--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:40:54 GMT 2020
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=500000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=1250
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=1250
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/8res/ML1972/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -316.46 -319.30
2 -316.49 -320.01
--------------------------------------
TOTAL -316.47 -319.72
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882957 0.078944 0.354770 1.406311 0.851771 693.66 722.33 1.001
r(A<->C){all} 0.169197 0.021232 0.000005 0.462508 0.131077 75.05 91.13 1.008
r(A<->G){all} 0.149080 0.015859 0.000035 0.391437 0.115234 80.27 126.90 1.001
r(A<->T){all} 0.174540 0.021005 0.000018 0.445091 0.139390 86.11 89.64 1.000
r(C<->G){all} 0.167789 0.017375 0.000356 0.412330 0.135706 84.09 105.35 1.001
r(C<->T){all} 0.168523 0.022154 0.000044 0.477345 0.126398 72.08 95.43 0.999
r(G<->T){all} 0.170870 0.018035 0.000121 0.443461 0.140111 96.55 102.39 1.003
pi(A){all} 0.221556 0.000686 0.173301 0.273655 0.220827 465.39 579.40 1.000
pi(C){all} 0.267531 0.000834 0.212241 0.327065 0.266050 463.48 607.24 0.999
pi(G){all} 0.283887 0.000830 0.231044 0.343209 0.283098 556.38 653.69 1.000
pi(T){all} 0.227026 0.000748 0.170150 0.276118 0.226673 579.89 614.34 0.999
alpha{1,2} 0.397072 0.235812 0.000124 1.406478 0.232424 327.83 412.79 1.000
alpha{3} 0.455561 0.246717 0.000728 1.432927 0.292828 514.79 632.90 1.000
pinvar{all} 0.992036 0.000097 0.972172 0.999999 0.995388 531.53 641.27 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -300.144045
Model 2: PositiveSelection -300.143925
Model 0: one-ratio -300.143926
Model 3: discrete -300.143925
Model 7: beta -300.143925
Model 8: beta&w>1 -300.143926
Model 0 vs 1 2.3799999996754195E-4
Model 2 vs 1 2.3999999996249244E-4
Model 8 vs 7 1.9999999949504854E-6
>C1
LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
ILLSEVITRSEVTWWVLDLAGPGLKK
>C2
LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
ILLSEVITRSEVTWWVLDLAGPGLKK
>C3
LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
ILLSEVITRSEVTWWVLDLAGPGLKK
>C4
LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
ILLSEVITRSEVTWWVLDLAGPGLKK
>C5
LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
ILLSEVITRSEVTWWVLDLAGPGLKK
>C6
LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
ILLSEVITRSEVTWWVLDLAGPGLKK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=76
C1 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
C2 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
C3 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
C4 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
C5 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
C6 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
**************************************************
C1 ILLSEVITRSEVTWWVLDLAGPGLKK
C2 ILLSEVITRSEVTWWVLDLAGPGLKK
C3 ILLSEVITRSEVTWWVLDLAGPGLKK
C4 ILLSEVITRSEVTWWVLDLAGPGLKK
C5 ILLSEVITRSEVTWWVLDLAGPGLKK
C6 ILLSEVITRSEVTWWVLDLAGPGLKK
**************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 76 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 76 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2280]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2280]--->[2280]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.447 Mb, Max= 30.596 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
C2 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
C3 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
C4 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
C5 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
C6 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
**************************************************
C1 ILLSEVITRSEVTWWVLDLAGPGLKK
C2 ILLSEVITRSEVTWWVLDLAGPGLKK
C3 ILLSEVITRSEVTWWVLDLAGPGLKK
C4 ILLSEVITRSEVTWWVLDLAGPGLKK
C5 ILLSEVITRSEVTWWVLDLAGPGLKK
C6 ILLSEVITRSEVTWWVLDLAGPGLKK
**************************
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA
C2 TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA
