) [-586.702] (-585.466) (-586.314) * [-587.459] (-584.414) (-587.912) (-586.659) -- 0:00:27
547000 -- (-584.276) (-583.379) (-585.309) [-584.250] * (-584.366) [-585.388] (-586.217) (-586.392) -- 0:00:27
547500 -- (-588.441) (-584.215) [-586.594] (-583.002) * [-587.370] (-586.215) (-587.177) (-585.437) -- 0:00:27
548000 -- (-583.291) (-584.202) (-585.379) [-585.239] * (-584.589) [-584.601] (-587.507) (-583.490) -- 0:00:27
548500 -- [-584.721] (-593.043) (-584.122) (-585.825) * (-585.464) [-586.433] (-584.624) (-584.558) -- 0:00:27
549000 -- (-583.983) (-585.830) (-583.966) [-583.648] * (-584.417) (-584.185) [-585.480] (-583.544) -- 0:00:27
549500 -- (-584.762) (-587.640) [-583.263] (-583.852) * [-584.178] (-585.460) (-586.778) (-588.166) -- 0:00:27
550000 -- [-582.992] (-583.317) (-587.337) (-583.307) * (-585.507) [-584.195] (-584.804) (-590.476) -- 0:00:27
Average standard deviation of split frequencies: 0.009310
550500 -- [-586.336] (-587.402) (-584.150) (-585.338) * (-585.709) (-583.462) (-585.077) [-583.717] -- 0:00:26
551000 -- (-586.220) (-587.522) [-584.388] (-583.915) * (-584.366) (-585.487) (-586.668) [-584.143] -- 0:00:26
551500 -- (-583.451) (-587.608) [-584.894] (-586.667) * (-583.941) (-583.196) (-585.686) [-585.206] -- 0:00:26
552000 -- (-583.631) (-589.811) [-586.026] (-585.116) * [-585.460] (-583.406) (-584.490) (-584.101) -- 0:00:26
552500 -- (-584.326) (-586.502) [-584.314] (-585.958) * [-584.978] (-587.673) (-589.277) (-587.353) -- 0:00:26
553000 -- [-583.844] (-584.156) (-585.026) (-585.308) * (-586.452) [-586.848] (-585.386) (-587.108) -- 0:00:26
553500 -- (-586.795) (-583.788) (-584.450) [-583.196] * [-585.536] (-585.193) (-585.303) (-586.263) -- 0:00:26
554000 -- (-584.234) [-584.970] (-587.970) (-584.024) * (-584.762) [-585.911] (-584.736) (-583.643) -- 0:00:26
554500 -- [-584.198] (-587.651) (-584.485) (-584.044) * (-583.295) (-591.135) (-584.680) [-584.393] -- 0:00:26
555000 -- [-588.364] (-585.246) (-584.527) (-584.618) * [-583.717] (-585.511) (-587.688) (-584.528) -- 0:00:26
Average standard deviation of split frequencies: 0.009485
555500 -- [-587.438] (-583.175) (-587.725) (-584.319) * (-587.295) (-583.525) [-584.749] (-584.017) -- 0:00:26
556000 -- [-583.759] (-586.148) (-584.165) (-585.495) * [-585.340] (-583.769) (-583.887) (-584.901) -- 0:00:26
556500 -- (-585.635) [-583.725] (-584.024) (-585.616) * (-586.393) (-584.469) [-583.879] (-586.570) -- 0:00:26
557000 -- (-588.397) (-586.430) (-590.777) [-583.095] * (-584.367) (-586.665) (-584.663) [-587.865] -- 0:00:26
557500 -- [-586.776] (-588.355) (-585.626) (-585.572) * [-583.082] (-590.109) (-585.660) (-586.680) -- 0:00:26
558000 -- (-585.399) [-583.369] (-584.867) (-587.182) * [-585.431] (-590.232) (-585.079) (-586.433) -- 0:00:26
558500 -- (-585.307) [-583.361] (-594.169) (-587.068) * (-583.492) (-584.711) [-583.959] (-584.876) -- 0:00:26
559000 -- (-583.551) (-588.898) (-591.902) [-584.534] * [-585.675] (-584.977) (-584.274) (-587.256) -- 0:00:26
559500 -- [-584.925] (-586.869) (-585.982) (-586.234) * [-583.764] (-584.793) (-583.711) (-583.819) -- 0:00:26
560000 -- (-587.999) [-584.488] (-585.506) (-586.286) * [-584.085] (-585.813) (-588.750) (-586.323) -- 0:00:26
Average standard deviation of split frequencies: 0.009722
560500 -- (-585.202) (-586.006) [-585.620] (-583.856) * [-586.030] (-584.061) (-584.234) (-583.990) -- 0:00:26
561000 -- (-584.679) (-587.386) (-585.046) [-583.175] * [-587.353] (-583.841) (-585.308) (-583.068) -- 0:00:26
561500 -- (-589.192) [-585.404] (-586.108) (-584.610) * (-587.026) [-583.461] (-585.316) (-585.305) -- 0:00:26
562000 -- (-584.037) [-584.573] (-585.239) (-584.194) * (-584.948) [-585.174] (-585.380) (-585.643) -- 0:00:26
562500 -- [-583.006] (-586.867) (-585.466) (-587.806) * (-583.499) [-586.002] (-584.454) (-586.827) -- 0:00:26
563000 -- (-585.730) (-588.361) (-588.212) [-586.649] * (-586.583) (-583.183) [-584.766] (-584.345) -- 0:00:26
563500 -- (-584.507) [-583.931] (-584.393) (-587.674) * (-584.325) (-585.091) (-584.528) [-588.727] -- 0:00:26
564000 -- [-584.283] (-583.110) (-583.582) (-587.457) * (-584.686) (-583.650) (-585.162) [-584.539] -- 0:00:26
564500 -- [-586.011] (-583.519) (-583.716) (-588.387) * [-586.418] (-584.632) (-583.056) (-584.451) -- 0:00:26
565000 -- (-585.030) (-584.514) (-591.694) [-586.802] * (-587.139) [-586.600] (-587.188) (-582.777) -- 0:00:26
Average standard deviation of split frequencies: 0.009786
565500 -- (-585.077) [-583.273] (-588.339) (-585.534) * [-584.278] (-587.870) (-584.578) (-582.891) -- 0:00:26
566000 -- [-584.162] (-582.937) (-590.680) (-585.314) * (-584.263) (-585.986) (-584.285) [-582.891] -- 0:00:26
566500 -- (-584.912) [-586.362] (-585.454) (-585.372) * (-585.756) (-585.399) (-585.396) [-588.314] -- 0:00:26
567000 -- [-583.628] (-588.573) (-582.878) (-584.478) * (-587.412) (-583.452) [-585.311] (-584.776) -- 0:00:25
567500 -- (-584.447) [-587.001] (-582.778) (-585.536) * [-585.328] (-583.407) (-587.473) (-584.935) -- 0:00:25
568000 -- [-583.272] (-586.333) (-584.678) (-584.275) * (-584.862) (-583.055) [-585.497] (-585.937) -- 0:00:25
568500 -- (-584.830) (-585.004) [-584.713] (-588.075) * (-587.895) [-586.702] (-584.788) (-588.493) -- 0:00:25
569000 -- [-584.118] (-585.022) (-587.447) (-585.728) * (-586.919) (-583.078) (-582.935) [-584.075] -- 0:00:25
569500 -- (-583.877) (-585.094) [-584.976] (-585.258) * [-584.724] (-584.467) (-587.674) (-585.065) -- 0:00:25
570000 -- (-587.547) (-584.629) [-587.536] (-586.367) * (-583.332) (-586.167) [-585.559] (-588.074) -- 0:00:25
Average standard deviation of split frequencies: 0.010377
570500 -- (-584.110) (-583.867) [-583.813] (-583.650) * (-585.834) (-586.219) (-586.282) [-584.561] -- 0:00:25
571000 -- (-587.973) (-584.958) [-583.649] (-583.915) * (-585.817) [-585.828] (-585.968) (-585.517) -- 0:00:25
571500 -- (-588.287) (-587.877) [-584.442] (-582.751) * (-586.278) (-585.737) (-587.401) [-583.435] -- 0:00:25
572000 -- (-585.441) (-584.290) [-585.986] (-584.141) * (-590.160) (-586.305) (-584.921) [-584.598] -- 0:00:25
572500 -- [-583.964] (-583.625) (-585.502) (-585.581) * (-589.228) [-583.938] (-584.443) (-585.511) -- 0:00:25
573000 -- [-585.091] (-584.708) (-585.776) (-584.626) * [-585.209] (-586.878) (-584.851) (-584.069) -- 0:00:25
573500 -- [-584.683] (-585.372) (-587.321) (-586.272) * (-585.217) [-584.494] (-584.484) (-584.035) -- 0:00:25
574000 -- (-584.416) (-584.559) [-586.647] (-585.069) * (-585.423) (-584.276) [-584.622] (-588.654) -- 0:00:25
574500 -- (-584.386) (-590.281) [-583.264] (-587.169) * (-586.594) (-584.873) (-585.064) [-584.224] -- 0:00:25
575000 -- [-584.733] (-591.593) (-583.982) (-584.445) * (-583.481) (-588.860) [-586.702] (-583.564) -- 0:00:25
Average standard deviation of split frequencies: 0.009821
575500 -- (-585.288) (-584.676) (-585.113) [-583.462] * (-586.074) (-587.691) [-584.303] (-585.772) -- 0:00:25
576000 -- (-584.451) (-585.444) (-584.655) [-583.492] * (-586.438) (-584.340) [-583.788] (-584.919) -- 0:00:25
576500 -- [-584.018] (-584.554) (-583.838) (-583.546) * [-584.331] (-587.387) (-583.639) (-583.921) -- 0:00:25
577000 -- (-584.972) [-587.464] (-585.039) (-590.612) * [-584.017] (-594.937) (-586.987) (-583.973) -- 0:00:25
577500 -- (-587.200) (-586.130) (-584.578) [-588.403] * [-583.484] (-584.865) (-584.939) (-584.654) -- 0:00:25
578000 -- (-589.362) (-585.834) [-584.675] (-587.662) * [-585.173] (-586.802) (-585.872) (-584.335) -- 0:00:25
578500 -- (-592.860) (-585.591) [-587.988] (-585.708) * (-584.002) (-585.995) (-585.221) [-586.092] -- 0:00:25
579000 -- (-585.568) [-585.463] (-585.499) (-590.596) * [-587.368] (-586.257) (-590.973) (-584.238) -- 0:00:25
579500 -- [-584.205] (-584.702) (-583.932) (-589.443) * (-586.040) (-583.730) (-583.895) [-585.442] -- 0:00:25
580000 -- (-589.185) (-585.500) (-583.623) [-583.232] * (-584.944) (-584.693) [-584.792] (-585.441) -- 0:00:25
Average standard deviation of split frequencies: 0.009590
580500 -- (-588.740) [-584.506] (-587.005) (-585.854) * [-583.480] (-584.291) (-583.317) (-588.248) -- 0:00:25
581000 -- [-585.390] (-585.553) (-583.342) (-584.538) * [-588.853] (-585.304) (-583.400) (-585.697) -- 0:00:25
581500 -- [-584.340] (-585.599) (-587.394) (-583.252) * (-586.031) (-585.809) (-583.386) [-585.386] -- 0:00:25
582000 -- (-583.903) (-584.776) [-584.878] (-583.187) * (-585.420) (-586.146) [-584.815] (-586.763) -- 0:00:25
582500 -- (-583.891) (-583.873) (-583.805) [-585.260] * (-584.502) [-584.650] (-586.349) (-585.962) -- 0:00:25
583000 -- (-583.983) [-585.290] (-585.432) (-585.225) * (-589.103) (-584.185) (-584.973) [-583.090] -- 0:00:25
583500 -- (-585.397) [-584.798] (-587.113) (-586.286) * (-592.382) (-595.185) [-584.570] (-584.780) -- 0:00:24
584000 -- (-585.429) [-584.272] (-585.650) (-585.113) * (-582.925) (-586.663) (-584.920) [-582.803] -- 0:00:24
584500 -- [-583.695] (-586.252) (-585.729) (-585.400) * [-586.088] (-592.067) (-585.287) (-583.406) -- 0:00:24
585000 -- [-585.375] (-588.041) (-592.818) (-587.507) * (-585.152) (-585.900) (-590.799) [-583.317] -- 0:00:24
Average standard deviation of split frequencies: 0.009754
585500 -- (-582.951) (-585.249) [-585.312] (-584.487) * (-583.085) [-587.706] (-589.820) (-582.815) -- 0:00:24
586000 -- (-582.911) (-583.552) (-585.605) [-584.608] * [-586.729] (-586.740) (-592.030) (-583.853) -- 0:00:24
586500 -- [-586.265] (-587.656) (-584.559) (-584.371) * (-584.455) [-586.816] (-585.365) (-587.347) -- 0:00:24
587000 -- (-586.748) (-587.868) (-584.455) [-583.982] * (-584.260) [-583.227] (-585.617) (-585.191) -- 0:00:24
587500 -- (-588.064) [-589.353] (-585.249) (-584.976) * (-583.628) (-584.787) [-585.050] (-588.438) -- 0:00:24
588000 -- (-584.305) [-584.193] (-583.997) (-585.664) * [-584.783] (-583.410) (-588.407) (-583.656) -- 0:00:24
588500 -- [-582.828] (-582.859) (-583.639) (-584.085) * (-585.388) (-583.761) (-587.143) [-583.067] -- 0:00:24
589000 -- [-583.284] (-583.460) (-583.831) (-587.013) * (-585.679) (-584.415) [-584.944] (-585.673) -- 0:00:24
589500 -- (-583.527) [-588.039] (-584.307) (-585.279) * (-586.480) (-586.079) (-587.261) [-586.532] -- 0:00:24
590000 -- (-584.740) (-584.293) [-584.828] (-584.312) * (-588.578) (-587.971) [-586.447] (-584.184) -- 0:00:24
Average standard deviation of split frequencies: 0.010076
590500 -- (-583.951) [-583.560] (-587.981) (-585.647) * (-589.281) (-586.857) (-585.712) [-589.285] -- 0:00:24
591000 -- (-588.994) (-583.270) [-585.767] (-584.996) * (-587.729) [-585.627] (-586.176) (-587.522) -- 0:00:24
591500 -- (-583.605) (-584.503) [-584.925] (-586.579) * (-589.706) (-583.953) (-585.766) [-583.596] -- 0:00:24
592000 -- [-583.960] (-584.440) (-583.699) (-584.178) * (-583.307) [-588.649] (-584.846) (-588.827) -- 0:00:24
592500 -- (-589.928) [-584.949] (-585.289) (-584.666) * [-583.342] (-589.132) (-585.007) (-584.305) -- 0:00:24
593000 -- (-586.901) (-588.603) [-584.778] (-586.059) * [-587.009] (-590.049) (-585.586) (-584.316) -- 0:00:24
593500 -- (-586.453) [-583.703] (-585.144) (-585.841) * (-586.059) (-592.427) (-584.073) [-587.757] -- 0:00:24
594000 -- (-584.856) [-585.347] (-586.685) (-584.806) * (-584.400) (-588.790) [-584.717] (-588.313) -- 0:00:24
594500 -- [-586.322] (-584.674) (-585.399) (-584.498) * (-583.004) (-583.761) [-590.486] (-587.086) -- 0:00:24
595000 -- (-582.694) [-584.630] (-586.684) (-591.100) * [-583.584] (-583.638) (-584.470) (-587.510) -- 0:00:24
Average standard deviation of split frequencies: 0.010282
595500 -- [-585.159] (-587.436) (-586.615) (-585.595) * (-585.263) (-587.725) (-587.681) [-587.987] -- 0:00:24
596000 -- [-583.838] (-589.427) (-585.187) (-585.401) * [-583.546] (-584.889) (-583.796) (-586.239) -- 0:00:24
596500 -- (-585.579) (-584.622) (-584.758) [-585.710] * (-585.064) (-584.052) (-583.865) [-584.857] -- 0:00:24
597000 -- (-586.802) (-585.578) [-586.212] (-586.703) * (-588.344) (-584.887) [-585.106] (-585.980) -- 0:00:24
597500 -- (-584.798) [-584.620] (-583.801) (-583.999) * (-584.908) (-583.903) (-584.647) [-582.926] -- 0:00:24
598000 -- [-584.430] (-585.254) (-583.423) (-587.164) * (-582.848) [-583.360] (-585.083) (-583.492) -- 0:00:24
598500 -- (-584.708) [-583.705] (-584.226) (-589.303) * [-587.547] (-583.738) (-587.150) (-583.821) -- 0:00:24
599000 -- (-587.240) [-584.706] (-584.523) (-589.176) * (-586.983) (-589.382) (-583.982) [-586.164] -- 0:00:24
599500 -- (-586.474) (-590.574) (-584.643) [-586.854] * (-587.034) (-591.576) [-584.603] (-586.887) -- 0:00:24
600000 -- (-586.802) (-587.794) [-585.057] (-586.194) * (-584.737) (-586.181) [-586.685] (-588.991) -- 0:00:24
Average standard deviation of split frequencies: 0.009663
600500 -- [-584.894] (-587.096) (-583.545) (-586.435) * (-586.951) (-584.711) [-586.129] (-585.426) -- 0:00:23
601000 -- [-584.696] (-590.453) (-585.112) (-585.777) * (-587.128) (-585.133) [-583.992] (-584.585) -- 0:00:23
601500 -- (-587.709) [-586.860] (-590.401) (-584.506) * (-585.012) (-585.842) (-587.371) [-584.228] -- 0:00:23
602000 -- [-593.119] (-583.530) (-584.598) (-586.730) * (-585.461) [-586.975] (-586.325) (-584.461) -- 0:00:23
602500 -- (-590.971) [-584.912] (-585.054) (-583.853) * (-584.380) (-584.765) [-585.201] (-583.335) -- 0:00:23
603000 -- [-584.074] (-585.064) (-584.910) (-585.648) * (-583.945) (-583.967) [-583.299] (-584.013) -- 0:00:23
603500 -- (-583.647) (-586.106) [-584.921] (-585.247) * [-584.227] (-583.594) (-584.129) (-583.320) -- 0:00:23
604000 -- (-586.171) (-587.897) (-583.112) [-583.881] * (-583.821) [-583.595] (-584.812) (-582.959) -- 0:00:23
604500 -- (-586.436) (-586.352) [-586.629] (-583.596) * [-585.680] (-586.325) (-586.780) (-584.603) -- 0:00:23
605000 -- (-584.983) (-584.948) [-585.364] (-587.268) * (-583.358) (-584.757) [-585.677] (-584.286) -- 0:00:23
Average standard deviation of split frequencies: 0.009432
605500 -- (-589.876) (-584.941) (-584.573) [-583.945] * (-582.779) [-584.415] (-584.450) (-585.504) -- 0:00:23
606000 -- (-585.707) [-584.904] (-595.165) (-584.049) * [-583.354] (-584.216) (-583.499) (-583.290) -- 0:00:23
606500 -- (-585.400) [-588.890] (-586.385) (-583.608) * (-585.210) (-585.513) [-583.885] (-584.386) -- 0:00:23
607000 -- (-583.739) (-588.322) [-584.818] (-585.547) * (-584.833) (-584.398) (-583.254) [-584.802] -- 0:00:23
607500 -- [-585.164] (-587.835) (-584.732) (-586.252) * (-583.937) (-586.626) [-583.696] (-583.852) -- 0:00:23
608000 -- (-586.743) [-584.305] (-586.513) (-583.681) * (-584.463) [-584.115] (-583.571) (-586.626) -- 0:00:23
608500 -- (-589.268) [-586.032] (-584.200) (-583.896) * (-584.046) (-585.297) (-584.100) [-586.034] -- 0:00:23
609000 -- (-584.676) [-584.768] (-586.708) (-584.631) * (-588.835) (-584.740) (-583.742) [-583.563] -- 0:00:23
609500 -- [-585.099] (-585.399) (-587.679) (-584.310) * (-584.041) (-584.948) [-583.050] (-584.270) -- 0:00:23
610000 -- (-586.319) [-583.313] (-587.795) (-588.348) * [-585.776] (-585.701) (-585.494) (-586.914) -- 0:00:23
Average standard deviation of split frequencies: 0.010035
610500 -- [-587.807] (-584.668) (-588.953) (-586.195) * [-584.888] (-589.326) (-587.431) (-584.676) -- 0:00:23
611000 -- (-592.130) (-589.280) (-584.610) [-584.518] * (-583.846) [-585.215] (-586.136) (-584.279) -- 0:00:23
611500 -- (-585.465) (-585.462) [-582.817] (-585.749) * (-583.292) (-585.379) (-585.603) [-586.116] -- 0:00:23
612000 -- (-586.607) [-584.197] (-585.788) (-584.483) * (-585.940) (-585.413) [-584.516] (-591.238) -- 0:00:23
612500 -- (-586.423) (-583.847) [-587.570] (-586.783) * (-585.336) [-584.882] (-587.420) (-584.216) -- 0:00:23
613000 -- (-585.640) (-586.404) [-588.502] (-586.067) * (-583.701) [-584.259] (-586.342) (-587.258) -- 0:00:23
613500 -- (-586.582) (-584.756) [-585.250] (-584.391) * (-585.037) (-584.649) (-584.822) [-590.566] -- 0:00:23
614000 -- (-585.016) (-584.062) (-583.466) [-584.297] * (-586.082) (-586.263) (-586.067) [-585.362] -- 0:00:23
614500 -- (-583.851) (-587.963) [-585.257] (-583.573) * (-584.148) (-588.813) [-586.888] (-587.826) -- 0:00:23
615000 -- (-583.511) [-582.919] (-587.036) (-584.059) * (-587.122) (-584.278) [-585.342] (-588.941) -- 0:00:23
Average standard deviation of split frequencies: 0.010044
615500 -- (-583.057) (-584.014) [-588.507] (-584.473) * (-586.445) [-584.886] (-588.713) (-586.527) -- 0:00:23
616000 -- (-586.113) (-584.982) (-585.233) [-585.753] * (-584.004) (-584.762) (-586.184) [-585.851] -- 0:00:23
616500 -- (-587.705) (-588.189) (-586.376) [-583.797] * (-586.643) [-584.563] (-586.647) (-584.311) -- 0:00:23
617000 -- [-584.107] (-585.923) (-583.358) (-584.074) * (-585.423) (-587.680) (-587.911) [-584.427] -- 0:00:22
617500 -- (-584.529) [-583.638] (-583.583) (-585.059) * (-587.258) (-584.757) [-584.169] (-584.115) -- 0:00:22
618000 -- [-588.169] (-584.354) (-583.946) (-584.015) * (-586.737) (-583.918) [-585.350] (-584.980) -- 0:00:22
618500 -- [-586.237] (-588.941) (-587.403) (-589.799) * (-584.908) (-583.413) [-585.113] (-584.815) -- 0:00:22
619000 -- (-586.032) (-584.897) [-584.876] (-586.200) * (-583.882) [-585.123] (-584.952) (-584.729) -- 0:00:22
619500 -- (-588.201) [-583.933] (-587.025) (-584.195) * [-582.977] (-587.183) (-583.644) (-584.236) -- 0:00:22
620000 -- (-587.347) [-583.878] (-585.475) (-585.732) * (-583.225) (-586.407) (-585.517) [-587.311] -- 0:00:22
Average standard deviation of split frequencies: 0.010016
620500 -- (-587.101) [-586.565] (-589.275) (-585.353) * (-586.043) [-585.694] (-585.600) (-582.913) -- 0:00:22
621000 -- (-586.550) (-583.916) [-583.964] (-590.686) * (-583.345) (-587.177) [-584.926] (-584.781) -- 0:00:22
621500 -- (-587.071) [-583.498] (-584.887) (-584.833) * (-587.724) (-584.851) [-583.490] (-585.512) -- 0:00:22
622000 -- (-584.867) (-584.490) (-585.604) [-583.798] * (-584.682) [-584.360] (-587.594) (-585.002) -- 0:00:22
622500 -- [-586.195] (-585.602) (-585.365) (-584.056) * (-583.986) (-584.690) (-588.595) [-584.214] -- 0:00:22
623000 -- (-585.772) [-584.738] (-585.952) (-584.907) * (-583.769) (-584.128) [-586.177] (-587.009) -- 0:00:22
623500 -- (-584.538) (-584.986) (-586.918) [-584.711] * (-585.631) (-583.588) [-583.659] (-586.269) -- 0:00:22
624000 -- (-584.088) [-583.992] (-584.453) (-584.185) * (-587.066) (-583.909) (-586.779) [-584.056] -- 0:00:22
624500 -- (-586.923) (-584.285) [-582.845] (-582.881) * (-587.133) (-582.863) (-589.799) [-584.301] -- 0:00:22
625000 -- (-585.415) [-582.956] (-583.274) (-586.301) * [-584.095] (-584.965) (-586.387) (-583.863) -- 0:00:22
Average standard deviation of split frequencies: 0.010072
625500 -- (-584.921) (-582.985) [-584.501] (-584.829) * (-585.416) (-585.006) (-587.195) [-585.081] -- 0:00:22
626000 -- (-585.455) (-585.208) [-585.719] (-583.996) * (-583.807) (-587.466) (-586.076) [-586.299] -- 0:00:22
626500 -- (-584.818) (-584.936) (-583.934) [-585.146] * (-585.296) (-588.142) (-584.612) [-584.436] -- 0:00:22
627000 -- (-584.174) (-585.916) (-586.316) [-584.436] * (-584.498) [-587.795] (-584.359) (-584.204) -- 0:00:22
627500 -- (-586.081) [-584.819] (-583.812) (-584.696) * (-583.101) (-584.579) [-582.906] (-585.197) -- 0:00:22
628000 -- (-587.507) [-583.896] (-582.866) (-584.671) * [-584.673] (-584.091) (-584.408) (-583.862) -- 0:00:22
628500 -- [-586.282] (-584.511) (-583.063) (-587.058) * (-586.621) (-583.369) [-585.918] (-585.491) -- 0:00:22
629000 -- (-586.728) (-588.271) (-583.294) [-584.530] * (-589.104) (-584.695) (-587.826) [-583.337] -- 0:00:22
629500 -- [-584.486] (-584.208) (-586.795) (-584.598) * (-587.132) [-584.976] (-584.513) (-583.503) -- 0:00:22
630000 -- (-583.769) (-588.434) [-583.229] (-584.401) * (-585.478) [-584.517] (-584.149) (-586.454) -- 0:00:22
Average standard deviation of split frequencies: 0.010511
630500 -- [-585.205] (-584.695) (-584.568) (-591.699) * (-584.601) (-584.233) [-586.522] (-585.761) -- 0:00:22
631000 -- (-584.881) (-583.683) (-583.071) [-583.838] * (-585.220) [-583.325] (-584.832) (-583.744) -- 0:00:22
631500 -- (-584.874) (-585.667) (-584.591) [-585.384] * [-585.218] (-583.619) (-587.175) (-583.982) -- 0:00:22
632000 -- [-585.796] (-587.679) (-585.822) (-588.978) * (-587.843) (-583.105) (-584.449) [-583.816] -- 0:00:22
632500 -- (-585.073) (-586.897) (-585.475) [-585.432] * (-588.406) [-584.533] (-582.855) (-587.073) -- 0:00:22
633000 -- (-584.950) [-584.176] (-585.730) (-586.700) * (-587.430) [-584.209] (-589.244) (-583.376) -- 0:00:22
633500 -- (-585.303) (-585.434) (-584.826) [-584.562] * (-585.600) [-584.372] (-585.381) (-583.269) -- 0:00:21
634000 -- (-586.113) [-592.399] (-584.722) (-584.147) * (-592.165) (-584.667) (-584.814) [-585.584] -- 0:00:21
634500 -- (-584.845) (-588.769) (-583.553) [-583.602] * (-585.642) (-584.214) (-584.828) [-585.064] -- 0:00:21
635000 -- (-585.507) (-585.800) [-582.803] (-583.541) * (-585.252) (-584.693) [-585.828] (-584.022) -- 0:00:21
Average standard deviation of split frequencies: 0.010794
635500 -- (-584.770) [-590.034] (-583.085) (-585.494) * [-583.076] (-584.087) (-584.940) (-583.232) -- 0:00:21
636000 -- (-585.280) (-586.195) (-586.056) [-587.628] * (-583.193) (-583.353) [-584.168] (-584.871) -- 0:00:21
636500 -- (-589.422) (-584.558) [-585.613] (-585.615) * (-587.630) (-583.421) [-584.365] (-587.741) -- 0:00:21
637000 -- [-588.045] (-583.735) (-586.043) (-584.797) * [-586.551] (-583.941) (-585.489) (-586.980) -- 0:00:22
637500 -- (-586.136) (-584.405) (-584.319) [-586.009] * (-584.727) [-584.016] (-587.263) (-586.635) -- 0:00:22
638000 -- (-587.220) (-586.100) (-584.344) [-583.879] * (-584.607) (-585.282) [-582.927] (-585.816) -- 0:00:22
638500 -- (-585.088) (-585.237) (-588.475) [-589.534] * (-584.590) [-585.199] (-587.547) (-584.898) -- 0:00:22
639000 -- (-583.986) (-586.075) [-585.637] (-589.438) * (-586.758) (-583.937) [-584.470] (-586.503) -- 0:00:22
639500 -- [-584.502] (-586.287) (-585.549) (-585.860) * [-584.998] (-583.921) (-584.436) (-584.577) -- 0:00:21
640000 -- (-586.324) (-585.874) (-583.937) [-584.776] * (-583.023) [-587.646] (-585.387) (-584.854) -- 0:00:21
Average standard deviation of split frequencies: 0.010485
640500 -- (-585.346) [-585.328] (-585.999) (-584.991) * (-586.324) (-587.364) [-585.600] (-583.458) -- 0:00:21
641000 -- [-584.746] (-592.948) (-583.066) (-583.750) * (-583.952) (-589.810) (-587.279) [-584.731] -- 0:00:21
641500 -- (-584.451) [-586.018] (-586.793) (-583.027) * (-588.115) [-584.848] (-585.342) (-585.890) -- 0:00:21
642000 -- (-584.149) (-586.982) (-586.516) [-586.660] * (-584.125) (-586.073) [-585.757] (-584.257) -- 0:00:21
642500 -- (-586.216) (-587.659) (-585.171) [-585.657] * [-587.494] (-583.073) (-585.890) (-585.879) -- 0:00:21
643000 -- [-583.176] (-586.318) (-589.088) (-583.928) * (-587.926) (-588.510) (-584.984) [-584.398] -- 0:00:21
643500 -- (-583.935) [-585.919] (-584.864) (-583.883) * [-583.440] (-585.107) (-586.977) (-585.514) -- 0:00:21
644000 -- (-585.355) [-587.957] (-584.922) (-585.445) * (-583.652) (-585.783) (-585.311) [-582.982] -- 0:00:21
644500 -- (-586.033) [-587.980] (-584.238) (-583.492) * (-583.272) [-584.394] (-582.870) (-582.993) -- 0:00:21
645000 -- (-591.542) [-586.055] (-583.506) (-583.433) * (-584.055) [-585.712] (-583.782) (-584.977) -- 0:00:21
Average standard deviation of split frequencies: 0.010171
645500 -- (-583.925) (-583.826) [-582.983] (-584.549) * (-583.533) [-585.120] (-582.856) (-584.665) -- 0:00:21
646000 -- (-583.932) [-584.233] (-585.534) (-585.039) * (-584.459) (-584.167) [-583.161] (-584.390) -- 0:00:21
646500 -- (-584.979) [-585.824] (-584.169) (-588.531) * [-584.406] (-584.392) (-585.732) (-586.949) -- 0:00:21
647000 -- (-586.327) (-588.472) (-585.773) [-587.173] * (-585.267) (-584.036) [-583.766] (-585.133) -- 0:00:21
647500 -- [-587.086] (-586.403) (-584.978) (-588.049) * [-586.760] (-586.742) (-584.970) (-584.081) -- 0:00:21
648000 -- (-583.533) (-585.098) (-584.015) [-584.249] * (-584.309) (-585.557) (-585.297) [-584.641] -- 0:00:21
648500 -- (-584.452) (-584.227) (-584.039) [-585.077] * (-585.062) [-584.946] (-587.798) (-584.954) -- 0:00:21
649000 -- (-585.168) (-587.099) (-584.754) [-586.201] * (-585.602) (-584.611) (-584.924) [-583.823] -- 0:00:21
649500 -- [-587.818] (-588.838) (-584.088) (-585.797) * (-589.384) [-583.595] (-583.751) (-583.436) -- 0:00:21
650000 -- [-583.907] (-586.381) (-583.285) (-586.659) * (-583.230) [-585.595] (-583.827) (-583.871) -- 0:00:21
Average standard deviation of split frequencies: 0.011003
650500 -- [-583.517] (-586.966) (-583.813) (-584.143) * (-584.508) (-583.932) [-583.155] (-585.089) -- 0:00:20
651000 -- (-586.023) [-585.903] (-586.496) (-583.591) * (-584.299) [-586.014] (-584.627) (-583.460) -- 0:00:20
651500 -- (-587.273) [-584.562] (-585.956) (-584.481) * (-584.187) (-585.248) [-585.124] (-583.425) -- 0:00:20
652000 -- (-586.498) (-586.538) [-583.831] (-583.991) * (-587.344) (-585.404) (-583.578) [-584.658] -- 0:00:20
652500 -- (-586.467) [-586.062] (-586.661) (-589.286) * [-585.070] (-583.766) (-587.265) (-583.637) -- 0:00:20
653000 -- (-586.533) (-586.785) (-584.535) [-584.642] * [-584.493] (-583.265) (-588.891) (-583.477) -- 0:00:20
653500 -- [-585.242] (-584.043) (-584.816) (-586.149) * (-583.729) (-585.926) (-585.713) [-583.383] -- 0:00:21
654000 -- [-585.329] (-583.882) (-586.371) (-586.290) * (-584.867) (-585.580) (-584.258) [-583.227] -- 0:00:21
654500 -- (-589.539) [-584.105] (-584.730) (-586.869) * [-585.657] (-585.470) (-584.928) (-590.448) -- 0:00:21
655000 -- (-583.891) (-583.227) [-583.283] (-586.338) * (-590.666) [-585.383] (-588.273) (-590.599) -- 0:00:21
Average standard deviation of split frequencies: 0.011183
655500 -- (-592.233) (-587.875) (-584.872) [-583.832] * (-586.922) (-585.190) (-585.912) [-586.134] -- 0:00:21
656000 -- (-592.509) [-587.205] (-587.250) (-584.875) * (-583.301) [-584.059] (-584.590) (-584.060) -- 0:00:20
656500 -- [-584.350] (-584.859) (-584.242) (-584.784) * (-590.438) [-583.520] (-587.667) (-585.722) -- 0:00:20
657000 -- [-584.489] (-585.475) (-584.006) (-585.945) * [-583.751] (-582.881) (-584.221) (-585.363) -- 0:00:20
657500 -- (-584.664) (-588.808) (-584.821) [-586.519] * (-585.037) (-582.785) (-585.475) [-585.725] -- 0:00:20
658000 -- [-585.632] (-585.808) (-583.370) (-589.129) * (-584.572) (-583.274) (-586.573) [-591.007] -- 0:00:20
658500 -- [-583.772] (-584.312) (-585.068) (-584.508) * (-583.953) [-583.303] (-585.180) (-587.242) -- 0:00:20
659000 -- (-583.822) (-583.388) (-584.316) [-583.251] * (-586.316) (-584.014) (-586.829) [-584.037] -- 0:00:20
659500 -- (-585.356) [-583.480] (-585.408) (-584.384) * (-587.837) [-591.893] (-585.033) (-585.681) -- 0:00:20
660000 -- (-585.838) [-584.225] (-584.705) (-583.955) * [-586.462] (-588.482) (-587.122) (-584.266) -- 0:00:20
Average standard deviation of split frequencies: 0.011193
660500 -- (-584.453) [-589.571] (-584.597) (-584.900) * (-590.817) [-583.344] (-583.935) (-584.281) -- 0:00:20
661000 -- (-584.424) (-592.314) (-587.128) [-584.481] * (-584.053) [-585.501] (-583.433) (-588.380) -- 0:00:20
661500 -- (-584.055) (-584.145) [-586.366] (-584.367) * (-583.696) (-587.479) [-585.455] (-587.846) -- 0:00:20
662000 -- (-583.860) (-584.836) [-585.151] (-586.711) * (-585.755) (-586.081) (-583.903) [-586.482] -- 0:00:20
662500 -- (-583.789) (-583.462) (-585.875) [-586.857] * (-584.034) [-584.714] (-583.623) (-589.487) -- 0:00:20
663000 -- (-584.415) [-585.929] (-584.575) (-588.792) * (-582.954) (-586.980) (-583.054) [-585.694] -- 0:00:20
663500 -- [-585.572] (-584.865) (-585.841) (-590.715) * (-583.902) [-586.120] (-584.152) (-585.025) -- 0:00:20
664000 -- (-583.847) [-583.870] (-585.190) (-586.194) * (-584.170) (-591.292) (-584.625) [-583.834] -- 0:00:20
664500 -- (-583.898) (-584.901) (-588.561) [-585.340] * (-583.269) (-593.211) [-584.413] (-587.304) -- 0:00:20
665000 -- [-583.796] (-585.487) (-583.873) (-584.421) * (-584.110) (-583.746) (-587.739) [-587.273] -- 0:00:20
Average standard deviation of split frequencies: 0.010883
665500 -- [-583.908] (-587.594) (-583.406) (-584.211) * (-584.446) (-583.401) (-584.024) [-585.346] -- 0:00:20
666000 -- [-584.464] (-590.287) (-583.487) (-585.940) * [-585.666] (-583.882) (-584.244) (-584.223) -- 0:00:20
666500 -- [-583.749] (-587.495) (-587.732) (-583.750) * [-583.777] (-586.361) (-585.591) (-583.571) -- 0:00:20
667000 -- (-584.032) [-585.391] (-585.964) (-583.012) * (-584.271) [-585.425] (-584.053) (-583.444) -- 0:00:19
667500 -- (-584.208) [-585.154] (-587.180) (-583.289) * (-588.167) [-585.849] (-584.310) (-584.873) -- 0:00:19
668000 -- (-583.142) (-583.947) [-584.505] (-584.643) * (-586.412) (-585.882) (-587.455) [-584.572] -- 0:00:19
668500 -- [-583.813] (-588.236) (-585.244) (-584.968) * [-586.696] (-584.725) (-584.152) (-588.003) -- 0:00:19
669000 -- [-585.993] (-583.423) (-587.538) (-583.512) * (-585.430) (-588.824) (-585.565) [-582.973] -- 0:00:19
669500 -- (-585.879) (-585.234) [-584.979] (-583.635) * (-584.132) (-585.352) (-586.321) [-584.248] -- 0:00:19
670000 -- [-584.291] (-588.469) (-586.284) (-585.379) * (-584.326) (-583.785) (-585.950) [-587.187] -- 0:00:19
Average standard deviation of split frequencies: 0.011114
670500 -- (-588.425) (-585.365) (-586.123) [-585.321] * (-584.920) (-584.354) (-589.079) [-583.641] -- 0:00:20
671000 -- (-588.410) (-585.864) (-586.759) [-583.867] * (-588.629) (-583.841) (-586.812) [-587.282] -- 0:00:20
671500 -- [-585.936] (-584.925) (-586.569) (-584.183) * (-584.451) [-585.370] (-591.061) (-586.322) -- 0:00:20
672000 -- (-584.065) (-585.588) (-585.830) [-587.277] * (-584.300) (-583.431) [-584.493] (-586.823) -- 0:00:20
672500 -- (-584.454) (-583.261) (-584.461) [-584.798] * (-583.676) (-585.448) [-585.294] (-584.680) -- 0:00:19
673000 -- [-583.451] (-584.428) (-585.320) (-586.022) * (-585.370) (-584.555) (-585.478) [-583.466] -- 0:00:19
673500 -- (-583.147) [-584.444] (-584.412) (-585.243) * (-583.298) [-584.619] (-584.644) (-583.510) -- 0:00:19
674000 -- (-584.595) [-584.203] (-583.132) (-584.232) * (-583.751) (-584.975) (-583.616) [-583.311] -- 0:00:19
674500 -- (-584.449) (-586.336) (-584.043) [-583.442] * (-583.729) (-585.213) (-583.618) [-583.613] -- 0:00:19
675000 -- (-584.606) [-583.671] (-583.955) (-587.426) * (-583.238) (-584.835) (-589.282) [-583.761] -- 0:00:19
Average standard deviation of split frequencies: 0.011070
675500 -- (-585.420) [-583.636] (-583.178) (-587.456) * [-583.238] (-583.802) (-583.487) (-589.479) -- 0:00:19
676000 -- (-586.038) (-586.148) [-583.017] (-584.527) * [-585.408] (-587.591) (-586.734) (-583.354) -- 0:00:19
676500 -- [-582.832] (-583.782) (-584.911) (-583.735) * (-585.379) (-584.078) (-586.657) [-583.286] -- 0:00:19
677000 -- (-583.155) (-583.111) [-590.657] (-584.481) * (-590.166) (-584.634) [-584.810] (-585.322) -- 0:00:19
677500 -- (-584.107) (-585.884) (-590.768) [-584.960] * (-585.613) (-587.321) (-586.753) [-583.422] -- 0:00:19
678000 -- (-584.107) (-585.267) (-586.489) [-584.683] * [-584.946] (-586.178) (-583.555) (-584.239) -- 0:00:19
678500 -- (-584.919) [-586.206] (-584.412) (-587.029) * (-588.256) [-583.421] (-584.749) (-584.223) -- 0:00:19
679000 -- (-585.271) (-586.070) [-583.268] (-585.450) * [-584.743] (-583.752) (-584.529) (-588.304) -- 0:00:19
679500 -- (-588.334) (-593.328) [-583.738] (-588.298) * (-585.710) (-587.559) [-586.114] (-584.924) -- 0:00:19
680000 -- (-584.658) (-585.340) (-583.964) [-584.810] * (-583.606) (-585.296) [-584.014] (-585.824) -- 0:00:19
Average standard deviation of split frequencies: 0.011427
680500 -- (-584.583) [-588.344] (-585.428) (-586.729) * [-584.786] (-588.494) (-585.491) (-584.246) -- 0:00:19
681000 -- (-583.612) [-591.056] (-589.306) (-585.025) * (-587.078) (-587.366) (-586.510) [-583.706] -- 0:00:19
681500 -- [-585.001] (-589.788) (-587.131) (-583.450) * [-586.708] (-584.782) (-587.350) (-584.694) -- 0:00:19
682000 -- (-584.466) (-583.876) [-584.430] (-583.449) * (-585.197) [-583.575] (-585.134) (-585.583) -- 0:00:19
682500 -- (-584.453) (-582.833) (-586.013) [-583.540] * (-583.404) (-585.208) [-586.410] (-585.406) -- 0:00:19
683000 -- (-584.065) (-583.463) [-586.666] (-584.497) * (-587.926) (-584.303) [-583.273] (-586.521) -- 0:00:19
683500 -- (-588.993) [-585.627] (-583.678) (-594.977) * [-585.329] (-585.880) (-584.200) (-586.214) -- 0:00:18
684000 -- (-586.107) (-587.559) [-585.218] (-588.766) * (-586.821) (-583.019) (-585.035) [-584.056] -- 0:00:18
684500 -- (-586.389) (-585.707) (-583.831) [-584.759] * [-583.385] (-586.841) (-585.241) (-584.744) -- 0:00:18
685000 -- [-584.851] (-587.308) (-585.286) (-588.872) * [-583.822] (-583.663) (-586.554) (-584.375) -- 0:00:18
Average standard deviation of split frequencies: 0.011237
685500 -- (-585.316) (-585.162) [-583.205] (-586.308) * (-583.313) (-584.969) (-583.531) [-583.011] -- 0:00:18
686000 -- [-587.354] (-587.079) (-586.917) (-582.935) * [-583.859] (-585.202) (-584.081) (-584.102) -- 0:00:18
686500 -- (-585.020) (-583.745) [-582.846] (-585.188) * (-586.873) (-584.192) [-583.979] (-586.519) -- 0:00:18
687000 -- (-585.972) (-584.635) [-584.250] (-587.408) * (-585.320) [-584.391] (-585.633) (-585.011) -- 0:00:18
687500 -- (-585.484) (-589.809) [-584.113] (-585.317) * [-583.166] (-582.898) (-587.280) (-583.683) -- 0:00:19
688000 -- [-585.811] (-588.921) (-583.462) (-587.580) * (-584.938) (-584.273) [-583.573] (-583.955) -- 0:00:19
688500 -- (-588.456) (-583.048) (-586.184) [-583.352] * (-585.482) [-584.259] (-591.260) (-584.622) -- 0:00:19
689000 -- (-588.013) (-585.739) [-583.260] (-587.306) * (-586.476) (-586.496) (-588.114) [-586.518] -- 0:00:18
689500 -- (-584.126) (-587.138) [-585.903] (-587.671) * (-586.072) [-583.864] (-586.961) (-583.363) -- 0:00:18
690000 -- (-584.680) (-587.527) (-588.195) [-586.646] * [-584.309] (-588.701) (-587.601) (-583.864) -- 0:00:18
Average standard deviation of split frequencies: 0.010579
690500 -- (-585.092) (-583.472) [-587.245] (-586.312) * (-588.554) [-583.902] (-583.730) (-583.447) -- 0:00:18
691000 -- (-583.848) [-586.313] (-588.383) (-584.580) * (-584.559) (-587.058) [-583.600] (-584.997) -- 0:00:18
691500 -- [-587.951] (-584.974) (-589.633) (-583.992) * (-584.617) (-586.850) [-585.191] (-588.354) -- 0:00:18
692000 -- (-584.774) (-583.585) [-584.628] (-585.040) * (-584.877) (-584.842) (-584.799) [-584.468] -- 0:00:18
692500 -- (-584.967) (-583.980) (-585.095) [-583.568] * (-585.826) [-584.210] (-583.794) (-583.683) -- 0:00:18
693000 -- (-586.144) (-586.411) (-583.321) [-583.969] * (-584.550) [-582.890] (-584.571) (-588.670) -- 0:00:18
693500 -- (-583.357) (-587.401) [-585.732] (-584.197) * (-584.536) [-584.445] (-585.784) (-591.618) -- 0:00:18
694000 -- (-592.003) [-585.241] (-585.282) (-583.470) * [-583.829] (-585.815) (-585.698) (-583.624) -- 0:00:18
694500 -- (-585.395) (-583.066) (-586.251) [-583.577] * (-591.109) [-583.967] (-585.344) (-587.157) -- 0:00:18
695000 -- (-588.496) [-585.357] (-583.918) (-583.322) * (-586.950) (-584.475) [-584.250] (-590.400) -- 0:00:18
Average standard deviation of split frequencies: 0.010040
695500 -- [-586.531] (-584.425) (-585.502) (-586.316) * (-586.579) (-588.265) (-588.225) [-584.236] -- 0:00:18
696000 -- (-585.543) (-584.911) [-584.299] (-586.761) * (-584.862) [-587.346] (-587.571) (-584.359) -- 0:00:18
696500 -- (-583.959) (-585.816) [-582.798] (-584.977) * [-585.160] (-585.852) (-587.148) (-586.461) -- 0:00:18
697000 -- [-583.326] (-586.603) (-588.501) (-586.808) * (-587.116) [-584.156] (-586.407) (-585.729) -- 0:00:18
697500 -- (-583.915) (-584.468) (-589.422) [-584.353] * [-587.462] (-584.177) (-585.367) (-583.710) -- 0:00:18
698000 -- (-584.598) (-586.434) (-585.241) [-584.017] * (-587.008) (-583.409) (-585.598) [-583.427] -- 0:00:18
698500 -- (-587.267) (-585.064) (-584.241) [-583.125] * [-588.723] (-585.255) (-584.216) (-584.637) -- 0:00:18
699000 -- (-586.215) (-585.338) [-585.967] (-587.621) * (-584.413) (-585.159) [-584.422] (-584.577) -- 0:00:18
699500 -- [-586.696] (-588.315) (-591.273) (-586.285) * (-587.675) (-584.976) (-585.459) [-584.516] -- 0:00:18
700000 -- [-584.104] (-584.886) (-583.460) (-585.843) * (-584.052) [-583.595] (-587.468) (-583.573) -- 0:00:18
Average standard deviation of split frequencies: 0.009587
700500 -- [-584.869] (-584.587) (-585.106) (-589.010) * (-585.528) [-584.173] (-587.913) (-585.274) -- 0:00:17
701000 -- (-587.355) (-584.118) (-585.886) [-583.892] * (-584.731) (-585.302) (-587.203) [-584.138] -- 0:00:17
701500 -- (-583.397) (-583.451) (-586.785) [-584.478] * (-583.892) [-583.810] (-585.412) (-584.581) -- 0:00:17