C3 TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA
C4 TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA
C5 TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA
C6 TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA
**************************************************
C1 CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT
C2 CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT
C3 CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT
C4 CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT
C5 CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT
C6 CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT
**************************************************
C1 TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC
C2 TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC
C3 TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC
C4 TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC
C5 TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC
C6 TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC
**************************************************
C1 ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT
C2 ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT
C3 ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT
C4 ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT
C5 ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT
C6 ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT
**************************************************
C1 CGATTTAGCCGGCCCAGGCCTCAAAAAA
C2 CGATTTAGCCGGCCCAGGCCTCAAAAAA
C3 CGATTTAGCCGGCCCAGGCCTCAAAAAA
C4 CGATTTAGCCGGCCCAGGCCTCAAAAAA
C5 CGATTTAGCCGGCCCAGGCCTCAAAAAA
C6 CGATTTAGCCGGCCCAGGCCTCAAAAAA
****************************
>C1
TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA
CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT
TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC
ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT
CGATTTAGCCGGCCCAGGCCTCAAAAAA
>C2
TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA
CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT
TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC
ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT
CGATTTAGCCGGCCCAGGCCTCAAAAAA
>C3
TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA
CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT
TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC
ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT
CGATTTAGCCGGCCCAGGCCTCAAAAAA
>C4
TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA
CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT
TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC
ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT
CGATTTAGCCGGCCCAGGCCTCAAAAAA
>C5
TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA
CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT
TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC
ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT
CGATTTAGCCGGCCCAGGCCTCAAAAAA
>C6
TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA
CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT
TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC
ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT
CGATTTAGCCGGCCCAGGCCTCAAAAAA
>C1
LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
ILLSEVITRSEVTWWVLDLAGPGLKK
>C2
LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
ILLSEVITRSEVTWWVLDLAGPGLKK
>C3
LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
ILLSEVITRSEVTWWVLDLAGPGLKK
>C4
LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
ILLSEVITRSEVTWWVLDLAGPGLKK
>C5
LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
ILLSEVITRSEVTWWVLDLAGPGLKK
>C6
LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
ILLSEVITRSEVTWWVLDLAGPGLKK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 228 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855195
Setting output file names to "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1746634552
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 500000