702000 -- [-583.249] (-583.247) (-585.294) (-585.546) * (-583.576) (-588.925) [-583.384] (-583.637) -- 0:00:17
702500 -- (-583.549) (-583.113) [-584.654] (-584.641) * (-584.353) (-586.338) [-582.780] (-582.954) -- 0:00:17
703000 -- (-584.280) [-583.885] (-585.202) (-584.644) * (-584.277) (-585.187) [-585.612] (-584.311) -- 0:00:17
703500 -- (-584.620) [-584.921] (-584.286) (-584.023) * (-587.148) (-586.625) (-586.606) [-584.818] -- 0:00:17
704000 -- (-585.367) (-587.304) (-584.798) [-584.747] * (-584.926) (-587.572) [-586.104] (-584.797) -- 0:00:18
704500 -- [-583.896] (-587.038) (-584.055) (-583.599) * (-588.199) (-588.265) (-587.938) [-584.583] -- 0:00:18
705000 -- (-584.461) (-583.236) (-584.375) [-587.787] * [-585.267] (-583.102) (-584.564) (-583.564) -- 0:00:17
Average standard deviation of split frequencies: 0.009584
705500 -- [-584.495] (-583.973) (-592.038) (-586.030) * (-585.315) (-587.290) (-585.854) [-583.564] -- 0:00:17
706000 -- (-587.108) (-592.047) (-590.364) [-586.112] * (-586.330) (-583.230) [-583.167] (-585.437) -- 0:00:17
706500 -- (-584.992) (-585.286) [-583.822] (-588.235) * (-585.494) (-587.822) [-586.023] (-583.503) -- 0:00:17
707000 -- (-585.256) [-585.910] (-583.063) (-587.677) * (-586.156) [-584.642] (-590.626) (-583.091) -- 0:00:17
707500 -- (-584.814) [-586.834] (-586.178) (-585.126) * [-584.129] (-584.269) (-588.994) (-584.122) -- 0:00:17
708000 -- [-584.535] (-592.855) (-590.576) (-585.349) * (-586.939) [-585.041] (-592.618) (-584.483) -- 0:00:17
708500 -- [-584.422] (-583.501) (-585.105) (-583.450) * (-586.303) (-584.438) (-586.310) [-583.914] -- 0:00:17
709000 -- (-584.841) [-584.496] (-584.494) (-584.415) * (-583.506) [-584.318] (-587.068) (-584.189) -- 0:00:17
709500 -- [-583.455] (-582.959) (-584.983) (-584.124) * (-584.453) [-584.635] (-583.752) (-583.183) -- 0:00:17
710000 -- [-583.433] (-583.258) (-583.439) (-582.630) * (-583.527) (-585.071) [-584.531] (-583.377) -- 0:00:17
Average standard deviation of split frequencies: 0.009365
710500 -- (-583.893) [-583.869] (-587.834) (-585.862) * (-587.048) (-582.838) (-584.840) [-583.877] -- 0:00:17
711000 -- (-585.709) [-583.288] (-584.641) (-584.405) * (-588.279) (-583.167) (-584.865) [-590.392] -- 0:00:17
711500 -- (-591.396) (-584.200) [-585.474] (-585.450) * (-584.907) [-584.825] (-585.657) (-588.847) -- 0:00:17
712000 -- (-584.037) (-585.466) (-583.686) [-583.811] * (-584.967) (-585.071) (-584.177) [-583.404] -- 0:00:17
712500 -- (-587.817) [-587.343] (-584.746) (-587.360) * (-583.580) [-584.175] (-583.480) (-587.185) -- 0:00:17
713000 -- (-585.297) [-584.236] (-585.664) (-585.444) * (-586.098) (-584.108) (-582.996) [-588.161] -- 0:00:17
713500 -- (-583.773) (-583.352) (-583.271) [-584.553] * (-588.175) (-584.290) [-584.603] (-586.555) -- 0:00:17
714000 -- (-584.054) (-587.763) (-583.006) [-586.525] * (-587.151) (-583.852) (-583.601) [-587.108] -- 0:00:17
714500 -- (-584.140) [-586.479] (-584.391) (-588.398) * [-584.705] (-582.880) (-584.550) (-590.520) -- 0:00:17
715000 -- (-584.049) (-583.203) (-585.029) [-585.827] * (-589.239) (-585.962) [-585.378] (-590.098) -- 0:00:17
Average standard deviation of split frequencies: 0.009024
715500 -- [-584.288] (-584.501) (-589.721) (-586.945) * (-583.353) (-588.813) (-586.214) [-586.733] -- 0:00:17
716000 -- (-585.367) (-583.878) (-585.905) [-584.999] * [-584.730] (-584.598) (-589.355) (-583.378) -- 0:00:17
716500 -- (-585.336) (-587.815) (-588.150) [-583.824] * (-586.176) (-584.282) (-589.260) [-585.964] -- 0:00:17
717000 -- (-583.322) (-588.305) [-587.181] (-586.680) * (-583.273) [-584.536] (-585.970) (-583.466) -- 0:00:16
717500 -- (-583.807) [-583.772] (-591.406) (-583.391) * (-585.792) (-585.045) [-587.271] (-588.314) -- 0:00:16
718000 -- [-584.496] (-587.461) (-586.381) (-584.477) * [-583.231] (-587.297) (-583.848) (-589.476) -- 0:00:16
718500 -- (-589.381) [-589.745] (-584.265) (-589.983) * (-583.884) [-585.212] (-584.899) (-583.977) -- 0:00:16
719000 -- (-583.986) [-586.767] (-584.232) (-589.241) * (-583.411) (-584.291) (-586.193) [-585.375] -- 0:00:16
719500 -- (-583.947) [-585.231] (-586.523) (-586.523) * (-584.958) (-584.072) [-585.614] (-583.615) -- 0:00:16
720000 -- (-585.121) (-588.360) (-584.960) [-583.796] * [-587.089] (-584.605) (-584.513) (-584.481) -- 0:00:16
Average standard deviation of split frequencies: 0.009273
720500 -- (-586.334) (-585.082) [-584.914] (-584.905) * (-585.104) [-584.880] (-584.161) (-583.902) -- 0:00:16
721000 -- [-587.066] (-584.664) (-583.146) (-585.008) * [-583.900] (-583.931) (-587.507) (-588.477) -- 0:00:17
721500 -- (-582.820) (-584.228) [-583.983] (-583.763) * (-585.404) (-583.006) [-587.259] (-586.166) -- 0:00:16
722000 -- (-583.894) (-584.121) (-584.579) [-585.295] * (-588.066) [-584.914] (-583.691) (-586.053) -- 0:00:16
722500 -- (-584.201) (-585.290) (-585.725) [-583.544] * (-585.175) [-586.306] (-585.914) (-585.295) -- 0:00:16
723000 -- [-583.796] (-583.716) (-583.002) (-587.885) * (-583.175) (-583.734) (-584.647) [-585.373] -- 0:00:16
723500 -- (-588.342) (-591.075) [-583.340] (-585.975) * (-583.564) (-583.715) [-586.040] (-583.745) -- 0:00:16
724000 -- (-585.593) (-587.433) (-584.464) [-585.065] * (-582.735) [-584.858] (-585.036) (-588.435) -- 0:00:16
724500 -- (-587.019) (-584.927) [-583.999] (-584.083) * (-587.511) (-586.953) (-584.923) [-585.228] -- 0:00:16
725000 -- (-583.845) [-583.909] (-584.741) (-584.805) * (-584.465) [-588.438] (-588.281) (-584.581) -- 0:00:16
Average standard deviation of split frequencies: 0.009167
725500 -- (-587.323) (-584.719) (-588.969) [-583.781] * (-583.492) (-583.765) (-585.319) [-583.165] -- 0:00:16
726000 -- (-583.938) (-586.672) (-585.831) [-583.737] * [-588.035] (-586.370) (-584.967) (-585.114) -- 0:00:16
726500 -- (-584.689) [-585.602] (-587.709) (-583.740) * (-584.461) [-585.554] (-584.401) (-583.919) -- 0:00:16
727000 -- (-583.405) (-586.380) [-586.552] (-584.741) * (-585.415) (-586.125) [-583.806] (-585.322) -- 0:00:16
727500 -- (-585.990) [-586.824] (-585.900) (-586.889) * [-584.512] (-588.198) (-586.129) (-586.093) -- 0:00:16
728000 -- (-586.559) (-584.284) [-585.774] (-584.172) * (-583.723) (-587.153) [-587.257] (-584.265) -- 0:00:16
728500 -- (-586.653) (-585.507) (-591.605) [-584.545] * (-586.691) (-588.557) (-586.426) [-584.469] -- 0:00:16
729000 -- (-585.295) (-584.871) [-584.502] (-584.649) * (-584.071) (-584.549) [-590.606] (-584.542) -- 0:00:16
729500 -- (-588.545) [-586.294] (-583.974) (-584.574) * (-587.857) [-586.093] (-593.714) (-585.969) -- 0:00:16
730000 -- (-586.800) [-585.204] (-585.416) (-585.076) * (-587.719) [-584.525] (-585.202) (-586.762) -- 0:00:16
Average standard deviation of split frequencies: 0.008691
730500 -- (-585.199) [-583.059] (-584.227) (-584.923) * (-584.440) [-585.070] (-585.097) (-585.947) -- 0:00:16
731000 -- (-585.480) (-584.964) [-584.528] (-588.838) * (-584.480) (-583.093) [-584.565] (-588.512) -- 0:00:16
731500 -- (-584.192) (-583.410) (-588.723) [-587.050] * (-584.368) (-586.141) (-586.075) [-587.128] -- 0:00:16
732000 -- (-584.482) (-583.077) [-586.469] (-587.280) * (-584.468) (-583.903) [-584.770] (-584.502) -- 0:00:16
732500 -- (-583.848) [-584.154] (-586.821) (-585.934) * (-584.726) [-589.238] (-585.234) (-589.557) -- 0:00:16
733000 -- (-584.001) (-582.841) (-588.589) [-583.634] * (-587.012) (-587.042) [-584.105] (-588.529) -- 0:00:16
733500 -- (-583.455) (-584.309) (-585.412) [-589.188] * (-583.424) (-585.089) [-587.474] (-584.295) -- 0:00:15
734000 -- (-584.018) (-585.431) (-584.913) [-586.873] * [-583.979] (-584.109) (-585.497) (-584.552) -- 0:00:15
734500 -- [-584.057] (-584.185) (-587.019) (-587.252) * [-584.260] (-586.153) (-586.372) (-586.466) -- 0:00:15
735000 -- (-582.855) (-583.143) (-584.691) [-585.465] * (-586.844) [-584.109] (-584.209) (-584.073) -- 0:00:15
Average standard deviation of split frequencies: 0.008439
735500 -- (-582.959) [-584.562] (-593.436) (-585.343) * [-583.832] (-584.727) (-585.424) (-584.036) -- 0:00:15
736000 -- (-583.920) (-585.565) (-586.283) [-583.710] * (-584.999) [-584.996] (-587.138) (-589.723) -- 0:00:15
736500 -- (-585.097) [-585.606] (-588.019) (-585.698) * (-585.094) [-586.448] (-585.099) (-585.639) -- 0:00:15
737000 -- (-583.853) (-584.918) [-585.517] (-586.549) * [-583.834] (-584.878) (-585.698) (-586.178) -- 0:00:15
737500 -- (-583.495) [-584.784] (-586.198) (-586.482) * (-588.000) [-584.697] (-585.351) (-583.650) -- 0:00:15
738000 -- (-583.851) [-584.549] (-586.180) (-586.613) * (-588.249) (-585.455) (-587.806) [-585.490] -- 0:00:15
738500 -- (-585.741) [-585.668] (-586.312) (-585.969) * (-590.232) (-584.048) [-583.797] (-587.768) -- 0:00:15
739000 -- (-586.602) [-586.374] (-586.323) (-584.408) * (-590.146) [-583.507] (-583.925) (-588.601) -- 0:00:15
739500 -- (-586.146) [-584.556] (-586.878) (-584.032) * (-592.680) (-585.625) [-583.954] (-585.754) -- 0:00:15
740000 -- (-587.193) (-587.914) (-583.496) [-583.942] * (-588.777) (-589.763) (-583.823) [-584.215] -- 0:00:15
Average standard deviation of split frequencies: 0.008274
740500 -- (-586.570) (-585.210) [-584.083] (-586.438) * (-585.153) (-585.154) [-590.084] (-584.576) -- 0:00:15
741000 -- (-586.563) [-584.341] (-586.670) (-584.218) * (-585.649) [-587.698] (-585.377) (-587.640) -- 0:00:15
741500 -- (-589.479) (-588.722) (-586.687) [-585.384] * [-586.555] (-586.325) (-588.356) (-584.253) -- 0:00:15
742000 -- (-585.314) [-589.566] (-583.096) (-584.563) * (-586.530) (-587.512) (-585.021) [-585.371] -- 0:00:15
742500 -- (-583.212) (-585.077) [-584.968] (-583.972) * (-584.240) (-587.329) [-588.796] (-583.823) -- 0:00:15
743000 -- (-586.479) [-584.624] (-586.964) (-584.580) * [-585.736] (-586.403) (-584.784) (-584.381) -- 0:00:15
743500 -- [-586.340] (-584.380) (-584.304) (-586.549) * (-584.065) (-584.060) [-584.957] (-583.827) -- 0:00:15
744000 -- (-584.763) (-584.933) [-583.314] (-586.547) * [-586.802] (-582.946) (-585.487) (-583.550) -- 0:00:15
744500 -- (-591.436) [-583.200] (-583.634) (-585.073) * (-586.387) (-585.813) (-584.379) [-583.807] -- 0:00:15
745000 -- [-582.746] (-583.857) (-585.152) (-582.890) * (-584.663) (-585.585) (-583.687) [-584.465] -- 0:00:15
Average standard deviation of split frequencies: 0.007992
745500 -- (-583.717) (-585.244) (-584.697) [-585.009] * (-583.007) (-584.275) [-588.311] (-585.191) -- 0:00:15
746000 -- (-583.429) [-589.359] (-588.593) (-586.221) * (-585.412) (-586.890) [-583.366] (-585.715) -- 0:00:15
746500 -- (-584.872) (-586.045) [-583.095] (-585.289) * (-588.405) (-582.969) (-585.943) [-585.573] -- 0:00:15
747000 -- (-584.678) (-583.540) [-584.401] (-583.775) * (-585.165) [-584.089] (-587.091) (-590.558) -- 0:00:15
747500 -- (-587.250) [-584.021] (-583.075) (-584.321) * (-587.750) (-583.576) (-584.893) [-585.275] -- 0:00:15
748000 -- (-590.248) (-585.478) (-582.933) [-586.622] * (-591.642) (-586.524) [-584.200] (-587.055) -- 0:00:15
748500 -- (-585.722) (-584.592) (-584.158) [-583.630] * (-590.365) [-586.396] (-586.399) (-587.103) -- 0:00:15
749000 -- (-585.556) (-586.608) (-587.521) [-583.280] * (-585.707) (-588.592) [-583.557] (-583.472) -- 0:00:15
749500 -- [-585.291] (-583.883) (-589.186) (-583.338) * (-585.667) (-584.560) [-585.409] (-583.961) -- 0:00:15
750000 -- [-584.757] (-583.640) (-585.580) (-584.950) * (-586.157) (-585.520) (-585.412) [-584.897] -- 0:00:15
Average standard deviation of split frequencies: 0.008127
750500 -- (-585.975) [-584.644] (-584.667) (-586.373) * (-585.767) (-584.533) (-584.841) [-583.108] -- 0:00:14
751000 -- [-583.640] (-584.542) (-584.540) (-585.039) * (-583.373) [-587.436] (-583.518) (-588.550) -- 0:00:14
751500 -- (-583.025) [-583.763] (-585.602) (-587.224) * (-585.881) (-584.495) [-584.794] (-583.139) -- 0:00:14
752000 -- (-596.487) [-582.996] (-585.897) (-584.200) * (-585.708) (-584.006) [-587.668] (-584.668) -- 0:00:14
752500 -- [-586.059] (-585.270) (-590.247) (-585.562) * (-585.039) (-587.315) [-585.578] (-583.583) -- 0:00:14
753000 -- (-584.731) (-588.947) (-585.536) [-585.090] * (-583.128) (-587.992) [-587.677] (-584.026) -- 0:00:14
753500 -- (-586.352) (-586.225) [-586.413] (-583.994) * (-584.368) (-586.933) [-585.678] (-586.142) -- 0:00:14
754000 -- (-584.607) (-583.903) (-584.133) [-583.994] * (-585.750) (-587.013) (-586.034) [-584.931] -- 0:00:14
754500 -- (-584.109) [-583.468] (-584.079) (-584.076) * (-587.243) (-584.126) (-582.946) [-583.751] -- 0:00:14
755000 -- [-586.005] (-583.219) (-583.372) (-585.216) * (-590.018) (-583.260) [-585.425] (-585.727) -- 0:00:14
Average standard deviation of split frequencies: 0.007677
755500 -- (-586.797) (-584.590) [-584.014] (-585.281) * (-585.256) (-586.990) [-586.450] (-585.144) -- 0:00:14
756000 -- (-584.885) [-585.766] (-583.605) (-585.603) * [-583.904] (-584.524) (-584.874) (-585.659) -- 0:00:14
756500 -- (-583.736) (-583.518) [-585.384] (-583.658) * [-583.909] (-584.694) (-585.424) (-585.197) -- 0:00:14
757000 -- (-593.254) [-586.481] (-585.667) (-586.059) * [-587.922] (-588.236) (-585.626) (-585.829) -- 0:00:14
757500 -- (-586.690) (-583.250) [-588.911] (-588.268) * [-584.215] (-590.643) (-584.672) (-583.152) -- 0:00:14
758000 -- (-583.567) [-584.148] (-585.252) (-586.246) * (-586.221) (-586.356) [-586.472] (-584.031) -- 0:00:14
758500 -- (-585.252) (-587.028) (-584.323) [-588.210] * (-585.403) (-584.328) (-587.225) [-584.623] -- 0:00:14
759000 -- (-583.962) (-587.871) [-585.427] (-586.126) * (-583.767) (-584.431) (-585.922) [-583.837] -- 0:00:14
759500 -- (-583.514) (-587.583) [-583.320] (-585.526) * [-583.867] (-586.014) (-588.004) (-583.688) -- 0:00:14
760000 -- (-585.330) [-584.136] (-584.208) (-584.972) * (-584.497) (-585.438) (-585.672) [-583.622] -- 0:00:14
Average standard deviation of split frequencies: 0.007359
760500 -- (-583.803) (-587.666) [-583.759] (-583.584) * (-583.691) (-586.356) [-583.592] (-586.393) -- 0:00:14
761000 -- (-586.525) (-586.561) (-583.211) [-584.390] * (-587.750) (-584.051) [-585.615] (-584.586) -- 0:00:14
761500 -- (-586.967) (-585.871) (-585.490) [-584.842] * (-588.195) [-583.254] (-585.098) (-583.018) -- 0:00:14
762000 -- (-587.646) (-584.836) (-584.677) [-585.462] * (-587.026) (-585.812) (-584.257) [-584.933] -- 0:00:14
762500 -- [-586.425] (-584.231) (-585.784) (-588.279) * [-588.926] (-584.315) (-585.016) (-586.060) -- 0:00:14
763000 -- [-585.509] (-586.533) (-587.858) (-589.652) * [-585.409] (-583.733) (-586.474) (-583.637) -- 0:00:14
763500 -- (-584.098) [-583.562] (-585.059) (-587.863) * [-585.956] (-588.917) (-585.073) (-585.567) -- 0:00:14
764000 -- (-584.485) [-587.982] (-587.522) (-589.947) * [-583.914] (-583.141) (-585.212) (-584.888) -- 0:00:14
764500 -- [-584.518] (-586.564) (-584.443) (-585.001) * (-587.375) (-585.443) (-583.107) [-583.734] -- 0:00:14
765000 -- (-585.773) (-589.737) (-584.556) [-583.409] * (-584.504) [-584.478] (-585.091) (-586.205) -- 0:00:14
Average standard deviation of split frequencies: 0.007856
765500 -- (-584.108) [-586.345] (-587.611) (-584.275) * (-587.726) [-584.689] (-587.455) (-584.248) -- 0:00:14
766000 -- (-585.077) (-584.668) [-585.302] (-584.332) * [-584.129] (-588.151) (-588.379) (-585.152) -- 0:00:14
766500 -- (-585.174) (-588.450) (-584.369) [-585.401] * [-583.512] (-585.005) (-585.122) (-585.279) -- 0:00:14
767000 -- (-587.064) (-584.830) [-585.348] (-584.695) * (-587.571) (-586.367) [-585.840] (-588.164) -- 0:00:13
767500 -- (-588.964) (-583.224) (-583.616) [-585.962] * (-590.801) (-591.367) (-585.450) [-587.990] -- 0:00:13
768000 -- (-585.685) (-585.969) (-586.273) [-584.305] * [-584.880] (-586.781) (-583.855) (-584.953) -- 0:00:13
768500 -- (-584.584) (-586.881) [-585.197] (-584.512) * (-584.770) (-582.871) [-584.451] (-584.892) -- 0:00:13
769000 -- (-585.896) [-584.697] (-583.191) (-585.047) * (-585.225) (-585.046) [-590.273] (-584.077) -- 0:00:13
769500 -- (-585.542) [-583.410] (-585.606) (-584.165) * [-588.940] (-587.438) (-586.527) (-586.956) -- 0:00:13
770000 -- (-583.286) [-583.019] (-584.021) (-584.318) * (-585.922) (-586.535) (-586.376) [-587.597] -- 0:00:13
Average standard deviation of split frequencies: 0.008132
770500 -- (-583.345) [-598.861] (-586.776) (-585.137) * (-584.175) [-584.752] (-583.624) (-588.953) -- 0:00:13
771000 -- (-584.335) (-594.366) (-584.688) [-583.400] * (-584.043) [-584.723] (-588.322) (-591.270) -- 0:00:13
771500 -- [-585.898] (-586.329) (-585.741) (-584.303) * [-583.759] (-585.218) (-588.034) (-583.780) -- 0:00:13
772000 -- (-586.979) (-586.676) [-585.445] (-585.822) * (-583.482) (-588.801) (-587.393) [-583.215] -- 0:00:13
772500 -- (-592.078) (-585.320) (-585.486) [-583.370] * [-586.914] (-587.884) (-586.900) (-584.243) -- 0:00:13
773000 -- [-586.643] (-588.419) (-583.987) (-589.417) * [-584.166] (-583.813) (-587.424) (-584.972) -- 0:00:13
773500 -- (-583.887) [-587.043] (-583.978) (-584.557) * (-586.362) (-583.472) (-585.227) [-584.068] -- 0:00:13
774000 -- (-584.462) (-585.741) (-584.452) [-583.340] * (-585.240) (-584.787) [-586.304] (-587.112) -- 0:00:13
774500 -- (-585.406) [-588.205] (-584.387) (-585.145) * [-584.588] (-584.475) (-588.145) (-585.199) -- 0:00:13
775000 -- (-587.710) [-586.110] (-586.737) (-585.352) * (-586.248) [-584.635] (-583.635) (-583.244) -- 0:00:13
Average standard deviation of split frequencies: 0.008112
775500 -- (-584.620) (-585.019) (-584.487) [-590.184] * (-586.387) [-585.146] (-583.006) (-583.373) -- 0:00:13
776000 -- [-583.216] (-587.240) (-586.167) (-585.554) * (-584.931) [-587.189] (-585.016) (-585.707) -- 0:00:13
776500 -- [-584.859] (-585.690) (-584.003) (-591.209) * (-586.737) [-585.253] (-587.102) (-584.751) -- 0:00:13
777000 -- (-585.105) (-583.138) [-587.560] (-589.357) * (-583.511) (-583.804) (-583.361) [-584.901] -- 0:00:13
777500 -- (-584.152) [-584.932] (-582.749) (-583.995) * (-583.963) [-584.264] (-584.077) (-587.756) -- 0:00:13
778000 -- (-583.000) [-585.156] (-588.482) (-583.412) * [-586.141] (-584.512) (-583.812) (-584.953) -- 0:00:13
778500 -- (-584.101) (-583.396) (-591.018) [-588.424] * (-584.551) (-583.813) [-584.184] (-585.395) -- 0:00:13
779000 -- (-586.649) (-584.589) [-586.971] (-584.983) * [-585.446] (-583.522) (-586.926) (-585.177) -- 0:00:13
779500 -- (-585.753) (-582.995) [-582.882] (-585.850) * (-586.520) [-584.017] (-584.766) (-585.984) -- 0:00:13