Running Markov chain
MCMC stamp = 5966703673
Seed = 1318889156
Swapseed = 1579855195
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -510.274930 -- -24.965149
Chain 2 -- -510.274930 -- -24.965149
Chain 3 -- -510.274930 -- -24.965149
Chain 4 -- -510.274853 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -510.274930 -- -24.965149
Chain 2 -- -510.274901 -- -24.965149
Chain 3 -- -510.274901 -- -24.965149
Chain 4 -- -510.274930 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (500000 generations requested):
0 -- [-510.275] (-510.275) (-510.275) (-510.275) * [-510.275] (-510.275) (-510.275) (-510.275)
500 -- (-322.757) [-322.215] (-326.913) (-321.484) * (-328.904) [-325.316] (-319.089) (-333.551) -- 0:00:00
1000 -- [-320.925] (-324.346) (-326.750) (-325.330) * [-323.662] (-328.574) (-329.414) (-325.080) -- 0:00:00
1500 -- [-326.698] (-330.951) (-324.949) (-320.194) * (-326.226) [-323.817] (-331.266) (-328.927) -- 0:00:00
2000 -- (-324.805) (-322.924) [-326.305] (-321.849) * (-323.329) [-325.223] (-326.580) (-334.310) -- 0:00:00
2500 -- [-324.913] (-324.518) (-328.610) (-321.356) * (-324.660) (-329.231) [-319.127] (-330.975) -- 0:00:00
3000 -- [-320.245] (-326.357) (-330.156) (-323.487) * (-326.246) [-323.084] (-323.148) (-325.846) -- 0:00:00
3500 -- (-332.796) [-325.962] (-328.770) (-328.397) * [-320.013] (-325.139) (-335.278) (-325.127) -- 0:00:00
4000 -- [-326.140] (-324.713) (-323.751) (-323.403) * (-332.592) (-329.767) (-324.921) [-323.521] -- 0:00:00
4500 -- [-322.023] (-330.375) (-323.958) (-326.114) * (-338.348) (-329.398) (-322.766) [-324.762] -- 0:00:00
5000 -- [-329.088] (-328.220) (-330.516) (-329.837) * [-323.050] (-328.926) (-329.364) (-330.846) -- 0:00:00
Average standard deviation of split frequencies: 0.099243
5500 -- (-326.662) [-326.273] (-327.465) (-323.437) * (-330.248) (-320.239) (-327.194) [-324.590] -- 0:00:00
6000 -- (-326.876) [-332.034] (-328.796) (-321.006) * (-325.385) [-317.206] (-320.135) (-328.149) -- 0:00:00
6500 -- (-322.647) (-330.806) [-321.344] (-326.809) * (-330.203) (-318.433) [-320.000] (-326.266) -- 0:00:00
7000 -- (-319.466) (-326.271) (-323.113) [-330.425] * (-337.436) [-316.915] (-327.348) (-336.576) -- 0:00:00
7500 -- [-327.582] (-320.201) (-327.502) (-322.952) * (-328.479) [-320.885] (-332.883) (-331.548) -- 0:00:00
8000 -- (-324.832) [-321.373] (-326.308) (-330.722) * [-335.939] (-319.885) (-327.870) (-325.318) -- 0:00:00
8500 -- (-332.573) (-324.351) (-324.918) [-331.693] * (-325.831) [-318.093] (-318.837) (-335.026) -- 0:00:57
9000 -- [-327.413] (-328.272) (-329.293) (-328.407) * (-337.603) (-316.816) (-317.734) [-321.772] -- 0:00:54
9500 -- (-347.674) (-324.480) [-325.238] (-329.371) * (-332.505) [-318.502] (-316.076) (-320.877) -- 0:00:51
10000 -- (-344.118) [-326.749] (-326.896) (-329.702) * (-331.774) [-317.707] (-317.446) (-330.158) -- 0:00:49
Average standard deviation of split frequencies: 0.058150
10500 -- (-335.149) (-327.724) (-326.240) [-321.061] * (-332.234) (-317.816) (-316.146) [-324.265] -- 0:00:46
11000 -- (-331.072) (-321.072) (-320.579) [-320.469] * (-335.826) (-315.178) (-315.689) [-325.219] -- 0:00:44
11500 -- (-317.641) (-326.909) (-338.231) [-322.502] * (-326.698) (-315.872) [-317.036] (-326.831) -- 0:00:42
12000 -- [-320.209] (-326.262) (-335.784) (-333.947) * [-317.041] (-316.668) (-315.426) (-331.823) -- 0:00:40
12500 -- [-317.160] (-326.497) (-326.176) (-351.064) * (-316.740) (-316.415) (-316.428) [-329.334] -- 0:00:39
13000 -- [-315.511] (-328.130) (-336.254) (-335.724) * [-316.562] (-316.858) (-316.119) (-332.614) -- 0:00:37
13500 -- (-316.342) (-323.246) (-327.370) [-323.448] * [-315.662] (-317.766) (-321.980) (-330.158) -- 0:00:36
14000 -- (-315.956) (-329.836) (-326.664) [-325.660] * (-317.743) (-316.545) (-317.194) [-335.869] -- 0:00:34
14500 -- [-315.671] (-326.920) (-334.483) (-325.592) * (-317.806) (-316.778) [-317.536] (-337.661) -- 0:00:33
15000 -- (-317.189) (-337.366) [-330.994] (-325.629) * [-317.277] (-316.127) (-318.006) (-336.676) -- 0:00:32
Average standard deviation of split frequencies: 0.062199