780000 -- [-583.212] (-583.051) (-585.163) (-586.202) * (-585.289) [-586.126] (-588.288) (-584.781) -- 0:00:13
Average standard deviation of split frequencies: 0.007815
780500 -- (-585.110) (-584.253) (-588.406) [-585.375] * (-586.904) (-584.723) [-585.139] (-584.542) -- 0:00:13
781000 -- (-584.475) [-582.916] (-587.016) (-588.706) * (-585.255) [-585.979] (-584.201) (-586.308) -- 0:00:13
781500 -- (-584.547) [-584.434] (-584.620) (-587.093) * (-585.658) (-586.966) [-583.569] (-585.070) -- 0:00:13
782000 -- (-585.301) (-583.329) [-587.246] (-586.568) * (-584.361) [-585.644] (-587.484) (-583.506) -- 0:00:13
782500 -- (-585.322) [-583.449] (-586.469) (-586.451) * (-583.973) (-585.906) (-586.580) [-584.413] -- 0:00:13
783000 -- (-587.984) (-584.908) (-586.120) [-584.656] * (-588.183) [-585.091] (-587.937) (-585.723) -- 0:00:13
783500 -- (-586.057) (-585.170) (-585.249) [-583.541] * (-584.426) (-583.335) [-584.680] (-586.158) -- 0:00:12
784000 -- (-588.757) (-584.612) (-585.253) [-584.873] * [-586.134] (-583.026) (-585.572) (-590.772) -- 0:00:12
784500 -- (-588.063) (-582.984) [-583.901] (-585.847) * (-591.374) (-585.806) (-588.850) [-585.440] -- 0:00:12
785000 -- (-583.681) (-583.725) (-592.887) [-584.221] * (-587.877) (-589.316) [-585.003] (-585.129) -- 0:00:12
Average standard deviation of split frequencies: 0.007938
785500 -- (-585.061) (-584.523) (-587.073) [-584.576] * [-588.259] (-585.431) (-585.984) (-583.658) -- 0:00:12
786000 -- [-583.671] (-584.254) (-583.487) (-585.044) * [-587.774] (-589.767) (-584.692) (-584.477) -- 0:00:12
786500 -- (-584.052) (-585.687) (-583.874) [-583.126] * (-584.149) (-586.804) [-584.217] (-584.238) -- 0:00:12
787000 -- (-584.688) [-586.347] (-584.199) (-588.268) * (-583.774) (-586.398) (-584.036) [-584.916] -- 0:00:12
787500 -- (-588.395) (-584.419) (-583.659) [-584.277] * (-584.435) [-585.579] (-584.747) (-585.357) -- 0:00:12
788000 -- (-584.302) (-588.049) [-585.202] (-587.448) * (-585.420) (-589.692) (-584.336) [-586.040] -- 0:00:12
788500 -- [-584.353] (-588.337) (-586.373) (-587.903) * [-585.429] (-590.567) (-585.687) (-583.884) -- 0:00:12
789000 -- [-583.767] (-585.700) (-587.090) (-585.547) * (-586.789) (-586.462) [-584.548] (-585.246) -- 0:00:12
789500 -- (-583.894) (-584.770) (-587.129) [-585.642] * (-586.318) (-584.113) [-584.453] (-584.964) -- 0:00:12
790000 -- [-582.841] (-583.924) (-584.522) (-584.680) * (-585.261) (-584.607) [-583.370] (-583.475) -- 0:00:12
Average standard deviation of split frequencies: 0.008101
790500 -- (-584.733) (-584.189) (-591.776) [-585.041] * (-586.988) [-582.943] (-588.090) (-583.933) -- 0:00:12
791000 -- (-582.844) [-586.675] (-584.449) (-584.581) * (-586.015) [-585.092] (-586.944) (-586.891) -- 0:00:12
791500 -- (-586.193) (-583.372) (-585.686) [-583.209] * (-584.701) (-583.521) [-584.104] (-587.069) -- 0:00:12
792000 -- (-584.499) (-583.227) [-584.143] (-586.140) * (-587.848) [-583.155] (-584.709) (-585.976) -- 0:00:12
792500 -- [-585.668] (-583.886) (-584.143) (-588.837) * (-586.994) (-583.848) (-587.294) [-585.916] -- 0:00:12
793000 -- (-584.893) (-584.160) [-585.924] (-586.035) * (-583.996) (-585.562) (-584.045) [-584.181] -- 0:00:12
793500 -- (-584.172) [-584.259] (-585.452) (-589.300) * [-584.804] (-587.448) (-583.727) (-583.677) -- 0:00:12
794000 -- (-584.323) (-583.991) (-591.008) [-585.706] * (-584.903) (-583.436) (-583.999) [-583.374] -- 0:00:12
794500 -- [-584.711] (-584.365) (-585.200) (-582.953) * [-583.165] (-584.625) (-585.281) (-584.475) -- 0:00:12
795000 -- (-584.716) (-586.538) [-586.265] (-583.817) * (-584.144) (-586.029) (-592.786) [-585.129] -- 0:00:12
Average standard deviation of split frequencies: 0.007629
795500 -- [-585.551] (-587.476) (-588.845) (-583.454) * (-586.359) (-585.872) (-592.209) [-584.354] -- 0:00:12
796000 -- [-584.522] (-586.006) (-585.969) (-586.834) * [-592.438] (-589.319) (-584.367) (-584.484) -- 0:00:12
796500 -- (-584.607) (-585.359) (-583.159) [-584.982] * [-594.937] (-586.435) (-586.362) (-582.829) -- 0:00:12
797000 -- [-583.445] (-585.417) (-583.269) (-584.806) * [-586.850] (-586.889) (-585.525) (-585.970) -- 0:00:12
797500 -- [-583.053] (-584.591) (-588.862) (-585.574) * (-591.328) [-585.788] (-584.966) (-585.115) -- 0:00:12
798000 -- [-583.050] (-584.667) (-583.140) (-585.767) * (-591.474) (-584.324) [-585.227] (-584.298) -- 0:00:12
798500 -- (-584.093) [-584.065] (-583.874) (-589.077) * (-584.024) (-586.181) [-587.020] (-583.829) -- 0:00:12
799000 -- (-585.366) (-585.144) (-584.759) [-584.529] * (-584.358) (-585.699) [-584.299] (-583.228) -- 0:00:12
799500 -- (-584.636) [-584.641] (-582.976) (-584.560) * [-589.096] (-583.572) (-587.823) (-583.076) -- 0:00:12
800000 -- [-583.739] (-586.183) (-583.557) (-585.069) * (-583.717) (-584.641) (-585.312) [-585.401] -- 0:00:12
Average standard deviation of split frequencies: 0.007412
800500 -- (-584.749) (-584.112) [-587.728] (-591.061) * (-593.298) (-583.550) (-589.083) [-584.438] -- 0:00:11
801000 -- [-585.634] (-584.475) (-584.458) (-587.587) * (-588.350) (-585.047) (-586.391) [-585.899] -- 0:00:11
801500 -- (-585.295) (-585.945) (-582.947) [-582.959] * (-588.023) (-586.554) [-586.548] (-587.691) -- 0:00:11
802000 -- [-583.549] (-586.847) (-587.674) (-582.961) * [-588.318] (-583.765) (-586.913) (-584.722) -- 0:00:11
802500 -- (-587.892) (-585.660) (-584.691) [-582.916] * (-584.753) [-583.799] (-586.116) (-586.196) -- 0:00:11
803000 -- (-585.306) (-585.182) (-586.195) [-584.065] * (-585.720) (-585.850) [-585.314] (-587.797) -- 0:00:11
803500 -- (-584.755) (-585.716) [-584.092] (-583.596) * (-587.686) (-588.215) (-584.539) [-591.972] -- 0:00:11
804000 -- (-585.793) (-585.043) (-585.230) [-586.175] * (-587.858) (-583.646) [-583.734] (-585.304) -- 0:00:11
804500 -- (-584.093) [-584.330] (-588.050) (-589.166) * (-588.656) (-584.624) [-587.047] (-587.216) -- 0:00:11
805000 -- (-589.403) (-584.549) [-583.691] (-588.570) * (-584.708) (-582.955) [-584.220] (-585.111) -- 0:00:11
Average standard deviation of split frequencies: 0.007775
805500 -- (-589.066) [-585.613] (-585.188) (-587.110) * (-588.983) (-587.342) (-587.877) [-583.076] -- 0:00:11
806000 -- (-584.497) (-585.039) [-583.951] (-584.723) * (-586.787) (-583.691) [-584.588] (-584.912) -- 0:00:11
806500 -- (-585.087) (-585.757) (-586.954) [-585.609] * (-583.686) [-585.016] (-590.671) (-584.711) -- 0:00:11
807000 -- [-587.173] (-584.693) (-584.660) (-584.190) * (-586.892) (-583.095) [-584.616] (-586.339) -- 0:00:11
807500 -- [-587.000] (-584.927) (-584.124) (-585.117) * (-583.325) [-583.953] (-583.215) (-585.009) -- 0:00:11
808000 -- (-584.752) (-589.133) [-583.468] (-585.168) * [-584.475] (-585.015) (-586.745) (-585.434) -- 0:00:11
808500 -- (-583.651) (-587.172) (-585.514) [-585.009] * (-584.498) (-585.952) (-587.533) [-584.546] -- 0:00:11
809000 -- (-583.986) [-584.272] (-584.244) (-584.094) * (-584.214) (-585.332) [-589.376] (-585.750) -- 0:00:11
809500 -- (-588.029) (-586.572) [-583.322] (-586.560) * [-583.671] (-582.779) (-588.402) (-586.567) -- 0:00:11
810000 -- (-586.489) (-583.906) [-585.881] (-588.544) * (-584.694) (-587.645) [-584.238] (-584.745) -- 0:00:11
Average standard deviation of split frequencies: 0.007320
810500 -- (-589.946) (-583.829) (-588.269) [-585.350] * (-586.817) (-585.013) [-583.832] (-589.955) -- 0:00:11
811000 -- (-591.914) (-589.485) (-584.822) [-586.785] * (-586.479) [-583.797] (-587.719) (-584.198) -- 0:00:11
811500 -- [-585.126] (-588.375) (-583.432) (-583.816) * (-588.653) (-582.811) [-585.634] (-586.178) -- 0:00:11
812000 -- (-583.868) [-584.965] (-583.934) (-586.592) * [-585.045] (-584.167) (-583.696) (-586.266) -- 0:00:11
812500 -- (-589.367) (-585.557) (-586.709) [-585.274] * (-584.606) (-584.224) (-585.743) [-586.207] -- 0:00:11
813000 -- [-583.670] (-587.204) (-583.887) (-583.618) * (-588.293) [-586.439] (-587.359) (-588.043) -- 0:00:11
813500 -- (-586.964) [-585.381] (-584.111) (-583.790) * (-584.600) (-585.536) (-586.101) [-582.924] -- 0:00:11
814000 -- [-585.953] (-584.759) (-587.182) (-583.915) * (-586.482) (-585.478) (-586.069) [-583.974] -- 0:00:11
814500 -- (-584.866) (-585.845) [-583.766] (-585.012) * (-590.397) (-582.862) [-584.543] (-584.200) -- 0:00:11
815000 -- (-587.160) [-583.373] (-583.960) (-586.214) * (-588.987) [-583.198] (-583.757) (-584.650) -- 0:00:11
Average standard deviation of split frequencies: 0.007714
815500 -- (-586.063) (-586.687) [-584.325] (-585.755) * (-585.111) [-590.959] (-583.532) (-585.150) -- 0:00:11
816000 -- [-584.291] (-589.611) (-583.491) (-588.395) * (-588.636) [-582.942] (-584.593) (-589.634) -- 0:00:11
816500 -- (-589.122) (-586.146) (-583.797) [-584.320] * [-586.438] (-582.920) (-587.549) (-585.115) -- 0:00:11
817000 -- (-584.923) (-585.760) [-584.324] (-587.759) * (-589.809) (-583.130) [-585.790] (-586.648) -- 0:00:10
817500 -- [-585.692] (-584.171) (-586.329) (-586.230) * (-585.129) (-584.461) (-584.506) [-584.052] -- 0:00:10
818000 -- (-584.539) (-585.738) [-584.010] (-585.552) * (-584.812) (-584.863) (-584.089) [-585.178] -- 0:00:10
818500 -- [-586.454] (-583.493) (-584.431) (-586.447) * (-587.163) (-583.848) (-584.278) [-586.153] -- 0:00:10
819000 -- [-587.812] (-583.034) (-583.727) (-583.436) * [-586.190] (-584.408) (-582.948) (-583.751) -- 0:00:10
819500 -- [-589.023] (-585.331) (-582.821) (-585.121) * (-585.059) [-585.000] (-586.302) (-584.298) -- 0:00:10
820000 -- [-586.438] (-586.689) (-584.651) (-586.850) * (-584.354) (-584.501) [-584.507] (-584.658) -- 0:00:10
Average standard deviation of split frequencies: 0.007501
820500 -- (-587.387) (-583.827) [-584.866] (-585.890) * (-584.231) (-585.631) [-584.466] (-584.461) -- 0:00:10
821000 -- (-584.759) [-583.909] (-587.787) (-584.844) * (-592.357) (-584.833) (-586.308) [-587.578] -- 0:00:10
821500 -- (-586.958) (-584.209) (-587.494) [-588.354] * (-584.177) (-583.632) (-584.608) [-586.052] -- 0:00:10
822000 -- (-584.525) (-584.409) [-583.328] (-592.150) * (-584.248) [-583.941] (-585.283) (-583.986) -- 0:00:10
822500 -- (-589.350) [-588.829] (-583.419) (-589.021) * (-587.314) (-586.700) [-582.908] (-583.583) -- 0:00:10
823000 -- (-584.724) (-585.117) (-584.593) [-584.854] * (-583.909) (-587.740) [-585.049] (-584.522) -- 0:00:10
823500 -- (-584.831) (-588.745) [-584.108] (-588.476) * [-585.787] (-585.337) (-584.734) (-583.870) -- 0:00:10
824000 -- (-587.663) (-586.575) (-586.613) [-586.333] * (-584.897) (-586.442) [-584.061] (-584.994) -- 0:00:10
824500 -- [-584.000] (-584.691) (-587.075) (-584.612) * (-584.850) (-584.365) (-583.611) [-583.317] -- 0:00:10
825000 -- (-584.668) (-586.125) [-587.201] (-587.588) * (-584.873) (-584.830) (-585.536) [-583.567] -- 0:00:10
Average standard deviation of split frequencies: 0.007520
825500 -- (-587.436) (-583.691) (-588.073) [-584.847] * (-585.054) (-585.931) (-584.541) [-584.157] -- 0:00:10
826000 -- (-585.261) (-584.413) (-585.912) [-584.072] * [-585.470] (-587.947) (-582.960) (-585.519) -- 0:00:10
826500 -- (-587.703) (-589.497) (-584.578) [-583.597] * (-584.749) (-583.191) [-582.947] (-587.660) -- 0:00:10
827000 -- [-584.459] (-585.059) (-583.587) (-591.408) * (-586.894) (-583.043) (-584.414) [-583.770] -- 0:00:10
827500 -- (-585.949) [-583.490] (-583.730) (-586.645) * (-584.188) (-587.023) (-584.522) [-585.000] -- 0:00:10
828000 -- (-585.044) (-583.817) [-583.213] (-587.572) * (-585.023) (-585.730) (-585.687) [-585.141] -- 0:00:10
828500 -- (-585.262) [-585.992] (-585.603) (-583.500) * (-585.942) [-584.726] (-587.206) (-586.851) -- 0:00:10
829000 -- (-585.995) [-585.712] (-583.305) (-585.279) * (-586.532) [-584.622] (-585.059) (-585.224) -- 0:00:10
829500 -- (-584.935) (-586.503) [-585.252] (-583.917) * (-585.640) (-593.309) [-584.876] (-585.759) -- 0:00:10
830000 -- (-584.384) [-584.500] (-585.216) (-583.464) * (-586.539) (-595.489) [-583.529] (-592.073) -- 0:00:10
Average standard deviation of split frequencies: 0.007678
830500 -- (-585.628) [-585.424] (-583.702) (-589.248) * (-589.457) [-584.561] (-585.557) (-585.460) -- 0:00:10
831000 -- (-583.942) (-585.407) (-585.597) [-582.899] * (-586.415) (-583.792) [-583.693] (-585.651) -- 0:00:10
831500 -- [-584.664] (-586.813) (-586.267) (-585.550) * (-584.794) (-583.319) [-583.130] (-590.001) -- 0:00:10
832000 -- (-583.777) (-590.511) (-583.873) [-583.446] * (-586.655) (-584.677) (-586.265) [-583.949] -- 0:00:10
832500 -- (-583.381) [-585.219] (-582.881) (-588.172) * (-585.485) (-584.404) [-588.178] (-584.489) -- 0:00:10
833000 -- (-584.123) [-584.985] (-583.194) (-584.331) * (-585.704) [-583.561] (-585.127) (-584.455) -- 0:00:10
833500 -- (-584.451) (-584.544) (-583.767) [-584.232] * (-586.529) [-583.216] (-585.540) (-585.907) -- 0:00:09
834000 -- (-586.985) [-582.943] (-583.796) (-585.403) * [-583.287] (-582.937) (-583.645) (-589.534) -- 0:00:09
834500 -- [-583.720] (-584.523) (-583.237) (-584.570) * (-583.620) (-584.218) (-586.830) [-587.171] -- 0:00:09
835000 -- (-583.015) (-585.722) (-584.900) [-590.087] * (-584.124) (-584.134) [-585.092] (-585.628) -- 0:00:09
Average standard deviation of split frequencies: 0.007401
835500 -- (-587.593) (-586.587) (-583.972) [-584.499] * (-585.261) [-584.598] (-583.951) (-584.982) -- 0:00:09
836000 -- [-585.971] (-586.529) (-585.320) (-583.410) * [-587.326] (-586.699) (-588.419) (-584.561) -- 0:00:09
836500 -- (-585.085) (-584.737) [-587.596] (-585.252) * (-588.021) (-583.371) (-583.731) [-588.764] -- 0:00:09
837000 -- (-585.510) (-586.449) (-588.901) [-584.008] * (-585.807) (-586.034) (-587.190) [-584.851] -- 0:00:09
837500 -- (-582.905) [-586.131] (-586.686) (-585.530) * (-583.248) (-585.136) (-586.096) [-583.526] -- 0:00:09
838000 -- [-585.249] (-587.061) (-589.505) (-586.579) * (-584.287) (-586.824) [-586.832] (-585.896) -- 0:00:09
838500 -- [-584.397] (-586.652) (-585.959) (-585.213) * [-584.431] (-585.254) (-586.243) (-589.734) -- 0:00:09
839000 -- (-586.641) (-584.862) [-583.973] (-589.388) * (-584.083) (-585.126) (-586.734) [-585.524] -- 0:00:09
839500 -- (-585.958) [-584.975] (-585.758) (-586.222) * (-586.345) (-583.308) (-583.790) [-584.254] -- 0:00:09
840000 -- (-587.640) (-583.849) (-586.538) [-584.012] * [-584.891] (-584.092) (-584.123) (-583.866) -- 0:00:09
Average standard deviation of split frequencies: 0.007044
840500 -- [-588.347] (-583.861) (-583.169) (-585.385) * (-584.578) (-586.446) [-583.947] (-585.033) -- 0:00:09
841000 -- (-585.277) (-587.344) (-583.951) [-585.629] * (-587.526) (-587.313) (-586.523) [-586.581] -- 0:00:09
841500 -- [-583.465] (-586.590) (-584.513) (-587.262) * (-587.418) (-584.497) [-582.982] (-584.663) -- 0:00:09
842000 -- (-584.679) (-585.438) (-584.123) [-583.435] * (-588.026) (-583.591) (-584.673) [-585.405] -- 0:00:09
842500 -- (-584.537) (-584.114) (-583.837) [-584.331] * (-586.435) [-584.819] (-585.620) (-586.750) -- 0:00:09
843000 -- (-587.999) [-583.806] (-583.893) (-590.380) * (-590.319) (-584.948) (-583.500) [-585.790] -- 0:00:09
843500 -- (-587.886) (-584.436) [-585.422] (-588.880) * (-585.800) (-583.693) [-586.539] (-586.068) -- 0:00:09
844000 -- (-589.515) [-583.602] (-584.264) (-589.078) * (-584.687) (-585.630) [-585.660] (-591.068) -- 0:00:09
844500 -- [-588.057] (-584.480) (-584.249) (-587.319) * [-583.862] (-584.442) (-585.527) (-584.100) -- 0:00:09
845000 -- (-584.857) (-584.137) [-584.098] (-584.813) * (-584.622) (-587.934) [-586.876] (-585.091) -- 0:00:09
Average standard deviation of split frequencies: 0.007488
845500 -- (-585.152) (-583.821) [-584.118] (-585.088) * [-584.621] (-587.807) (-585.235) (-584.447) -- 0:00:09
846000 -- (-584.359) [-584.219] (-586.250) (-585.656) * (-584.407) [-585.209] (-585.779) (-586.968) -- 0:00:09
846500 -- [-583.195] (-583.451) (-590.549) (-583.373) * (-584.471) [-586.052] (-586.699) (-587.652) -- 0:00:09
847000 -- (-583.491) (-584.804) (-589.000) [-584.938] * (-585.584) [-587.436] (-584.947) (-585.284) -- 0:00:09
847500 -- (-587.670) (-586.229) (-583.877) [-584.138] * [-584.227] (-585.986) (-591.043) (-587.239) -- 0:00:09
848000 -- (-586.805) (-588.388) (-585.895) [-585.677] * (-585.606) [-585.532] (-588.234) (-586.976) -- 0:00:09
848500 -- [-584.343] (-583.985) (-585.331) (-584.175) * (-586.149) [-588.391] (-585.988) (-587.198) -- 0:00:09
849000 -- (-585.787) (-584.588) (-587.819) [-585.862] * (-589.533) (-583.481) [-585.460] (-586.704) -- 0:00:09
849500 -- (-585.685) (-586.592) (-587.911) [-583.521] * (-592.433) (-587.057) [-584.090] (-583.891) -- 0:00:09
850000 -- (-587.888) (-585.218) (-586.302) [-583.975] * (-591.277) (-583.383) [-583.930] (-584.760) -- 0:00:09
Average standard deviation of split frequencies: 0.007343
850500 -- [-585.245] (-586.581) (-584.416) (-590.966) * (-584.791) (-583.767) (-583.646) [-587.388] -- 0:00:08
851000 -- (-585.270) (-584.433) [-584.073] (-588.632) * (-584.595) (-588.766) (-589.179) [-584.976] -- 0:00:08
851500 -- (-585.192) (-585.647) [-583.156] (-587.426) * (-585.542) [-583.884] (-586.516) (-587.608) -- 0:00:08
852000 -- (-584.629) (-583.950) [-583.296] (-590.559) * (-584.172) (-586.126) (-588.933) [-583.740] -- 0:00:08
852500 -- (-588.369) (-586.934) [-583.048] (-588.289) * [-586.597] (-583.524) (-587.144) (-583.214) -- 0:00:08
853000 -- (-584.420) [-583.855] (-583.064) (-586.357) * [-586.424] (-585.006) (-583.545) (-584.753) -- 0:00:08
853500 -- (-584.128) [-584.671] (-584.124) (-588.560) * [-585.370] (-588.984) (-584.190) (-585.045) -- 0:00:08
854000 -- [-587.087] (-585.845) (-583.320) (-584.944) * [-583.968] (-586.072) (-583.552) (-587.069) -- 0:00:08
854500 -- (-584.018) (-584.539) (-583.057) [-584.421] * (-584.288) [-583.281] (-584.291) (-586.975) -- 0:00:08
855000 -- (-586.789) (-585.902) (-586.627) [-585.376] * (-589.260) (-584.063) [-584.680] (-583.390) -- 0:00:08
Average standard deviation of split frequencies: 0.007056
855500 -- (-587.361) (-584.876) (-586.852) [-586.561] * [-587.078] (-586.622) (-584.050) (-585.180) -- 0:00:08
856000 -- (-584.858) (-586.169) [-587.428] (-584.593) * (-587.410) (-585.218) (-584.924) [-584.469] -- 0:00:08
856500 -- (-585.337) (-584.447) (-586.733) [-588.513] * [-586.491] (-585.133) (-584.905) (-588.863) -- 0:00:08
857000 -- (-584.184) (-582.959) [-585.589] (-583.940) * [-587.669] (-585.463) (-584.784) (-587.975) -- 0:00:08