15500 -- (-316.417) (-325.325) [-323.549] (-324.691) * (-317.769) [-317.806] (-317.040) (-336.080) -- 0:00:31
16000 -- (-320.619) (-334.251) (-335.309) [-322.796] * (-316.874) (-315.947) [-320.145] (-331.559) -- 0:00:30
16500 -- (-315.924) (-320.644) [-324.853] (-323.324) * (-316.173) [-316.400] (-318.624) (-323.162) -- 0:00:29
17000 -- [-315.881] (-331.760) (-320.164) (-319.405) * (-316.559) [-315.927] (-319.582) (-320.598) -- 0:00:28
17500 -- (-315.741) [-328.079] (-325.994) (-315.716) * (-317.346) (-318.890) [-320.333] (-318.316) -- 0:00:27
18000 -- [-317.538] (-321.302) (-332.786) (-320.275) * (-316.191) (-317.883) [-318.242] (-317.832) -- 0:00:26
18500 -- (-318.298) (-319.388) (-332.745) [-316.474] * (-318.215) [-315.611] (-318.869) (-316.853) -- 0:00:26
19000 -- [-318.471] (-322.039) (-327.337) (-315.487) * [-316.280] (-319.050) (-317.254) (-316.960) -- 0:00:25
19500 -- (-321.218) [-318.018] (-317.265) (-315.938) * (-316.763) (-315.789) [-318.389] (-317.304) -- 0:00:24
20000 -- (-323.532) (-316.682) [-322.124] (-319.299) * (-315.687) [-318.600] (-316.348) (-317.083) -- 0:00:24
Average standard deviation of split frequencies: 0.045620
20500 -- (-322.419) [-317.957] (-321.918) (-316.704) * (-316.388) [-320.258] (-320.592) (-319.314) -- 0:00:23
21000 -- (-321.818) [-315.422] (-321.291) (-317.703) * (-315.049) (-315.993) [-315.238] (-319.193) -- 0:00:22
21500 -- (-317.516) [-319.215] (-320.059) (-317.434) * (-316.378) (-315.595) [-317.298] (-315.323) -- 0:00:22
22000 -- (-315.231) (-318.902) (-316.730) [-317.779] * (-320.026) [-315.956] (-317.319) (-321.746) -- 0:00:21
22500 -- (-317.135) (-318.231) (-318.212) [-317.117] * (-317.815) (-316.732) [-318.281] (-318.904) -- 0:00:21
23000 -- (-318.743) (-316.702) (-315.267) [-315.208] * [-318.076] (-316.528) (-315.806) (-317.562) -- 0:00:20
23500 -- [-316.355] (-317.200) (-316.504) (-315.294) * (-321.813) (-316.660) [-317.172] (-319.318) -- 0:00:40
24000 -- (-316.528) (-317.816) [-317.056] (-317.489) * [-315.888] (-316.094) (-315.841) (-316.884) -- 0:00:39
24500 -- (-316.461) (-316.854) [-316.648] (-319.137) * (-316.673) (-317.863) [-315.651] (-316.055) -- 0:00:38
25000 -- (-316.976) [-318.144] (-318.334) (-322.643) * (-319.275) [-317.999] (-315.131) (-319.035) -- 0:00:38
Average standard deviation of split frequencies: 0.041442
25500 -- (-319.616) (-321.181) [-316.411] (-315.375) * (-320.340) [-318.691] (-315.761) (-319.055) -- 0:00:37
26000 -- (-322.655) [-317.415] (-316.515) (-316.150) * (-317.927) [-317.755] (-317.652) (-318.047) -- 0:00:36
26500 -- (-318.615) (-318.113) [-317.042] (-316.975) * [-319.062] (-316.109) (-317.308) (-321.628) -- 0:00:35
27000 -- (-317.447) (-316.381) (-320.552) [-316.931] * [-319.767] (-315.311) (-316.033) (-318.020) -- 0:00:35
27500 -- (-318.051) (-318.362) (-319.927) [-315.862] * [-318.722] (-317.271) (-318.705) (-316.842) -- 0:00:34
28000 -- [-317.562] (-316.477) (-316.616) (-316.291) * [-317.292] (-320.156) (-316.274) (-315.447) -- 0:00:33
28500 -- (-318.210) (-316.957) (-316.643) [-317.186] * [-317.958] (-321.057) (-321.568) (-318.094) -- 0:00:33
29000 -- (-319.048) [-316.491] (-318.317) (-316.909) * (-318.655) (-316.868) (-322.687) [-315.892] -- 0:00:32
29500 -- (-315.916) [-316.398] (-319.438) (-317.232) * (-319.239) (-318.441) (-321.070) [-316.318] -- 0:00:31
30000 -- [-316.497] (-316.216) (-316.981) (-317.535) * (-315.968) [-318.281] (-320.665) (-315.367) -- 0:00:31
Average standard deviation of split frequencies: 0.038096
30500 -- [-316.644] (-319.636) (-320.581) (-316.794) * (-317.088) [-319.105] (-317.580) (-317.549) -- 0:00:30
31000 -- (-317.586) [-316.649] (-317.882) (-320.925) * (-317.681) [-316.925] (-316.521) (-317.051) -- 0:00:30
31500 -- (-316.048) [-316.602] (-318.249) (-317.954) * (-315.270) [-315.657] (-318.904) (-325.138) -- 0:00:29
32000 -- (-318.020) (-315.257) (-316.578) [-315.070] * (-322.033) (-317.492) (-318.234) [-319.117] -- 0:00:29
32500 -- (-316.044) [-317.376] (-317.184) (-315.292) * (-319.199) (-316.685) (-315.495) [-316.636] -- 0:00:28