857500 -- (-588.214) (-585.182) (-584.034) [-583.349] * (-583.597) [-584.554] (-583.990) (-587.480) -- 0:00:08
858000 -- (-584.097) (-584.666) [-587.446] (-585.853) * (-584.442) (-584.856) (-585.414) [-586.678] -- 0:00:08
858500 -- (-584.391) (-584.861) (-584.951) [-586.679] * (-583.592) (-583.961) [-587.679] (-585.222) -- 0:00:08
859000 -- (-583.847) (-586.299) [-586.650] (-584.806) * (-583.706) (-585.361) [-583.220] (-584.682) -- 0:00:08
859500 -- [-584.541] (-585.629) (-587.434) (-587.136) * (-587.243) [-585.521] (-584.758) (-583.019) -- 0:00:08
860000 -- (-583.021) [-586.743] (-587.010) (-585.699) * (-586.822) (-586.425) (-585.932) [-582.964] -- 0:00:08
Average standard deviation of split frequencies: 0.006778
860500 -- (-584.200) (-582.664) [-585.285] (-590.414) * (-586.030) (-584.973) (-582.789) [-588.742] -- 0:00:08
861000 -- (-591.740) (-583.583) (-586.574) [-590.738] * (-583.613) [-583.565] (-583.400) (-588.097) -- 0:00:08
861500 -- [-586.208] (-586.381) (-584.978) (-585.149) * (-584.875) [-584.594] (-588.519) (-584.243) -- 0:00:08
862000 -- [-584.324] (-586.321) (-584.100) (-584.470) * (-586.864) (-583.111) [-588.158] (-587.632) -- 0:00:08
862500 -- (-586.694) [-583.969] (-586.791) (-586.031) * [-585.474] (-585.236) (-587.053) (-584.798) -- 0:00:08
863000 -- (-583.243) [-583.429] (-585.543) (-584.819) * (-586.526) (-584.720) [-584.110] (-588.317) -- 0:00:08
863500 -- (-583.232) (-583.474) [-583.877] (-586.294) * (-584.225) (-584.875) (-584.279) [-584.384] -- 0:00:08
864000 -- (-586.770) (-584.651) (-584.563) [-586.125] * (-584.172) [-585.006] (-583.638) (-587.251) -- 0:00:08
864500 -- [-585.583] (-584.153) (-587.301) (-587.518) * [-585.784] (-583.527) (-584.277) (-585.135) -- 0:00:08
865000 -- (-586.921) (-583.841) (-587.996) [-586.122] * (-582.982) (-587.715) [-585.332] (-586.164) -- 0:00:08
Average standard deviation of split frequencies: 0.006600
865500 -- (-588.259) (-586.048) (-585.439) [-586.279] * (-587.340) (-586.228) (-589.709) [-583.622] -- 0:00:08
866000 -- (-586.523) (-584.248) (-583.650) [-582.882] * (-590.132) (-586.657) (-586.250) [-583.210] -- 0:00:08
866500 -- (-584.950) (-586.528) [-584.556] (-583.145) * (-583.667) [-586.936] (-585.335) (-585.853) -- 0:00:08
867000 -- (-587.305) (-588.899) (-586.768) [-583.324] * (-586.549) [-583.386] (-588.384) (-583.589) -- 0:00:07
867500 -- (-583.771) (-588.776) (-584.246) [-584.761] * (-584.903) [-584.439] (-584.406) (-583.356) -- 0:00:07
868000 -- [-582.998] (-585.508) (-585.109) (-585.960) * (-587.088) [-586.789] (-584.317) (-590.558) -- 0:00:07
868500 -- (-584.759) (-584.753) (-584.127) [-583.562] * (-585.583) [-585.884] (-584.958) (-586.228) -- 0:00:07
869000 -- (-583.936) (-584.747) [-583.932] (-583.889) * (-585.979) (-586.728) [-584.120] (-586.792) -- 0:00:07
869500 -- (-585.638) (-585.778) [-585.268] (-585.282) * (-584.321) (-585.462) [-584.716] (-584.367) -- 0:00:07
870000 -- (-590.805) [-591.360] (-585.508) (-585.793) * [-583.865] (-586.944) (-584.283) (-585.602) -- 0:00:07
Average standard deviation of split frequencies: 0.006734
870500 -- (-585.490) (-583.480) (-583.632) [-586.025] * (-585.565) (-585.459) [-586.151] (-585.821) -- 0:00:07
871000 -- (-586.344) (-586.431) (-583.914) [-589.210] * [-586.735] (-586.429) (-584.286) (-584.662) -- 0:00:07
871500 -- (-584.793) [-586.445] (-585.406) (-591.481) * (-585.481) (-585.950) (-588.259) [-584.747] -- 0:00:07
872000 -- (-585.855) (-587.011) [-584.661] (-585.638) * (-584.320) [-585.476] (-584.494) (-584.574) -- 0:00:07
872500 -- (-587.254) (-585.480) (-585.210) [-586.012] * [-586.108] (-584.002) (-585.644) (-584.123) -- 0:00:07
873000 -- [-589.541] (-585.185) (-585.210) (-585.864) * (-584.089) (-586.311) (-585.701) [-586.038] -- 0:00:07
873500 -- [-587.694] (-583.743) (-585.029) (-589.220) * (-583.309) [-585.843] (-585.931) (-584.384) -- 0:00:07
874000 -- (-583.831) (-584.160) (-588.629) [-590.865] * (-585.639) (-585.377) [-583.652] (-587.372) -- 0:00:07
874500 -- [-584.429] (-584.381) (-583.060) (-585.383) * [-584.428] (-586.655) (-583.136) (-587.399) -- 0:00:07
875000 -- (-584.514) [-586.787] (-587.074) (-584.523) * (-586.376) (-583.266) (-583.135) [-583.046] -- 0:00:07
Average standard deviation of split frequencies: 0.007097
875500 -- [-583.027] (-587.671) (-586.472) (-584.430) * (-586.048) (-585.180) (-584.475) [-585.876] -- 0:00:07
876000 -- (-586.276) [-595.047] (-585.882) (-585.022) * (-582.808) (-587.838) (-584.980) [-587.238] -- 0:00:07
876500 -- (-584.852) (-584.668) [-585.608] (-583.153) * (-585.575) (-586.576) [-583.913] (-583.939) -- 0:00:07
877000 -- (-586.316) [-583.608] (-584.971) (-583.964) * (-591.701) [-586.017] (-584.530) (-584.470) -- 0:00:07
877500 -- [-585.524] (-584.660) (-587.115) (-585.936) * (-590.952) (-583.650) [-586.108] (-584.356) -- 0:00:07
878000 -- (-583.064) (-586.269) (-582.793) [-584.373] * (-584.180) (-587.750) [-582.865] (-583.736) -- 0:00:07
878500 -- (-585.385) (-584.516) [-584.667] (-586.895) * (-587.157) [-587.367] (-583.179) (-586.772) -- 0:00:07
879000 -- (-584.603) (-584.627) (-587.657) [-584.451] * [-584.873] (-590.263) (-584.003) (-586.410) -- 0:00:07
879500 -- [-586.152] (-585.188) (-584.785) (-584.624) * (-588.693) (-588.493) (-584.482) [-585.275] -- 0:00:07
880000 -- [-583.501] (-584.001) (-584.470) (-584.588) * (-584.704) [-585.310] (-584.714) (-586.162) -- 0:00:07
Average standard deviation of split frequencies: 0.007126
880500 -- [-584.172] (-583.982) (-585.030) (-583.290) * (-590.246) (-586.954) (-583.689) [-584.252] -- 0:00:07
881000 -- (-583.086) [-584.803] (-583.958) (-583.935) * (-589.197) (-583.574) [-583.637] (-585.243) -- 0:00:07
881500 -- (-584.772) [-587.076] (-585.644) (-584.841) * (-583.261) (-585.018) [-584.559] (-584.535) -- 0:00:07
882000 -- (-585.310) [-583.910] (-589.226) (-584.745) * [-583.044] (-583.648) (-594.982) (-585.337) -- 0:00:07
882500 -- (-583.383) (-583.282) [-585.354] (-583.204) * [-583.926] (-584.303) (-583.941) (-586.749) -- 0:00:07
883000 -- (-583.266) [-584.375] (-585.710) (-584.074) * (-584.362) (-583.705) [-584.123] (-586.496) -- 0:00:07
883500 -- (-584.046) (-585.216) (-585.177) [-583.581] * (-585.794) (-585.352) (-586.148) [-586.306] -- 0:00:06
884000 -- [-585.177] (-584.941) (-583.870) (-588.167) * (-584.925) (-587.502) (-583.404) [-584.371] -- 0:00:06
884500 -- (-585.216) [-585.454] (-584.381) (-585.195) * (-583.775) (-583.846) (-583.384) [-587.404] -- 0:00:06
885000 -- (-589.245) (-585.419) [-585.433] (-584.398) * (-584.612) [-584.592] (-584.093) (-585.932) -- 0:00:06
Average standard deviation of split frequencies: 0.007083
885500 -- (-587.474) (-583.805) [-583.606] (-583.147) * (-587.452) [-591.796] (-583.372) (-584.496) -- 0:00:06
886000 -- (-583.389) [-584.454] (-585.412) (-583.769) * (-588.583) (-585.862) [-585.923] (-587.137) -- 0:00:06
886500 -- (-585.337) (-586.589) (-584.923) [-584.183] * (-585.358) [-584.711] (-586.064) (-586.306) -- 0:00:06
887000 -- [-585.955] (-585.576) (-584.852) (-584.229) * (-587.317) [-585.240] (-584.991) (-585.261) -- 0:00:06
887500 -- [-585.289] (-588.036) (-588.133) (-582.890) * (-586.026) [-586.515] (-585.539) (-583.963) -- 0:00:06
888000 -- (-585.074) [-587.431] (-586.011) (-584.451) * (-582.870) (-586.532) [-584.197] (-584.210) -- 0:00:06
888500 -- (-583.362) [-583.631] (-585.051) (-583.797) * (-583.003) (-585.986) [-583.269] (-586.283) -- 0:00:06
889000 -- (-583.425) (-587.021) [-585.795] (-586.479) * (-586.725) (-585.037) (-584.620) [-585.715] -- 0:00:06
889500 -- [-583.113] (-584.694) (-588.980) (-583.541) * [-583.074] (-588.000) (-585.647) (-584.824) -- 0:00:06
890000 -- (-583.376) (-585.035) (-586.399) [-582.637] * (-583.616) (-589.348) (-584.925) [-583.297] -- 0:00:06
Average standard deviation of split frequencies: 0.007013
890500 -- (-582.839) (-588.204) [-585.639] (-582.835) * (-584.854) [-585.135] (-583.881) (-583.280) -- 0:00:06
891000 -- (-583.315) (-585.083) [-585.205] (-583.441) * (-583.996) [-582.683] (-585.100) (-584.558) -- 0:00:06
891500 -- [-586.564] (-587.110) (-588.770) (-584.614) * (-588.455) (-584.068) [-583.441] (-583.936) -- 0:00:06
892000 -- (-586.522) [-586.406] (-585.610) (-586.743) * (-584.682) (-583.733) [-586.685] (-587.580) -- 0:00:06
892500 -- (-585.254) (-583.987) (-587.572) [-584.355] * [-586.452] (-584.007) (-585.025) (-583.162) -- 0:00:06
893000 -- (-583.961) (-586.921) [-584.018] (-586.273) * [-583.531] (-584.102) (-586.656) (-585.118) -- 0:00:06
893500 -- [-585.818] (-585.503) (-586.002) (-584.824) * [-590.578] (-586.066) (-588.008) (-583.715) -- 0:00:06
894000 -- (-584.646) (-584.568) (-583.182) [-584.953] * [-584.841] (-585.396) (-586.137) (-584.222) -- 0:00:06
894500 -- (-584.528) (-585.283) (-587.301) [-586.787] * (-584.866) (-588.386) [-583.638] (-590.728) -- 0:00:06
895000 -- [-585.214] (-583.844) (-584.306) (-585.608) * (-585.187) (-584.729) [-589.416] (-589.569) -- 0:00:06
Average standard deviation of split frequencies: 0.007070
895500 -- [-585.613] (-584.168) (-583.353) (-587.038) * [-585.648] (-584.441) (-583.526) (-587.978) -- 0:00:06
896000 -- (-585.602) (-586.132) (-583.398) [-585.539] * (-587.873) (-583.542) [-587.773] (-587.464) -- 0:00:06
896500 -- (-590.489) [-583.752] (-584.259) (-586.025) * (-589.212) [-585.601] (-584.832) (-584.129) -- 0:00:06
897000 -- (-585.492) (-583.847) [-585.642] (-585.371) * (-586.381) (-585.676) [-585.175] (-583.311) -- 0:00:06
897500 -- (-585.641) [-583.879] (-590.301) (-583.857) * (-585.469) [-588.362] (-588.502) (-584.107) -- 0:00:06
898000 -- (-588.881) (-583.490) [-587.407] (-585.669) * (-589.773) (-587.164) [-588.361] (-585.407) -- 0:00:06
898500 -- (-585.037) [-585.350] (-586.481) (-583.555) * (-587.001) (-585.799) (-583.593) [-584.729] -- 0:00:06
899000 -- (-585.335) (-586.616) (-587.767) [-584.304] * (-585.145) (-586.143) [-584.339] (-583.109) -- 0:00:06
899500 -- (-583.508) (-583.481) (-586.324) [-586.035] * (-590.852) (-583.248) (-585.118) [-586.408] -- 0:00:06
900000 -- (-585.091) (-583.526) [-583.846] (-586.529) * (-584.260) (-587.207) (-591.762) [-583.363] -- 0:00:06
Average standard deviation of split frequencies: 0.006608
900500 -- [-584.822] (-587.165) (-583.169) (-586.055) * (-585.628) (-586.570) (-583.097) [-584.107] -- 0:00:05
901000 -- (-584.620) [-586.087] (-583.890) (-586.888) * (-585.028) [-583.043] (-584.439) (-583.100) -- 0:00:05
901500 -- [-585.450] (-584.475) (-584.092) (-588.292) * (-583.432) [-589.663] (-583.694) (-584.835) -- 0:00:05
902000 -- [-584.993] (-588.622) (-586.318) (-584.814) * (-583.399) [-584.843] (-587.093) (-590.216) -- 0:00:05
902500 -- (-583.964) (-588.494) (-586.730) [-585.125] * [-583.359] (-586.088) (-584.219) (-585.601) -- 0:00:05
903000 -- (-585.855) [-588.532] (-586.783) (-584.502) * [-587.434] (-584.703) (-582.843) (-585.038) -- 0:00:05
903500 -- (-587.385) (-587.834) (-584.452) [-583.829] * (-584.536) (-584.926) [-586.847] (-583.561) -- 0:00:05
904000 -- [-583.909] (-584.613) (-582.759) (-583.983) * (-585.256) [-586.150] (-584.421) (-588.400) -- 0:00:05
904500 -- (-585.287) (-586.392) [-583.063] (-585.816) * (-584.527) (-586.127) [-586.027] (-584.919) -- 0:00:05
905000 -- (-585.289) [-587.685] (-583.749) (-585.296) * (-583.854) (-583.135) [-583.002] (-588.881) -- 0:00:05
Average standard deviation of split frequencies: 0.006797
905500 -- (-583.387) (-585.660) [-584.149] (-586.707) * (-583.583) [-582.660] (-584.295) (-585.852) -- 0:00:05
906000 -- (-584.955) (-584.157) (-585.480) [-583.543] * (-584.987) (-584.377) (-586.779) [-587.149] -- 0:00:05
906500 -- [-584.583] (-585.849) (-586.590) (-583.289) * [-583.962] (-584.530) (-584.724) (-587.405) -- 0:00:05
907000 -- (-582.998) (-583.805) [-585.704] (-584.260) * (-586.124) [-585.191] (-582.986) (-585.737) -- 0:00:05
907500 -- (-583.369) (-583.485) (-586.344) [-584.300] * (-586.751) (-586.020) (-583.799) [-583.117] -- 0:00:05
908000 -- [-586.258] (-583.592) (-584.241) (-588.028) * (-586.500) [-585.491] (-592.821) (-583.957) -- 0:00:05
908500 -- (-589.099) (-585.298) (-586.159) [-583.636] * (-584.384) [-584.318] (-583.594) (-585.804) -- 0:00:05
909000 -- (-584.371) (-583.105) [-585.086] (-582.987) * (-585.907) [-583.474] (-585.514) (-585.693) -- 0:00:05
909500 -- (-585.941) (-586.235) [-583.760] (-583.902) * (-583.841) (-586.300) [-587.067] (-584.650) -- 0:00:05
910000 -- (-590.071) (-586.908) [-582.750] (-583.500) * (-584.949) (-585.689) (-584.918) [-585.450] -- 0:00:05
Average standard deviation of split frequencies: 0.006859
910500 -- (-585.746) (-584.018) (-588.657) [-584.944] * (-585.226) (-588.493) [-586.053] (-586.300) -- 0:00:05
911000 -- (-586.504) [-584.482] (-588.655) (-584.476) * [-582.718] (-586.139) (-584.041) (-583.470) -- 0:00:05
911500 -- (-586.976) [-586.240] (-588.297) (-585.078) * (-585.199) (-584.798) (-585.497) [-582.943] -- 0:00:05
912000 -- (-587.519) [-583.188] (-585.512) (-583.216) * (-583.971) (-586.302) [-584.580] (-584.721) -- 0:00:05
912500 -- (-585.511) (-585.627) [-583.860] (-589.731) * (-584.063) (-589.410) (-584.607) [-584.203] -- 0:00:05
913000 -- (-586.945) (-583.554) (-583.697) [-585.263] * (-586.030) (-584.827) (-583.954) [-585.085] -- 0:00:05
913500 -- (-585.735) [-582.978] (-583.810) (-583.867) * (-586.634) (-583.393) [-584.887] (-583.152) -- 0:00:05
914000 -- (-584.412) (-585.397) [-584.076] (-584.922) * [-585.420] (-586.138) (-586.351) (-584.157) -- 0:00:05
914500 -- (-584.775) (-585.719) (-585.941) [-588.477] * [-583.729] (-584.707) (-584.268) (-583.857) -- 0:00:05
915000 -- [-586.816] (-583.196) (-585.727) (-584.989) * (-583.307) (-585.175) (-584.860) [-586.068] -- 0:00:05
Average standard deviation of split frequencies: 0.006658
915500 -- (-585.576) (-583.872) [-586.581] (-586.889) * (-583.029) (-587.046) [-584.987] (-585.435) -- 0:00:05
916000 -- [-583.953] (-585.483) (-585.095) (-584.265) * [-583.858] (-582.952) (-584.615) (-584.026) -- 0:00:05
916500 -- [-584.886] (-588.020) (-584.386) (-583.897) * (-583.279) (-583.808) [-587.108] (-586.621) -- 0:00:05
917000 -- (-584.551) [-588.212] (-587.463) (-586.495) * (-583.133) (-583.263) [-583.916] (-585.878) -- 0:00:04
917500 -- (-585.191) (-583.927) [-589.781] (-584.362) * (-585.775) [-584.797] (-585.299) (-586.744) -- 0:00:04
918000 -- (-585.208) (-584.508) [-585.261] (-583.773) * (-586.096) (-583.454) [-583.448] (-587.588) -- 0:00:04
918500 -- (-585.849) (-585.711) [-582.984] (-585.877) * [-584.361] (-583.685) (-587.917) (-586.140) -- 0:00:04
919000 -- [-585.864] (-584.450) (-587.171) (-585.794) * (-582.961) (-587.349) (-587.285) [-587.019] -- 0:00:04
919500 -- (-583.835) (-584.944) (-585.480) [-585.677] * (-586.615) (-586.332) [-584.389] (-584.157) -- 0:00:04
920000 -- (-583.605) [-583.450] (-584.961) (-585.951) * (-585.880) (-584.032) (-583.973) [-584.739] -- 0:00:04
Average standard deviation of split frequencies: 0.007008
920500 -- [-584.526] (-584.615) (-583.544) (-585.550) * (-584.575) (-585.879) [-583.704] (-584.554) -- 0:00:04
921000 -- (-586.879) (-586.061) [-584.964] (-583.244) * (-583.466) (-584.206) [-585.302] (-585.700) -- 0:00:04
921500 -- [-586.021] (-583.056) (-590.071) (-583.347) * (-584.120) (-592.931) [-584.840] (-585.871) -- 0:00:04
922000 -- (-585.950) (-586.377) [-585.341] (-586.534) * (-583.982) (-587.409) (-584.863) [-585.350] -- 0:00:04
922500 -- (-588.622) (-584.963) [-584.278] (-588.761) * [-582.883] (-587.627) (-585.861) (-583.508) -- 0:00:04
923000 -- [-583.123] (-583.822) (-583.021) (-594.028) * (-584.460) [-585.689] (-585.404) (-585.969) -- 0:00:04
923500 -- [-584.645] (-585.355) (-582.954) (-584.185) * (-585.424) (-585.258) (-587.101) [-583.493] -- 0:00:04
924000 -- (-585.417) (-586.410) (-583.992) [-585.679] * [-584.595] (-587.080) (-583.976) (-585.203) -- 0:00:04
924500 -- (-590.004) (-585.916) (-586.213) [-583.360] * (-585.897) [-588.812] (-585.726) (-584.095) -- 0:00:04
925000 -- (-592.378) (-584.823) (-584.867) [-583.433] * (-585.603) [-589.430] (-586.090) (-585.745) -- 0:00:04
Average standard deviation of split frequencies: 0.006554
925500 -- (-586.612) (-584.969) [-584.427] (-583.483) * [-584.975] (-586.172) (-584.357) (-586.482) -- 0:00:04
926000 -- (-585.635) [-584.213] (-585.862) (-583.655) * [-588.929] (-584.551) (-584.179) (-584.702) -- 0:00:04
926500 -- (-584.850) (-584.832) [-588.485] (-585.582) * [-588.374] (-587.029) (-587.741) (-585.105) -- 0:00:04
927000 -- (-583.348) [-589.508] (-583.386) (-587.741) * (-587.297) [-585.682] (-589.726) (-586.329) -- 0:00:04
927500 -- (-583.862) [-583.675] (-589.388) (-588.291) * [-584.406] (-586.934) (-585.765) (-585.681) -- 0:00:04
928000 -- [-584.630] (-583.669) (-584.562) (-583.800) * (-584.890) (-586.364) [-584.501] (-587.370) -- 0:00:04
928500 -- [-584.502] (-583.617) (-585.319) (-583.671) * [-584.808] (-585.065) (-585.328) (-584.305) -- 0:00:04
929000 -- (-584.489) (-583.659) [-586.440] (-586.976) * (-583.457) (-585.074) (-589.885) [-583.212] -- 0:00:04
929500 -- (-584.019) (-584.153) [-586.642] (-588.926) * (-584.678) (-583.468) (-589.377) [-584.422] -- 0:00:04
930000 -- (-587.040) [-585.536] (-586.432) (-585.317) * (-589.278) [-587.699] (-584.317) (-586.868) -- 0:00:04
Average standard deviation of split frequencies: 0.006680
930500 -- (-584.723) (-588.550) [-583.389] (-585.278) * (-585.125) [-583.668] (-586.143) (-589.246) -- 0:00:04
931000 -- [-586.050] (-583.945) (-583.670) (-585.613) * (-586.289) [-585.025] (-583.238) (-585.207) -- 0:00:04
931500 -- (-587.526) [-585.259] (-583.523) (-587.107) * (-585.477) [-584.268] (-584.471) (-586.561) -- 0:00:04
932000 -- (-584.140) [-584.317] (-583.771) (-586.824) * [-587.932] (-585.543) (-583.833) (-583.112) -- 0:00:04
932500 -- [-584.603] (-585.480) (-586.067) (-583.428) * [-585.261] (-586.175) (-583.127) (-586.375) -- 0:00:04
933000 -- [-585.800] (-585.654) (-584.357) (-584.531) * (-587.099) [-583.606] (-586.510) (-583.816) -- 0:00:04
933500 -- (-587.859) [-584.271] (-584.905) (-589.165) * (-583.764) [-583.761] (-583.756) (-585.149) -- 0:00:03
934000 -- [-585.470] (-584.566) (-585.893) (-592.048) * (-583.471) [-583.946] (-589.863) (-585.566) -- 0:00:03
934500 -- (-586.270) [-583.643] (-586.359) (-585.048) * (-583.822) (-587.802) (-584.799) [-586.480] -- 0:00:03
935000 -- (-585.042) (-583.965) (-584.554) [-590.256] * (-585.655) (-586.440) [-586.041] (-586.765) -- 0:00:03
Average standard deviation of split frequencies: 0.006831
935500 -- (-584.490) (-585.975) (-585.163) [-584.631] * [-583.603] (-589.923) (-584.294) (-584.965) -- 0:00:03
936000 -- (-585.294) (-584.301) [-586.104] (-587.697) * [-583.886] (-589.029) (-584.749) (-583.855) -- 0:00:03
936500 -- (-585.202) (-585.923) (-583.684) [-586.202] * (-584.966) (-587.358) [-585.244] (-585.083) -- 0:00:03
937000 -- (-586.459) (-583.699) (-584.020) [-588.586] * (-585.325) (-586.369) [-584.933] (-583.096) -- 0:00:03
937500 -- (-582.902) (-584.513) (-585.418) [-584.158] * (-583.763) [-586.097] (-585.970) (-586.672) -- 0:00:03
938000 -- [-587.498] (-583.908) (-587.433) (-585.893) * (-584.774) [-583.123] (-587.113) (-583.723) -- 0:00:03
938500 -- [-585.321] (-585.847) (-587.926) (-586.538) * (-584.552) [-583.773] (-591.889) (-585.905) -- 0:00:03
939000 -- (-585.095) [-586.510] (-583.780) (-590.156) * (-583.831) [-584.723] (-590.051) (-585.543) -- 0:00:03
939500 -- [-585.311] (-584.580) (-584.580) (-584.092) * (-583.961) (-584.881) [-585.161] (-583.523) -- 0:00:03
940000 -- (-589.528) (-584.424) [-586.007] (-585.732) * (-585.939) [-583.547] (-587.555) (-584.799) -- 0:00:03
Average standard deviation of split frequencies: 0.007141
940500 -- (-588.407) [-584.471] (-585.484) (-587.145) * (-590.353) (-584.222) (-583.452) [-584.135] -- 0:00:03
941000 -- (-584.667) (-586.350) [-583.011] (-590.318) * [-586.350] (-584.266) (-583.641) (-584.040) -- 0:00:03
941500 -- (-584.003) (-585.568) (-586.993) [-586.453] * (-586.994) [-585.809] (-585.255) (-586.754) -- 0:00:03
942000 -- [-584.822] (-589.477) (-588.812) (-583.294) * (-587.163) [-585.552] (-583.733) (-584.471) -- 0:00:03
942500 -- [-584.476] (-587.906) (-589.136) (-589.018) * [-583.704] (-586.563) (-584.151) (-586.270) -- 0:00:03
943000 -- (-583.938) (-585.885) [-583.811] (-590.700) * [-584.286] (-586.788) (-587.237) (-584.778) -- 0:00:03
943500 -- [-583.568] (-584.173) (-585.073) (-585.359) * (-592.608) [-585.678] (-585.253) (-586.631) -- 0:00:03
944000 -- [-584.583] (-588.473) (-585.387) (-585.137) * (-589.578) (-584.794) [-585.644] (-583.391) -- 0:00:03
944500 -- [-582.730] (-585.201) (-588.237) (-585.655) * (-587.414) (-586.516) (-584.499) [-585.159] -- 0:00:03
945000 -- (-583.064) [-584.743] (-584.076) (-587.929) * (-586.657) (-587.039) [-583.923] (-585.744) -- 0:00:03
Average standard deviation of split frequencies: 0.007319
945500 -- (-583.729) (-585.657) [-586.281] (-587.873) * [-583.185] (-587.192) (-587.957) (-584.081) -- 0:00:03
946000 -- [-587.366] (-583.690) (-585.059) (-588.177) * (-585.273) (-588.086) (-584.213) [-585.678] -- 0:00:03
946500 -- (-583.882) (-584.566) (-585.042) [-585.376] * (-586.650) [-583.187] (-583.583) (-583.703) -- 0:00:03
947000 -- (-590.015) (-585.561) (-591.533) [-587.213] * (-585.666) [-586.887] (-585.104) (-584.880) -- 0:00:03
947500 -- (-590.948) [-583.144] (-586.748) (-585.377) * [-586.979] (-584.571) (-587.512) (-583.776) -- 0:00:03
948000 -- (-584.701) [-583.751] (-583.837) (-585.635) * [-583.803] (-585.664) (-583.819) (-584.495) -- 0:00:03
948500 -- (-585.458) [-583.095] (-584.131) (-584.535) * [-587.021] (-585.860) (-583.475) (-586.203) -- 0:00:03
949000 -- (-586.349) (-583.882) (-588.936) [-585.312] * (-583.250) (-586.760) [-584.089] (-583.625) -- 0:00:03
949500 -- [-584.031] (-583.869) (-588.989) (-587.477) * (-583.643) (-585.863) [-585.358] (-586.019) -- 0:00:03
950000 -- (-584.009) (-583.876) (-591.281) [-583.729] * (-584.666) [-586.562] (-584.279) (-586.926) -- 0:00:03
Average standard deviation of split frequencies: 0.006973
950500 -- [-585.080] (-583.786) (-586.406) (-583.380) * (-586.814) (-586.672) [-584.560] (-584.564) -- 0:00:02
951000 -- (-588.632) [-582.902] (-583.919) (-584.552) * [-584.922] (-585.096) (-584.216) (-585.013) -- 0:00:02
951500 -- [-584.509] (-583.058) (-584.367) (-584.890) * [-585.063] (-584.779) (-585.256) (-585.790) -- 0:00:02
952000 -- [-583.927] (-585.442) (-583.021) (-584.648) * (-583.735) (-586.641) [-584.346] (-584.310) -- 0:00:02
952500 -- (-586.381) (-583.396) (-583.908) [-584.788] * [-584.681] (-584.365) (-583.017) (-588.551) -- 0:00:02
953000 -- [-583.387] (-584.576) (-583.484) (-588.529) * [-585.015] (-585.087) (-584.417) (-588.627) -- 0:00:02
953500 -- (-589.599) (-586.956) (-587.622) [-584.449] * (-588.526) [-584.878] (-584.105) (-590.143) -- 0:00:02
954000 -- (-586.469) (-585.634) [-583.766] (-588.527) * [-584.576] (-585.260) (-585.194) (-583.849) -- 0:00:02
954500 -- [-583.773] (-583.436) (-586.037) (-585.275) * (-587.025) [-586.641] (-585.238) (-584.636) -- 0:00:02
955000 -- (-587.010) (-590.714) [-587.248] (-586.009) * (-587.116) (-585.420) (-584.971) [-584.805] -- 0:00:02
Average standard deviation of split frequencies: 0.007027
955500 -- (-584.568) (-585.444) (-584.319) [-587.286] * (-585.734) (-583.914) (-586.029) [-590.410] -- 0:00:02
956000 -- [-584.527] (-584.552) (-586.390) (-586.566) * (-585.883) (-585.504) (-585.826) [-585.384] -- 0:00:02
956500 -- (-587.163) (-585.934) [-589.622] (-583.562) * (-586.119) [-583.985] (-584.114) (-585.643) -- 0:00:02
957000 -- (-584.278) [-585.410] (-586.519) (-584.606) * (-586.142) [-586.858] (-584.663) (-587.666) -- 0:00:02
957500 -- (-588.893) [-586.442] (-584.006) (-583.819) * (-587.318) [-584.240] (-586.402) (-586.088) -- 0:00:02
958000 -- (-583.806) (-585.025) [-583.561] (-585.803) * (-587.348) (-584.117) (-587.972) [-585.211] -- 0:00:02
958500 -- (-583.311) [-584.943] (-590.568) (-588.122) * (-584.034) [-584.787] (-587.195) (-584.208) -- 0:00:02
959000 -- [-582.995] (-583.383) (-584.006) (-588.692) * (-582.822) (-583.810) [-582.870] (-588.939) -- 0:00:02
959500 -- [-585.234] (-585.541) (-585.554) (-583.537) * (-586.130) (-587.496) [-583.584] (-584.572) -- 0:00:02
960000 -- (-585.295) [-584.056] (-585.603) (-583.455) * (-583.871) (-585.401) (-583.946) [-584.645] -- 0:00:02
Average standard deviation of split frequencies: 0.007146
960500 -- (-584.765) [-586.042] (-589.436) (-584.875) * (-583.302) [-583.783] (-584.624) (-585.422) -- 0:00:02
961000 -- [-585.267] (-583.644) (-588.298) (-586.288) * [-584.536] (-583.619) (-584.184) (-587.227) -- 0:00:02
961500 -- [-586.418] (-591.005) (-586.023) (-585.273) * (-584.539) (-586.206) (-584.080) [-585.329] -- 0:00:02
962000 -- (-586.815) [-586.974] (-592.337) (-584.814) * (-584.648) (-585.714) [-585.153] (-584.702) -- 0:00:02
962500 -- (-586.544) (-586.246) (-584.255) [-585.370] * (-588.404) (-583.953) [-583.804] (-584.744) -- 0:00:02
963000 -- (-585.271) (-584.964) [-585.633] (-584.926) * (-588.762) (-584.814) (-587.841) [-584.344] -- 0:00:02
963500 -- (-588.276) (-584.181) [-585.149] (-583.984) * (-587.731) (-588.591) [-588.404] (-584.335) -- 0:00:02
964000 -- (-585.927) [-584.331] (-584.381) (-584.241) * [-589.117] (-583.973) (-587.622) (-585.200) -- 0:00:02
964500 -- [-583.797] (-583.618) (-583.168) (-586.864) * [-587.508] (-585.027) (-584.970) (-585.393) -- 0:00:02
965000 -- (-586.122) (-585.352) (-583.657) [-583.043] * (-586.335) (-585.542) [-585.648] (-585.259) -- 0:00:02
Average standard deviation of split frequencies: 0.006710
965500 -- (-584.974) [-587.227] (-587.850) (-583.960) * (-587.272) (-588.544) [-583.898] (-583.757) -- 0:00:02
966000 -- (-587.880) (-583.486) (-587.394) [-587.074] * (-590.278) (-585.486) [-583.972] (-584.044) -- 0:00:02
966500 -- (-586.934) (-584.100) (-591.631) [-584.797] * (-588.211) [-584.022] (-588.655) (-585.214) -- 0:00:02
967000 -- [-586.817] (-584.442) (-588.439) (-584.516) * (-584.136) (-588.994) (-585.079) [-585.646] -- 0:00:01
967500 -- (-585.533) [-583.586] (-589.887) (-590.724) * (-586.644) [-587.301] (-584.049) (-589.098) -- 0:00:01
968000 -- (-583.731) [-585.839] (-586.182) (-584.055) * (-586.943) (-590.805) [-583.360] (-587.014) -- 0:00:01
968500 -- (-584.391) (-589.537) (-588.145) [-585.371] * (-586.151) [-588.530] (-585.109) (-588.107) -- 0:00:01
969000 -- (-585.159) [-586.569] (-586.126) (-585.928) * (-585.254) [-584.442] (-585.105) (-584.859) -- 0:00:01
969500 -- (-584.222) [-583.261] (-587.630) (-584.784) * [-585.402] (-584.594) (-589.909) (-586.859) -- 0:00:01
970000 -- [-584.372] (-584.540) (-585.361) (-586.612) * (-585.622) (-583.121) (-585.773) [-583.103] -- 0:00:01
Average standard deviation of split frequencies: 0.006769
970500 -- (-589.290) (-588.121) (-586.633) [-583.950] * (-586.939) (-583.891) (-587.005) [-583.111] -- 0:00:01
971000 -- (-589.770) (-584.918) [-587.732] (-584.534) * (-584.378) (-585.131) [-585.852] (-587.422) -- 0:00:01
971500 -- (-584.011) (-586.452) (-586.691) [-583.243] * [-583.974] (-586.710) (-588.680) (-585.152) -- 0:00:01
972000 -- (-583.494) (-589.416) (-587.030) [-585.538] * (-586.078) (-585.872) (-585.301) [-583.943] -- 0:00:01
972500 -- (-585.051) (-588.425) [-585.776] (-583.032) * (-587.439) (-583.184) [-587.839] (-587.293) -- 0:00:01
973000 -- (-583.748) (-586.011) [-583.899] (-585.393) * (-582.860) [-586.464] (-587.687) (-586.439) -- 0:00:01
973500 -- [-583.909] (-590.642) (-587.212) (-583.239) * (-584.373) (-583.533) (-585.171) [-583.344] -- 0:00:01
974000 -- (-584.277) (-585.370) (-587.705) [-584.210] * [-585.559] (-586.064) (-584.458) (-583.531) -- 0:00:01
974500 -- [-584.318] (-587.941) (-587.049) (-588.371) * (-586.841) (-586.904) (-584.345) [-585.523] -- 0:00:01
975000 -- (-583.261) [-583.841] (-585.016) (-585.824) * (-584.510) [-587.217] (-582.924) (-583.440) -- 0:00:01
Average standard deviation of split frequencies: 0.006943
975500 -- (-584.274) [-583.675] (-584.397) (-584.217) * (-587.195) (-590.492) (-587.128) [-583.397] -- 0:00:01
976000 -- (-586.173) [-587.555] (-586.267) (-583.556) * (-588.909) (-586.483) (-584.096) [-586.458] -- 0:00:01
976500 -- (-587.576) (-584.454) (-583.655) [-583.632] * (-585.018) (-584.156) [-583.118] (-586.079) -- 0:00:01
977000 -- (-586.115) (-584.741) [-583.248] (-587.377) * (-583.733) (-583.499) (-584.443) [-586.065] -- 0:00:01
977500 -- [-588.300] (-585.860) (-587.425) (-586.952) * [-583.496] (-587.328) (-585.705) (-587.548) -- 0:00:01
978000 -- (-586.753) (-585.084) [-585.511] (-584.293) * [-583.219] (-587.043) (-587.722) (-586.066) -- 0:00:01
978500 -- (-586.936) (-584.796) [-582.965] (-583.832) * (-583.868) (-584.531) [-584.444] (-583.907) -- 0:00:01
979000 -- (-584.587) [-586.980] (-583.558) (-592.965) * (-583.528) (-584.496) (-583.688) [-586.095] -- 0:00:01
979500 -- (-583.641) [-582.898] (-584.119) (-585.341) * (-586.286) (-588.832) (-587.043) [-585.922] -- 0:00:01
980000 -- (-584.688) (-584.065) (-586.264) [-583.637] * [-584.912] (-584.517) (-584.923) (-584.533) -- 0:00:01
Average standard deviation of split frequencies: 0.006730
980500 -- (-586.919) [-584.158] (-585.255) (-587.355) * [-583.514] (-585.362) (-587.123) (-584.819) -- 0:00:01
981000 -- (-586.364) (-583.884) [-585.858] (-584.478) * [-586.475] (-584.146) (-585.439) (-583.759) -- 0:00:01
981500 -- (-585.310) [-587.548] (-587.559) (-585.872) * (-588.537) [-583.418] (-584.323) (-584.549) -- 0:00:01
982000 -- [-584.794] (-586.348) (-584.981) (-584.614) * [-584.090] (-585.580) (-584.407) (-590.097) -- 0:00:01
982500 -- (-584.652) [-584.952] (-585.848) (-582.723) * (-585.928) [-583.181] (-583.957) (-585.191) -- 0:00:01
983000 -- (-585.980) (-585.699) [-585.292] (-587.002) * [-584.011] (-584.646) (-586.535) (-584.119) -- 0:00:01
983500 -- (-585.058) [-586.864] (-584.951) (-586.036) * (-585.766) (-583.796) [-585.031] (-585.445) -- 0:00:00
984000 -- (-583.586) [-583.552] (-584.085) (-586.834) * [-583.155] (-588.133) (-586.332) (-583.861) -- 0:00:00
984500 -- (-584.362) [-583.579] (-584.906) (-584.344) * (-585.080) [-585.106] (-588.297) (-585.346) -- 0:00:00
985000 -- (-583.191) [-583.679] (-585.840) (-586.943) * (-585.011) (-583.795) [-583.498] (-585.794) -- 0:00:00
Average standard deviation of split frequencies: 0.006566
985500 -- (-583.886) [-584.610] (-584.900) (-586.399) * [-584.815] (-585.968) (-586.417) (-586.250) -- 0:00:00
986000 -- [-586.061] (-584.887) (-585.448) (-586.095) * [-587.696] (-586.420) (-585.029) (-586.645) -- 0:00:00
986500 -- [-584.126] (-590.002) (-585.326) (-585.395) * [-587.095] (-586.368) (-586.546) (-585.447) -- 0:00:00
987000 -- (-586.357) (-587.797) [-584.615] (-585.275) * (-585.607) [-587.773] (-583.117) (-585.746) -- 0:00:00
987500 -- (-591.839) (-589.400) (-583.962) [-584.485] * [-586.173] (-587.693) (-586.185) (-584.102) -- 0:00:00
988000 -- (-585.312) [-584.877] (-583.079) (-589.063) * [-584.429] (-588.130) (-583.518) (-584.579) -- 0:00:00
988500 -- (-586.048) (-585.111) [-585.749] (-585.399) * [-583.407] (-587.158) (-585.269) (-583.481) -- 0:00:00
989000 -- [-586.219] (-586.300) (-589.407) (-586.432) * (-583.318) (-586.284) [-584.198] (-584.285) -- 0:00:00
989500 -- [-587.598] (-585.039) (-584.434) (-583.588) * (-584.873) (-585.396) [-585.279] (-587.933) -- 0:00:00
990000 -- (-584.968) (-583.858) (-585.172) [-583.353] * (-584.514) (-586.062) [-585.635] (-585.625) -- 0:00:00
Average standard deviation of split frequencies: 0.006408
990500 -- (-592.146) (-585.880) (-585.008) [-587.120] * (-584.441) (-586.066) [-585.755] (-586.469) -- 0:00:00
991000 -- (-585.817) (-584.497) [-585.854] (-587.767) * (-584.453) (-584.347) (-585.251) [-586.367] -- 0:00:00
991500 -- (-593.482) [-584.661] (-585.016) (-584.975) * (-586.907) (-584.131) [-584.321] (-585.930) -- 0:00:00
992000 -- (-589.974) (-586.365) (-584.989) [-587.803] * (-585.608) (-583.950) (-583.549) [-584.062] -- 0:00:00
992500 -- (-588.928) (-584.011) (-583.966) [-584.083] * [-584.369] (-583.002) (-583.764) (-587.961) -- 0:00:00
993000 -- [-585.431] (-584.886) (-584.439) (-584.115) * (-587.266) [-584.794] (-586.874) (-588.203) -- 0:00:00
993500 -- (-584.030) (-585.443) [-584.387] (-584.887) * [-584.713] (-583.385) (-584.903) (-583.958) -- 0:00:00
994000 -- (-585.930) (-586.302) (-585.817) [-584.535] * (-586.350) (-588.901) [-582.849] (-585.955) -- 0:00:00
994500 -- (-583.021) [-587.183] (-584.875) (-585.428) * (-585.624) (-584.267) [-587.386] (-583.636) -- 0:00:00
995000 -- (-583.265) [-583.704] (-582.887) (-586.971) * (-584.550) [-584.537] (-583.969) (-587.419) -- 0:00:00
Average standard deviation of split frequencies: 0.006437
995500 -- (-590.564) (-586.077) [-583.921] (-585.755) * (-585.221) (-585.575) [-586.359] (-585.029) -- 0:00:00
996000 -- (-586.815) [-586.322] (-584.553) (-585.235) * (-586.501) (-586.347) [-584.821] (-584.745) -- 0:00:00
996500 -- (-584.986) (-585.206) (-584.763) [-588.675] * [-583.516] (-590.177) (-583.229) (-587.348) -- 0:00:00
997000 -- [-585.886] (-586.515) (-583.927) (-586.072) * (-584.208) (-583.821) [-584.720] (-592.185) -- 0:00:00
997500 -- (-585.042) [-585.198] (-586.979) (-586.902) * (-586.935) [-584.749] (-583.471) (-590.202) -- 0:00:00
998000 -- (-586.905) (-587.954) [-584.826] (-585.407) * (-585.766) (-583.799) [-583.549] (-586.144) -- 0:00:00
998500 -- (-584.508) [-587.523] (-584.332) (-585.338) * (-583.903) (-584.736) [-584.119] (-591.099) -- 0:00:00
999000 -- [-583.803] (-584.475) (-586.007) (-585.885) * (-584.297) [-585.764] (-585.268) (-587.588) -- 0:00:00
999500 -- (-590.621) (-583.357) (-583.447) [-585.613] * (-583.872) (-583.884) (-587.495) [-585.247] -- 0:00:00
1000000 -- (-584.690) (-584.701) [-584.540] (-585.190) * (-583.461) (-584.303) [-586.535] (-583.565) -- 0:00:00
Average standard deviation of split frequencies: 0.006627
Analysis completed in 60 seconds
Analysis used 59.19 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -582.61
Likelihood of best state for "cold" chain of run 2 was -582.61
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 69 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
33.7 % ( 19 %) Dirichlet(Pi{all})
33.8 % ( 28 %) Slider(Pi{all})
78.8 % ( 60 %) Multiplier(Alpha{1,2})
77.8 % ( 51 %) Multiplier(Alpha{3})
24.3 % ( 15 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 64 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 84 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.1 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
33.4 % ( 25 %) Dirichlet(Pi{all})
34.7 % ( 29 %) Slider(Pi{all})
78.8 % ( 52 %) Multiplier(Alpha{1,2})
77.1 % ( 42 %) Multiplier(Alpha{3})
24.6 % ( 33 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
70.4 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.3 % ( 23 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.5 % ( 30 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166671 0.82 0.67
3 | 166230 166497 0.84
4 | 166778 166993 166831
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166807 0.82 0.67
3 | 167059 166675 0.83
4 | 166399 166337 166723
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -584.20
| 1 2 |
| |
| |
| 1 11 2* 1 |
| 121 2 1 1 2 2 1 21 1 |
|22 2 2 2 2 1 2 1 1 1 1 22 * *2|
| 12 2 1 2 11 2 1 1 1 2 11 |
| 11 1 2 * 1 2 2 2 |
| 12* 2 2 *2 1 1 * 2 2 11 21 *1 1 |
| 22 2 1 222 1 1 2 22 2 2 |
| 1 2 2 2 2 1 2 1|
|1 1 1 2 2 2 1 |
| 1 1 1 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -586.05
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -584.32 -591.59
2 -584.35 -588.16
--------------------------------------
TOTAL -584.33 -590.92
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902444 0.087321 0.373170 1.496193 0.872600 1349.52 1419.59 1.001
r(A<->C){all} 0.166410 0.022252 0.000008 0.467394 0.126188 146.78 147.13 1.000
r(A<->G){all} 0.173541 0.022932 0.000103 0.486675 0.130673 148.75 168.10 1.001
r(A<->T){all} 0.159929 0.020116 0.000015 0.447352 0.121189 228.61 256.86 1.001
r(C<->G){all} 0.171668 0.020605 0.000145 0.462179 0.134398 150.95 175.14 1.000
r(C<->T){all} 0.166236 0.019283 0.000057 0.446715 0.127252 111.80 168.73 1.000
r(G<->T){all} 0.162217 0.018945 0.000008 0.451252 0.125645 75.74 120.55 1.002
pi(A){all} 0.207577 0.000373 0.170134 0.246935 0.207146 1264.80 1348.30 1.000
pi(C){all} 0.248465 0.000424 0.208130 0.288527 0.247540 1186.57 1255.88 1.000
pi(G){all} 0.330404 0.000511 0.288920 0.377016 0.330343 928.46 1192.65 1.002
pi(T){all} 0.213553 0.000402 0.175119 0.251457 0.213099 1188.33 1189.75 1.000
alpha{1,2} 0.411753 0.226594 0.000269 1.410952 0.243729 1115.08 1130.49 1.000
alpha{3} 0.472470 0.271632 0.000145 1.562550 0.292935 1143.32 1190.90 1.000
pinvar{all} 0.996261 0.000021 0.987903 0.999996 0.997642 1149.54 1248.36 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- .**...
9 -- .*.*..
10 -- ..**..
11 -- ...*.*
12 -- ..*.*.
13 -- .****.
14 -- .**.**
15 -- .*...*
16 -- .***.*
17 -- .*.***
18 -- ..****
19 -- ....**
20 -- ..*..*
21 -- ...**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 457 0.152232 0.017430 0.139907 0.164557 2
8 453 0.150899 0.008951 0.144570 0.157229 2
9 446 0.148568 0.012248 0.139907 0.157229 2
10 443 0.147568 0.009893 0.140573 0.154564 2
11 440 0.146569 0.000000 0.146569 0.146569 2
12 438 0.145903 0.004711 0.142572 0.149234 2
13 437 0.145570 0.006124 0.141239 0.149900 2
14 423 0.140906 0.006124 0.136576 0.145237 2
15 422 0.140573 0.002827 0.138574 0.142572 2
16 421 0.140240 0.007066 0.135243 0.145237 2
17 419 0.139574 0.004240 0.136576 0.142572 2
18 414 0.137908 0.000942 0.137242 0.138574 2
19 411 0.136909 0.003298 0.134577 0.139241 2
20 403 0.134244 0.009893 0.127249 0.141239 2
21 390 0.129913 0.005653 0.125916 0.133911 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100697 0.010396 0.000026 0.304186 0.069877 1.000 2
length{all}[2] 0.099395 0.010512 0.000003 0.293377 0.068187 1.000 2
length{all}[3] 0.097991 0.009616 0.000030 0.292630 0.066566 1.000 2
length{all}[4] 0.099806 0.009877 0.000111 0.297271 0.068947 1.000 2
length{all}[5] 0.102028 0.009876 0.000036 0.298653 0.071379 1.002 2
length{all}[6] 0.100951 0.009756 0.000110 0.296166 0.072259 1.000 2
length{all}[7] 0.102500 0.011419 0.000357 0.307880 0.073763 0.999 2
length{all}[8] 0.102202 0.009938 0.000076 0.278255 0.072786 0.998 2
length{all}[9] 0.097533 0.010151 0.000635 0.282544 0.071118 1.002 2
length{all}[10] 0.098230 0.011197 0.000569 0.323835 0.064381 1.001 2
length{all}[11] 0.097832 0.008903 0.000179 0.282145 0.067566 0.998 2
length{all}[12] 0.101910 0.010499 0.000070 0.307237 0.071395 0.998 2
length{all}[13] 0.101466 0.011675 0.000053 0.301795 0.067033 1.002 2
length{all}[14] 0.104718 0.010647 0.000327 0.323731 0.075419 0.998 2
length{all}[15] 0.105912 0.013555 0.000262 0.334052 0.071359 0.998 2
length{all}[16] 0.103341 0.009954 0.000399 0.313251 0.072127 1.004 2
length{all}[17] 0.101028 0.010515 0.000530 0.298432 0.068228 0.999 2
length{all}[18] 0.100242 0.009124 0.000011 0.293407 0.074175 1.003 2
length{all}[19] 0.094454 0.009384 0.000150 0.289233 0.061354 1.003 2
length{all}[20] 0.098736 0.010665 0.000056 0.316088 0.066658 0.998 2
length{all}[21] 0.102317 0.010569 0.000003 0.319039 0.069264 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006627
Maximum standard deviation of split frequencies = 0.017430
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------ C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 426
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 52 patterns at 142 / 142 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 52 patterns at 142 / 142 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
50752 bytes for conP
4576 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.095165 0.100564 0.049837 0.023470 0.094546 0.036103 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -614.868697
Iterating by ming2
Initial: fx= 614.868697
x= 0.09517 0.10056 0.04984 0.02347 0.09455 0.03610 0.30000 1.30000
1 h-m-p 0.0000 0.0002 338.7742 +++ 595.506092 m 0.0002 14 | 1/8
2 h-m-p 0.0017 0.0111 31.0164 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 310.0796 ++ 586.762168 m 0.0001 45 | 2/8
4 h-m-p 0.0011 0.0158 23.2457 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 277.4819 ++ 579.129980 m 0.0001 76 | 3/8
6 h-m-p 0.0013 0.0211 18.1581 -----------.. | 3/8
7 h-m-p 0.0000 0.0003 240.3892 +++ 560.277703 m 0.0003 108 | 4/8
8 h-m-p 0.0056 0.0461 11.3378 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 197.8305 ++ 560.101557 m 0.0000 140 | 5/8
10 h-m-p 0.0007 0.3712 6.5453 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 139.8347 ++ 559.333169 m 0.0000 171 | 6/8
12 h-m-p 0.1065 8.0000 0.0000 -Y 559.333169 0 0.0067 183 | 6/8
13 h-m-p 0.3109 8.0000 0.0000 Y 559.333169 0 0.3109 196
Out..
lnL = -559.333169
197 lfun, 197 eigenQcodon, 1182 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.027688 0.091699 0.048863 0.033616 0.047361 0.091423 0.299921 0.894217 0.355544
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.302986
np = 9
lnL0 = -606.263157
Iterating by ming2
Initial: fx= 606.263157
x= 0.02769 0.09170 0.04886 0.03362 0.04736 0.09142 0.29992 0.89422 0.35554
1 h-m-p 0.0000 0.0002 332.1234 +++ 583.712568 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0001 275.9103 ++ 579.599683 m 0.0001 27 | 2/9
3 h-m-p 0.0000 0.0000 844.8092 ++ 572.235381 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 362.4180 ++ 571.514638 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 6563.7570 ++ 559.366928 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 430.1291 ++ 559.333184 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0002 ------------C 559.333184 0 0.0000 99
Out..
lnL = -559.333184
100 lfun, 300 eigenQcodon, 1200 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.049229 0.013510 0.015040 0.094452 0.032171 0.026913 0.286774 1.396329 0.516753 0.288814 1.557693
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.219267
np = 11
lnL0 = -590.618614
Iterating by ming2
Initial: fx= 590.618614
x= 0.04923 0.01351 0.01504 0.09445 0.03217 0.02691 0.28677 1.39633 0.51675 0.28881 1.55769
1 h-m-p 0.0000 0.0001 321.1939 ++ 579.934043 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0002 80.5293 ++ 578.826778 m 0.0002 30 | 2/11
3 h-m-p 0.0000 0.0002 254.8085 ++ 573.146706 m 0.0002 44 | 3/11
4 h-m-p 0.0000 0.0001 282.1389 ++ 571.181793 m 0.0001 58 | 4/11
5 h-m-p 0.0000 0.0001 938.6436 ++ 566.948654 m 0.0001 72 | 5/11
6 h-m-p 0.0000 0.0000 5237.5262 ++ 562.014930 m 0.0000 86 | 6/11
7 h-m-p 0.0159 0.1430 3.0527 -------------.. | 6/11
8 h-m-p 0.0000 0.0001 137.7149 ++ 559.333180 m 0.0001 125 | 7/11
9 h-m-p 0.2485 8.0000 0.0000 +++ 559.333180 m 8.0000 140 | 7/11
10 h-m-p 0.0161 8.0000 0.0054 --------C 559.333180 0 0.0000 166 | 7/11
11 h-m-p 0.0160 8.0000 0.0001 +++++ 559.333180 m 8.0000 187 | 7/11
12 h-m-p 0.0008 0.4013 1.8009 +++++ 559.333174 m 0.4013 208 | 8/11
13 h-m-p 0.9010 8.0000 0.7446 +Y 559.333170 0 5.6881 223 | 8/11
14 h-m-p 1.6000 8.0000 0.0586 ++ 559.333170 m 8.0000 240 | 8/11
15 h-m-p 1.4482 8.0000 0.3237 Y 559.333170 0 0.6359 257 | 8/11
16 h-m-p 1.6000 8.0000 0.0066 C 559.333170 0 1.9510 274 | 8/11
17 h-m-p 0.3643 8.0000 0.0354 Y 559.333170 0 0.0397 291 | 8/11
18 h-m-p 1.0010 8.0000 0.0014 ++ 559.333170 m 8.0000 308 | 8/11
19 h-m-p 1.6000 8.0000 0.0055 C 559.333170 0 1.9927 325 | 8/11
20 h-m-p 1.6000 8.0000 0.0016 ++ 559.333170 m 8.0000 342 | 8/11
21 h-m-p 0.0659 8.0000 0.1938 ++C 559.333170 0 1.0552 361 | 8/11
22 h-m-p 1.6000 8.0000 0.0278 ++ 559.333170 m 8.0000 378 | 8/11
23 h-m-p 0.1902 8.0000 1.1675 +Y 559.333169 0 0.7608 396 | 8/11
24 h-m-p 1.6000 8.0000 0.2529 ++ 559.333165 m 8.0000 410 | 8/11
25 h-m-p 0.0138 0.8935 146.3794 ++++ 559.333159 m 0.8935 429 | 8/11
26 h-m-p -0.0000 -0.0000 0.2750
h-m-p: -0.00000000e+00 -0.00000000e+00 2.74966803e-01 559.333159
.. | 8/11
27 h-m-p 0.0160 8.0000 0.0000 C 559.333159 0 0.0160 457 | 7/11
28 h-m-p 0.0160 8.0000 0.0580 +++++ 559.333159 m 8.0000 477 | 7/11
29 h-m-p 0.1854 8.0000 2.5034 +++ 559.333159 m 8.0000 496 | 7/11
30 h-m-p 0.2962 1.4810 13.8360 ---------------.. | 7/11
31 h-m-p 0.0160 8.0000 0.0000 ------------- | 7/11
32 h-m-p 0.0160 8.0000 0.0000 +++++ 559.333159 m 8.0000 569 | 7/11
33 h-m-p 0.0001 0.0156 0.3528 ----------.. | 7/11
34 h-m-p 0.0160 8.0000 0.0000 +++++ 559.333159 m 8.0000 616 | 7/11
35 h-m-p 0.0160 8.0000 0.0310 +++++ 559.333157 m 8.0000 637 | 7/11
36 h-m-p 0.2564 8.0000 0.9686 +++ 559.333149 m 8.0000 656 | 7/11
37 h-m-p 1.6000 8.0000 0.4276 ++ 559.333148 m 8.0000 674 | 7/11
38 h-m-p 0.7975 8.0000 4.2891 ++ 559.333147 m 8.0000 692 | 7/11
39 h-m-p 1.6000 8.0000 2.9202 ++ 559.333147 m 8.0000 710 | 7/11
40 h-m-p 1.4023 8.0000 16.6591 ++ 559.333147 m 8.0000 728 | 7/11
41 h-m-p 1.6000 8.0000 17.2639 ++ 559.333147 m 8.0000 746 | 7/11
42 h-m-p 1.2500 6.2501 105.3606 ++ 559.333146 m 6.2501 764 | 7/11
43 h-m-p 1.6000 8.0000 25.4407 -------Y 559.333146 0 0.0000 789 | 7/11
44 h-m-p 0.3687 1.8436 0.0003 ------Y 559.333146 0 0.0000 813
Out..
lnL = -559.333146
814 lfun, 3256 eigenQcodon, 14652 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -559.329899 S = -559.329824 -0.000029
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:04
did 20 / 52 patterns 0:04
did 30 / 52 patterns 0:04
did 40 / 52 patterns 0:04
did 50 / 52 patterns 0:05
did 52 / 52 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.085563 0.088936 0.108438 0.102874 0.040289 0.106414 998.999379 0.260454 1.507668
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.044138
np = 9
lnL0 = -629.318629
Iterating by ming2
Initial: fx= 629.318629
x= 0.08556 0.08894 0.10844 0.10287 0.04029 0.10641 951.42857 0.26045 1.50767
1 h-m-p 0.0000 0.0003 300.0094 +++ 600.091750 m 0.0003 24 | 1/9
2 h-m-p 0.0041 0.0984 20.7260 +CYCC 599.975838 3 0.0142 51 | 1/9
3 h-m-p 0.0312 0.1560 2.0570 --------------.. | 1/9
4 h-m-p 0.0000 0.0004 288.4042 +++ 567.083337 m 0.0004 104 | 2/9
5 h-m-p 0.0103 0.0563 9.5493 -------------.. | 2/9
6 h-m-p 0.0000 0.0000 277.6675 ++ 565.459838 m 0.0000 154 | 3/9
7 h-m-p 0.0019 0.5569 2.6556 ------------.. | 3/9
8 h-m-p 0.0000 0.0001 240.8406 ++ 560.430491 m 0.0001 201 | 4/9
9 h-m-p 0.0065 0.7970 2.6139 ------------.. | 4/9
10 h-m-p 0.0000 0.0000 199.3953 ++ 559.577103 m 0.0000 246 | 5/9
11 h-m-p 0.0023 1.1670 2.9787 ------------.. | 5/9
12 h-m-p 0.0000 0.0000 141.3607 ++ 559.333207 m 0.0000 289 | 6/9
13 h-m-p 0.0819 8.0000 0.0000 ++++ 559.333207 m 8.0000 307 | 6/9
14 h-m-p 0.0160 8.0000 0.0030 --Y 559.333207 0 0.0003 324 | 6/9
15 h-m-p 0.0160 8.0000 0.0003 +++++ 559.333207 m 8.0000 342 | 6/9
16 h-m-p 0.0160 8.0000 0.4734 +++++ 559.333207 m 8.0000 360 | 6/9
17 h-m-p 1.6000 8.0000 0.5549 ++ 559.333206 m 8.0000 375 | 6/9
18 h-m-p 1.6000 8.0000 2.2315 ++ 559.333206 m 8.0000 390 | 6/9
19 h-m-p 1.6000 8.0000 2.7492 ++ 559.333206 m 8.0000 405 | 6/9
20 h-m-p 0.7447 3.7234 15.1054 ++ 559.333206 m 3.7234 420 | 6/9
21 h-m-p 0.0000 0.0000 23.9656
h-m-p: 0.00000000e+00 0.00000000e+00 2.39656207e+01 559.333206
.. | 6/9
22 h-m-p 0.0160 8.0000 0.0000 C 559.333206 0 0.0160 447 | 6/9
23 h-m-p 0.0160 8.0000 0.0000 +++++ 559.333206 m 8.0000 465 | 6/9
24 h-m-p 0.0160 8.0000 0.4825 +++++ 559.333204 m 8.0000 483 | 6/9
25 h-m-p 0.0972 1.5841 39.7118 +++ 559.333188 m 1.5841 499 | 7/9
26 h-m-p 0.1619 0.8095 91.6913 ++ 559.333175 m 0.8095 514 | 7/9
27 h-m-p -0.0000 -0.0000 0.0000
h-m-p: -4.85489945e-10 -2.42744973e-09 1.87339734e-06 559.333175
.. | 7/9
28 h-m-p 0.0160 8.0000 0.0000 Y 559.333175 0 0.0160 539 | 6/9
29 h-m-p -0.0000 -0.0000 0.0000
h-m-p: -8.97911571e-07 -4.48955786e-06 3.83185714e-06 559.333175
.. | 7/9
30 h-m-p 0.0160 8.0000 0.0000 -Y 559.333175 0 0.0010 566
Out..
lnL = -559.333175
567 lfun, 6237 eigenQcodon, 34020 P(t)
Time used: 0:16
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.020288 0.021215 0.020927 0.012547 0.025527 0.022071 951.394045 0.900000 0.457635 1.571757 1.300051
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.032993
np = 11
lnL0 = -576.187979
Iterating by ming2
Initial: fx= 576.187979
x= 0.02029 0.02122 0.02093 0.01255 0.02553 0.02207 951.39404 0.90000 0.45763 1.57176 1.30005
1 h-m-p 0.0000 0.0001 328.1956 ++ 565.999795 m 0.0001 27 | 1/11
2 h-m-p 0.0008 0.0060 35.3717 ++ 560.204849 m 0.0060 52 | 2/11
3 h-m-p 0.0000 0.0000 23614.2609 ++ 559.935928 m 0.0000 76 | 3/11
4 h-m-p 0.0000 0.0000 548.6292 ++ 559.872655 m 0.0000 99 | 4/11
5 h-m-p 0.0000 0.0000 1012.7580 ++ 559.729695 m 0.0000 121 | 5/11
6 h-m-p 0.0000 0.0000 8884.5173 ++ 559.333182 m 0.0000 142 | 6/11
7 h-m-p 1.6000 8.0000 0.0009 ++ 559.333182 m 8.0000 162 | 6/11
8 h-m-p 0.0108 0.9070 0.6508 ++++ 559.333167 m 0.9070 183 | 7/11
9 h-m-p 0.1984 0.9919 0.7580 ---------------.. | 7/11
10 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -559.333167
245 lfun, 2940 eigenQcodon, 16170 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -559.336017 S = -559.330607 -0.002370
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:20
did 20 / 52 patterns 0:20
did 30 / 52 patterns 0:20
did 40 / 52 patterns 0:21
did 50 / 52 patterns 0:21
did 52 / 52 patterns 0:21
Time used: 0:21
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=142
NC_011896_1_WP_010908607_1_2035_MLBR_RS09660 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
NC_002677_1_NP_302286_1_1158_ML1909 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
NZ_LVXE01000028_1_WP_010908607_1_1137_A3216_RS08530 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
NZ_LYPH01000031_1_WP_010908607_1_1219_A8144_RS05860 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
NZ_CP029543_1_WP_010908607_1_2059_DIJ64_RS10480 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
NZ_AP014567_1_WP_010908607_1_2114_hadB MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
**************************************************
NC_011896_1_WP_010908607_1_2035_MLBR_RS09660 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
NC_002677_1_NP_302286_1_1158_ML1909 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
NZ_LVXE01000028_1_WP_010908607_1_1137_A3216_RS08530 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
NZ_LYPH01000031_1_WP_010908607_1_1219_A8144_RS05860 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
NZ_CP029543_1_WP_010908607_1_2059_DIJ64_RS10480 GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
NZ_AP014567_1_WP_010908607_1_2114_hadB GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA
**************************************************
NC_011896_1_WP_010908607_1_2035_MLBR_RS09660 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
NC_002677_1_NP_302286_1_1158_ML1909 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
NZ_LVXE01000028_1_WP_010908607_1_1137_A3216_RS08530 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
NZ_LYPH01000031_1_WP_010908607_1_1219_A8144_RS05860 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
NZ_CP029543_1_WP_010908607_1_2059_DIJ64_RS10480 VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
NZ_AP014567_1_WP_010908607_1_2114_hadB VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
******************************************
>NC_011896_1_WP_010908607_1_2035_MLBR_RS09660 ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC GGGCTATCGCTTCAGCGAAACTGGCG >NC_002677_1_NP_302286_1_1158_ML1909 ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC GGGCTATCGCTTCAGCGAAACTGGCG >NZ_LVXE01000028_1_WP_010908607_1_1137_A3216_RS08530 ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC GGGCTATCGCTTCAGCGAAACTGGCG >NZ_LYPH01000031_1_WP_010908607_1_1219_A8144_RS05860 ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC GGGCTATCGCTTCAGCGAAACTGGCG >NZ_CP029543_1_WP_010908607_1_2059_DIJ64_RS10480 ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC GGGCTATCGCTTCAGCGAAACTGGCG >NZ_AP014567_1_WP_010908607_1_2114_hadB ATGGCGCGGCGTGAGTTTAGTTCAGTCAAGGTTGGTGACCTGCTGCCGGA AAAGACCTATCCACTTACTCGCCAGGATTTGGTGAATTACGCAGGGGTTT CGGGTGACTTGAATCCGATACACTGGGACGACGAAATCGCCAAGGTGGTG GGGCTAGACACCGCGATCGCTCATGGAATGCTGACGATGGGTATTGGCGG CGGATACGTCACCTCGTGGGTCGGTGACCCAGGTGCGGTCATCGAATACA ACGTGCGGTTTACTGCGGTAGTGCCGGTACCCAACGACGGCCAAGGTGCC GTGCTGGTGTTCAGCGGTAAGGTGAAGTCGGTTGATCCGGACACCAAGTC GGTGACCATCGCTCTCTCGGCCACAACCGGTGGCAAGAAGATCTTCGGCC GGGCTATCGCTTCAGCGAAACTGGCG
>NC_011896_1_WP_010908607_1_2035_MLBR_RS09660 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA >NC_002677_1_NP_302286_1_1158_ML1909 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA >NZ_LVXE01000028_1_WP_010908607_1_1137_A3216_RS08530 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA >NZ_LYPH01000031_1_WP_010908607_1_1219_A8144_RS05860 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA >NZ_CP029543_1_WP_010908607_1_2059_DIJ64_RS10480 MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA >NZ_AP014567_1_WP_010908607_1_2114_hadB MARREFSSVKVGDLLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVIEYNVRFTAVVPVPNDGQGA VLVFSGKVKSVDPDTKSVTIALSATTGGKKIFGRAIASAKLA
#NEXUS
[ID: 5105244773]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908607_1_2035_MLBR_RS09660
NC_002677_1_NP_302286_1_1158_ML1909
NZ_LVXE01000028_1_WP_010908607_1_1137_A3216_RS08530
NZ_LYPH01000031_1_WP_010908607_1_1219_A8144_RS05860
NZ_CP029543_1_WP_010908607_1_2059_DIJ64_RS10480
NZ_AP014567_1_WP_010908607_1_2114_hadB
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908607_1_2035_MLBR_RS09660,
2 NC_002677_1_NP_302286_1_1158_ML1909,
3 NZ_LVXE01000028_1_WP_010908607_1_1137_A3216_RS08530,
4 NZ_LYPH01000031_1_WP_010908607_1_1219_A8144_RS05860,
5 NZ_CP029543_1_WP_010908607_1_2059_DIJ64_RS10480,
6 NZ_AP014567_1_WP_010908607_1_2114_hadB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06987739,2:0.06818706,3:0.06656578,4:0.06894716,5:0.07137929,6:0.07225867);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06987739,2:0.06818706,3:0.06656578,4:0.06894716,5:0.07137929,6:0.07225867);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -584.32 -591.59
2 -584.35 -588.16
--------------------------------------
TOTAL -584.33 -590.92
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1909/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902444 0.087321 0.373170 1.496193 0.872600 1349.52 1419.59 1.001
r(A<->C){all} 0.166410 0.022252 0.000008 0.467394 0.126188 146.78 147.13 1.000
r(A<->G){all} 0.173541 0.022932 0.000103 0.486675 0.130673 148.75 168.10 1.001
r(A<->T){all} 0.159929 0.020116 0.000015 0.447352 0.121189 228.61 256.86 1.001
r(C<->G){all} 0.171668 0.020605 0.000145 0.462179 0.134398 150.95 175.14 1.000
r(C<->T){all} 0.166236 0.019283 0.000057 0.446715 0.127252 111.80 168.73 1.000
r(G<->T){all} 0.162217 0.018945 0.000008 0.451252 0.125645 75.74 120.55 1.002
pi(A){all} 0.207577 0.000373 0.170134 0.246935 0.207146 1264.80 1348.30 1.000
pi(C){all} 0.248465 0.000424 0.208130 0.288527 0.247540 1186.57 1255.88 1.000
pi(G){all} 0.330404 0.000511 0.288920 0.377016 0.330343 928.46 1192.65 1.002
pi(T){all} 0.213553 0.000402 0.175119 0.251457 0.213099 1188.33 1189.75 1.000
alpha{1,2} 0.411753 0.226594 0.000269 1.410952 0.243729 1115.08 1130.49 1.000
alpha{3} 0.472470 0.271632 0.000145 1.562550 0.292935 1143.32 1190.90 1.000
pinvar{all} 0.996261 0.000021 0.987903 0.999996 0.997642 1149.54 1248.36 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1909/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 142
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 0 0 0 0 0 0 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 1 1 1 1 1 1
CTC 1 1 1 1 1 1 | CCC 1 1 1 1 1 1 | CAC 1 1 1 1 1 1 | CGC 1 1 1 1 1 1
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 5 5 5 5 5 5 | CCG 4 4 4 4 4 4 | CAG 1 1 1 1 1 1 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 6 6 6 6 6 6 | ACC 6 6 6 6 6 6 | AAC 2 2 2 2 2 2 | AGC 1 1 1 1 1 1
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 1 1 1 1 1 1 | AAG 8 8 8 8 8 8 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 4 4 4 4 4 4 | Asp GAT 2 2 2 2 2 2 | Gly GGT 8 8 8 8 8 8
GTC 4 4 4 4 4 4 | GCC 3 3 3 3 3 3 | GAC 8 8 8 8 8 8 | GGC 5 5 5 5 5 5
GTA 2 2 2 2 2 2 | GCA 1 1 1 1 1 1 | Glu GAA 3 3 3 3 3 3 | GGA 2 2 2 2 2 2
GTG 9 9 9 9 9 9 | GCG 6 6 6 6 6 6 | GAG 1 1 1 1 1 1 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908607_1_2035_MLBR_RS09660
position 1: T:0.13380 C:0.16901 A:0.25352 G:0.44366
position 2: T:0.30282 C:0.26761 A:0.24648 G:0.18310
position 3: T:0.20423 C:0.30986 A:0.11972 G:0.36620
Average T:0.21362 C:0.24883 A:0.20657 G:0.33099
#2: NC_002677_1_NP_302286_1_1158_ML1909
position 1: T:0.13380 C:0.16901 A:0.25352 G:0.44366
position 2: T:0.30282 C:0.26761 A:0.24648 G:0.18310
position 3: T:0.20423 C:0.30986 A:0.11972 G:0.36620
Average T:0.21362 C:0.24883 A:0.20657 G:0.33099
#3: NZ_LVXE01000028_1_WP_010908607_1_1137_A3216_RS08530
position 1: T:0.13380 C:0.16901 A:0.25352 G:0.44366
position 2: T:0.30282 C:0.26761 A:0.24648 G:0.18310
position 3: T:0.20423 C:0.30986 A:0.11972 G:0.36620
Average T:0.21362 C:0.24883 A:0.20657 G:0.33099
#4: NZ_LYPH01000031_1_WP_010908607_1_1219_A8144_RS05860
position 1: T:0.13380 C:0.16901 A:0.25352 G:0.44366
position 2: T:0.30282 C:0.26761 A:0.24648 G:0.18310
position 3: T:0.20423 C:0.30986 A:0.11972 G:0.36620
Average T:0.21362 C:0.24883 A:0.20657 G:0.33099
#5: NZ_CP029543_1_WP_010908607_1_2059_DIJ64_RS10480
position 1: T:0.13380 C:0.16901 A:0.25352 G:0.44366
position 2: T:0.30282 C:0.26761 A:0.24648 G:0.18310
position 3: T:0.20423 C:0.30986 A:0.11972 G:0.36620
Average T:0.21362 C:0.24883 A:0.20657 G:0.33099
#6: NZ_AP014567_1_WP_010908607_1_2114_hadB
position 1: T:0.13380 C:0.16901 A:0.25352 G:0.44366
position 2: T:0.30282 C:0.26761 A:0.24648 G:0.18310
position 3: T:0.20423 C:0.30986 A:0.11972 G:0.36620
Average T:0.21362 C:0.24883 A:0.20657 G:0.33099
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 12 | TCC 0 | TAC 18 | TGC 0
Leu L TTA 0 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 30 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 6
CTC 6 | CCC 6 | CAC 6 | CGC 6
CTA 6 | CCA 12 | Gln Q CAA 6 | CGA 0
CTG 30 | CCG 24 | CAG 6 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 12 | Ser S AGT 6
ATC 36 | ACC 36 | AAC 12 | AGC 6
ATA 6 | ACA 6 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 18 | ACG 6 | AAG 48 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 24 | Asp D GAT 12 | Gly G GGT 48
GTC 24 | GCC 18 | GAC 48 | GGC 30
GTA 12 | GCA 6 | Glu E GAA 18 | GGA 12
GTG 54 | GCG 36 | GAG 6 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13380 C:0.16901 A:0.25352 G:0.44366
position 2: T:0.30282 C:0.26761 A:0.24648 G:0.18310
position 3: T:0.20423 C:0.30986 A:0.11972 G:0.36620
Average T:0.21362 C:0.24883 A:0.20657 G:0.33099
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -559.333169 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299921 1.300051
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908607_1_2035_MLBR_RS09660: 0.000004, NC_002677_1_NP_302286_1_1158_ML1909: 0.000004, NZ_LVXE01000028_1_WP_010908607_1_1137_A3216_RS08530: 0.000004, NZ_LYPH01000031_1_WP_010908607_1_1219_A8144_RS05860: 0.000004, NZ_CP029543_1_WP_010908607_1_2059_DIJ64_RS10480: 0.000004, NZ_AP014567_1_WP_010908607_1_2114_hadB: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29992
omega (dN/dS) = 1.30005
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 321.8 104.2 1.3001 0.0000 0.0000 0.0 0.0
7..2 0.000 321.8 104.2 1.3001 0.0000 0.0000 0.0 0.0
7..3 0.000 321.8 104.2 1.3001 0.0000 0.0000 0.0 0.0
7..4 0.000 321.8 104.2 1.3001 0.0000 0.0000 0.0 0.0
7..5 0.000 321.8 104.2 1.3001 0.0000 0.0000 0.0 0.0
7..6 0.000 321.8 104.2 1.3001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -559.333184 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.286774 0.769609 0.191233
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908607_1_2035_MLBR_RS09660: 0.000004, NC_002677_1_NP_302286_1_1158_ML1909: 0.000004, NZ_LVXE01000028_1_WP_010908607_1_1137_A3216_RS08530: 0.000004, NZ_LYPH01000031_1_WP_010908607_1_1219_A8144_RS05860: 0.000004, NZ_CP029543_1_WP_010908607_1_2059_DIJ64_RS10480: 0.000004, NZ_AP014567_1_WP_010908607_1_2114_hadB: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.28677
MLEs of dN/dS (w) for site classes (K=2)
p: 0.76961 0.23039
w: 0.19123 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 321.9 104.1 0.3776 0.0000 0.0000 0.0 0.0
7..2 0.000 321.9 104.1 0.3776 0.0000 0.0000 0.0 0.0
7..3 0.000 321.9 104.1 0.3776 0.0000 0.0000 0.0 0.0
7..4 0.000 321.9 104.1 0.3776 0.0000 0.0000 0.0 0.0
7..5 0.000 321.9 104.1 0.3776 0.0000 0.0000 0.0 0.0
7..6 0.000 321.9 104.1 0.3776 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -559.333146 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 998.999379 0.000000 0.000000 0.000001 108.490621
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908607_1_2035_MLBR_RS09660: 0.000004, NC_002677_1_NP_302286_1_1158_ML1909: 0.000004, NZ_LVXE01000028_1_WP_010908607_1_1137_A3216_RS08530: 0.000004, NZ_LYPH01000031_1_WP_010908607_1_1219_A8144_RS05860: 0.000004, NZ_CP029543_1_WP_010908607_1_2059_DIJ64_RS10480: 0.000004, NZ_AP014567_1_WP_010908607_1_2114_hadB: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 998.99938
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 1.00000 108.49062
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 302.3 123.7 108.4906 0.0000 0.0000 0.0 0.0
7..2 0.000 302.3 123.7 108.4906 0.0000 0.0000 0.0 0.0
7..3 0.000 302.3 123.7 108.4906 0.0000 0.0000 0.0 0.0
7..4 0.000 302.3 123.7 108.4906 0.0000 0.0000 0.0 0.0
7..5 0.000 302.3 123.7 108.4906 0.0000 0.0000 0.0 0.0
7..6 0.000 302.3 123.7 108.4906 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908607_1_2035_MLBR_RS09660)
Pr(w>1) post mean +- SE for w
1 M 1.000** 108.491
2 A 1.000** 108.491
3 R 1.000** 108.491
4 R 1.000** 108.491
5 E 1.000** 108.491
6 F 1.000** 108.491
7 S 1.000** 108.491
8 S 1.000** 108.491
9 V 1.000** 108.491
10 K 1.000** 108.491
11 V 1.000** 108.491
12 G 1.000** 108.491
13 D 1.000** 108.491
14 L 1.000** 108.491
15 L 1.000** 108.491
16 P 1.000** 108.491
17 E 1.000** 108.491
18 K 1.000** 108.491
19 T 1.000** 108.491
20 Y 1.000** 108.491
21 P 1.000** 108.491
22 L 1.000** 108.491
23 T 1.000** 108.491
24 R 1.000** 108.491
25 Q 1.000** 108.491
26 D 1.000** 108.491
27 L 1.000** 108.491
28 V 1.000** 108.491
29 N 1.000** 108.491
30 Y 1.000** 108.491
31 A 1.000** 108.491
32 G 1.000** 108.491
33 V 1.000** 108.491
34 S 1.000** 108.491
35 G 1.000** 108.491
36 D 1.000** 108.491
37 L 1.000** 108.491
38 N 1.000** 108.491
39 P 1.000** 108.491
40 I 1.000** 108.491
41 H 1.000** 108.491
42 W 1.000** 108.491
43 D 1.000** 108.491
44 D 1.000** 108.491
45 E 1.000** 108.491
46 I 1.000** 108.491
47 A 1.000** 108.491
48 K 1.000** 108.491
49 V 1.000** 108.491
50 V 1.000** 108.491
51 G 1.000** 108.491
52 L 1.000** 108.491
53 D 1.000** 108.491
54 T 1.000** 108.491
55 A 1.000** 108.491
56 I 1.000** 108.491
57 A 1.000** 108.491
58 H 1.000** 108.491
59 G 1.000** 108.491
60 M 1.000** 108.491
61 L 1.000** 108.491
62 T 1.000** 108.491
63 M 1.000** 108.491
64 G 1.000** 108.491
65 I 1.000** 108.491
66 G 1.000** 108.491
67 G 1.000** 108.491
68 G 1.000** 108.491
69 Y 1.000** 108.491
70 V 1.000** 108.491
71 T 1.000** 108.491
72 S 1.000** 108.491
73 W 1.000** 108.491
74 V 1.000** 108.491
75 G 1.000** 108.491
76 D 1.000** 108.491
77 P 1.000** 108.491
78 G 1.000** 108.491
79 A 1.000** 108.491
80 V 1.000** 108.491
81 I 1.000** 108.491
82 E 1.000** 108.491
83 Y 1.000** 108.491
84 N 1.000** 108.491
85 V 1.000** 108.491
86 R 1.000** 108.491
87 F 1.000** 108.491
88 T 1.000** 108.491
89 A 1.000** 108.491
90 V 1.000** 108.491
91 V 1.000** 108.491
92 P 1.000** 108.491
93 V 1.000** 108.491
94 P 1.000** 108.491
95 N 1.000** 108.491
96 D 1.000** 108.491
97 G 1.000** 108.491
98 Q 1.000** 108.491
99 G 1.000** 108.491
100 A 1.000** 108.491
101 V 1.000** 108.491
102 L 1.000** 108.491
103 V 1.000** 108.491
104 F 1.000** 108.491
105 S 1.000** 108.491
106 G 1.000** 108.491
107 K 1.000** 108.491
108 V 1.000** 108.491
109 K 1.000** 108.491
110 S 1.000** 108.491
111 V 1.000** 108.491
112 D 1.000** 108.491
113 P 1.000** 108.491
114 D 1.000** 108.491
115 T 1.000** 108.491
116 K 1.000** 108.491
117 S 1.000** 108.491
118 V 1.000** 108.491
119 T 1.000** 108.491
120 I 1.000** 108.491
121 A 1.000** 108.491
122 L 1.000** 108.491
123 S 1.000** 108.491
124 A 1.000** 108.491
125 T 1.000** 108.491
126 T 1.000** 108.491
127 G 1.000** 108.491
128 G 1.000** 108.491
129 K 1.000** 108.491
130 K 1.000** 108.491
131 I 1.000** 108.491
132 F 1.000** 108.491
133 G 1.000** 108.491
134 R 1.000** 108.491
135 A 1.000** 108.491
136 I 1.000** 108.491
137 A 1.000** 108.491
138 S 1.000** 108.491
139 A 1.000** 108.491
140 K 1.000** 108.491
141 L 1.000** 108.491
142 A 1.000** 108.491
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908607_1_2035_MLBR_RS09660)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -559.333175 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.394045 99.000000 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908607_1_2035_MLBR_RS09660: 0.000004, NC_002677_1_NP_302286_1_1158_ML1909: 0.000004, NZ_LVXE01000028_1_WP_010908607_1_1137_A3216_RS08530: 0.000004, NZ_LYPH01000031_1_WP_010908607_1_1219_A8144_RS05860: 0.000004, NZ_CP029543_1_WP_010908607_1_2059_DIJ64_RS10480: 0.000004, NZ_AP014567_1_WP_010908607_1_2114_hadB: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.39404
Parameters in M7 (beta):
p = 99.00000 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 302.3 123.7 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 302.3 123.7 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 302.3 123.7 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 302.3 123.7 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 302.3 123.7 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 302.3 123.7 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:16
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
check convergence..
lnL(ntime: 6 np: 11): -559.333167 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.394045 0.000010 0.225296 1.599162 1.561891
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908607_1_2035_MLBR_RS09660: 0.000004, NC_002677_1_NP_302286_1_1158_ML1909: 0.000004, NZ_LVXE01000028_1_WP_010908607_1_1137_A3216_RS08530: 0.000004, NZ_LYPH01000031_1_WP_010908607_1_1219_A8144_RS05860: 0.000004, NZ_CP029543_1_WP_010908607_1_2059_DIJ64_RS10480: 0.000004, NZ_AP014567_1_WP_010908607_1_2114_hadB: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.39405
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.22530 q = 1.59916
(p1 = 0.99999) w = 1.56189
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00012 0.00114 0.00507 0.01556 0.03835 0.08229 0.16173 0.30404 0.58776 1.56189
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 302.3 123.7 1.5619 0.0000 0.0000 0.0 0.0
7..2 0.000 302.3 123.7 1.5619 0.0000 0.0000 0.0 0.0
7..3 0.000 302.3 123.7 1.5619 0.0000 0.0000 0.0 0.0
7..4 0.000 302.3 123.7 1.5619 0.0000 0.0000 0.0 0.0
7..5 0.000 302.3 123.7 1.5619 0.0000 0.0000 0.0 0.0
7..6 0.000 302.3 123.7 1.5619 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908607_1_2035_MLBR_RS09660)
Pr(w>1) post mean +- SE for w
1 M 1.000** 1.562
2 A 1.000** 1.562
3 R 1.000** 1.562
4 R 1.000** 1.562
5 E 1.000** 1.562
6 F 1.000** 1.562
7 S 1.000** 1.562
8 S 1.000** 1.562
9 V 1.000** 1.562
10 K 1.000** 1.562
11 V 1.000** 1.562
12 G 1.000** 1.562
13 D 1.000** 1.562
14 L 1.000** 1.562
15 L 1.000** 1.562
16 P 1.000** 1.562
17 E 1.000** 1.562
18 K 1.000** 1.562
19 T 1.000** 1.562
20 Y 1.000** 1.562
21 P 1.000** 1.562
22 L 1.000** 1.562
23 T 1.000** 1.562
24 R 1.000** 1.562
25 Q 1.000** 1.562
26 D 1.000** 1.562
27 L 1.000** 1.562
28 V 1.000** 1.562
29 N 1.000** 1.562
30 Y 1.000** 1.562
31 A 1.000** 1.562
32 G 1.000** 1.562
33 V 1.000** 1.562
34 S 1.000** 1.562
35 G 1.000** 1.562
36 D 1.000** 1.562
37 L 1.000** 1.562
38 N 1.000** 1.562
39 P 1.000** 1.562
40 I 1.000** 1.562
41 H 1.000** 1.562
42 W 1.000** 1.562
43 D 1.000** 1.562
44 D 1.000** 1.562
45 E 1.000** 1.562
46 I 1.000** 1.562
47 A 1.000** 1.562
48 K 1.000** 1.562
49 V 1.000** 1.562
50 V 1.000** 1.562
51 G 1.000** 1.562
52 L 1.000** 1.562
53 D 1.000** 1.562
54 T 1.000** 1.562
55 A 1.000** 1.562
56 I 1.000** 1.562
57 A 1.000** 1.562
58 H 1.000** 1.562
59 G 1.000** 1.562
60 M 1.000** 1.562
61 L 1.000** 1.562
62 T 1.000** 1.562
63 M 1.000** 1.562
64 G 1.000** 1.562
65 I 1.000** 1.562
66 G 1.000** 1.562
67 G 1.000** 1.562
68 G 1.000** 1.562
69 Y 1.000** 1.562
70 V 1.000** 1.562
71 T 1.000** 1.562
72 S 1.000** 1.562
73 W 1.000** 1.562
74 V 1.000** 1.562
75 G 1.000** 1.562
76 D 1.000** 1.562
77 P 1.000** 1.562
78 G 1.000** 1.562
79 A 1.000** 1.562
80 V 1.000** 1.562
81 I 1.000** 1.562
82 E 1.000** 1.562
83 Y 1.000** 1.562
84 N 1.000** 1.562
85 V 1.000** 1.562
86 R 1.000** 1.562
87 F 1.000** 1.562
88 T 1.000** 1.562
89 A 1.000** 1.562
90 V 1.000** 1.562
91 V 1.000** 1.562
92 P 1.000** 1.562
93 V 1.000** 1.562
94 P 1.000** 1.562
95 N 1.000** 1.562
96 D 1.000** 1.562
97 G 1.000** 1.562
98 Q 1.000** 1.562
99 G 1.000** 1.562
100 A 1.000** 1.562
101 V 1.000** 1.562
102 L 1.000** 1.562
103 V 1.000** 1.562
104 F 1.000** 1.562
105 S 1.000** 1.562
106 G 1.000** 1.562
107 K 1.000** 1.562
108 V 1.000** 1.562
109 K 1.000** 1.562
110 S 1.000** 1.562
111 V 1.000** 1.562
112 D 1.000** 1.562
113 P 1.000** 1.562
114 D 1.000** 1.562
115 T 1.000** 1.562
116 K 1.000** 1.562
117 S 1.000** 1.562
118 V 1.000** 1.562
119 T 1.000** 1.562
120 I 1.000** 1.562
121 A 1.000** 1.562
122 L 1.000** 1.562
123 S 1.000** 1.562
124 A 1.000** 1.562
125 T 1.000** 1.562
126 T 1.000** 1.562
127 G 1.000** 1.562
128 G 1.000** 1.562
129 K 1.000** 1.562
130 K 1.000** 1.562
131 I 1.000** 1.562
132 F 1.000** 1.562
133 G 1.000** 1.562
134 R 1.000** 1.562
135 A 1.000** 1.562
136 I 1.000** 1.562
137 A 1.000** 1.562
138 S 1.000** 1.562
139 A 1.000** 1.562
140 K 1.000** 1.562
141 L 1.000** 1.562
142 A 1.000** 1.562
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908607_1_2035_MLBR_RS09660)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:21
Model 1: NearlyNeutral -559.333184 Model 2: PositiveSelection -559.333146 Model 0: one-ratio -559.333169 Model 7: beta -559.333175 Model 8: beta&w>1 -559.333167 Model 0 vs 1 2.999999992425728E-5 Model 2 vs 1 7.599999980811845E-5 Model 8 vs 7 1.5999999959603883E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