33000 -- [-317.276] (-317.238) (-317.744) (-314.936) * (-316.895) (-315.831) [-319.085] (-321.904) -- 0:00:28
33500 -- (-317.097) (-317.147) (-318.357) [-315.226] * [-317.903] (-318.295) (-316.377) (-318.533) -- 0:00:27
34000 -- [-318.702] (-318.011) (-316.536) (-315.140) * (-317.725) (-317.644) [-315.530] (-316.254) -- 0:00:27
34500 -- (-316.552) (-317.535) (-319.906) [-318.940] * (-316.720) (-316.662) (-316.254) [-317.254] -- 0:00:26
35000 -- (-321.254) [-320.514] (-316.044) (-321.691) * [-319.182] (-318.522) (-316.092) (-317.300) -- 0:00:26
Average standard deviation of split frequencies: 0.029605
35500 -- (-316.632) (-319.661) (-316.348) [-315.982] * (-317.633) (-323.991) [-318.328] (-316.309) -- 0:00:26
36000 -- (-318.445) [-316.338] (-319.041) (-322.014) * [-315.830] (-319.794) (-316.594) (-318.311) -- 0:00:25
36500 -- (-317.426) (-316.979) (-321.179) [-317.372] * [-316.060] (-319.438) (-319.685) (-319.855) -- 0:00:25
37000 -- (-316.177) [-322.108] (-324.522) (-320.847) * (-317.035) [-319.677] (-317.384) (-321.034) -- 0:00:25
37500 -- [-317.379] (-317.194) (-319.236) (-316.624) * [-317.908] (-319.215) (-317.190) (-319.971) -- 0:00:24
38000 -- (-317.375) [-318.070] (-318.642) (-321.623) * (-318.892) (-315.803) (-316.523) [-317.867] -- 0:00:36
38500 -- (-316.072) (-318.297) [-316.498] (-316.137) * (-322.189) [-317.228] (-318.736) (-319.392) -- 0:00:35
39000 -- (-316.008) [-315.899] (-319.495) (-316.048) * (-324.284) [-318.280] (-315.309) (-315.851) -- 0:00:35
39500 -- [-315.505] (-316.956) (-319.776) (-318.786) * (-317.149) (-317.238) [-316.789] (-315.272) -- 0:00:34
40000 -- [-315.524] (-316.588) (-317.489) (-319.332) * (-316.799) (-315.887) [-317.355] (-315.073) -- 0:00:34
Average standard deviation of split frequencies: 0.030268
40500 -- (-315.789) [-315.872] (-317.482) (-317.227) * [-315.839] (-321.435) (-316.356) (-319.278) -- 0:00:34
41000 -- (-316.440) [-318.655] (-317.896) (-317.027) * (-317.090) (-321.238) [-315.029] (-317.191) -- 0:00:33
41500 -- (-314.795) (-316.691) (-316.949) [-317.086] * (-319.161) [-317.739] (-317.245) (-318.244) -- 0:00:33
42000 -- (-316.486) (-317.331) (-316.489) [-317.011] * (-318.147) (-316.280) (-319.132) [-317.637] -- 0:00:32
42500 -- (-315.223) [-317.037] (-320.188) (-316.394) * [-315.920] (-316.883) (-318.514) (-316.381) -- 0:00:32
43000 -- (-319.293) [-317.784] (-317.767) (-316.192) * (-317.363) [-317.413] (-317.386) (-321.260) -- 0:00:31
43500 -- (-319.231) [-317.949] (-320.390) (-318.143) * (-317.359) (-316.009) [-318.198] (-317.045) -- 0:00:31
44000 -- (-315.427) (-315.174) (-321.668) [-314.942] * (-318.959) [-315.681] (-317.589) (-317.545) -- 0:00:31
44500 -- (-316.435) [-316.659] (-319.154) (-316.766) * (-316.584) (-315.631) (-321.136) [-317.920] -- 0:00:30
45000 -- [-315.345] (-316.851) (-318.323) (-316.198) * (-317.094) (-317.918) (-320.349) [-315.858] -- 0:00:30
Average standard deviation of split frequencies: 0.029719
45500 -- (-318.870) (-318.666) (-322.608) [-315.708] * [-315.922] (-320.423) (-318.752) (-317.231) -- 0:00:29
46000 -- (-324.608) (-318.844) [-316.383] (-317.045) * (-316.889) (-324.961) [-318.532] (-320.207) -- 0:00:29
46500 -- (-317.366) (-318.456) [-315.385] (-317.037) * [-317.335] (-319.712) (-316.647) (-315.475) -- 0:00:29
47000 -- (-318.380) (-315.935) [-320.349] (-316.224) * [-318.344] (-319.151) (-320.081) (-316.775) -- 0:00:28
47500 -- (-316.726) (-321.913) [-318.457] (-316.951) * [-318.929] (-320.957) (-317.863) (-316.968) -- 0:00:28
48000 -- (-319.322) (-316.168) [-316.175] (-317.715) * (-315.973) (-325.739) [-315.196] (-315.542) -- 0:00:28
48500 -- (-317.719) (-316.752) [-316.775] (-321.943) * (-318.093) (-323.201) [-315.495] (-315.733) -- 0:00:27
49000 -- [-316.871] (-316.435) (-317.081) (-325.853) * (-315.606) (-319.144) [-316.084] (-319.894) -- 0:00:27
49500 -- (-317.918) (-317.463) [-315.723] (-327.811) * [-316.986] (-317.778) (-315.086) (-318.556) -- 0:00:27
50000 -- (-315.895) [-318.015] (-315.700) (-321.621) * (-316.121) (-316.360) (-315.317) [-318.586] -- 0:00:27
Average standard deviation of split frequencies: 0.019494
50500 -- [-317.810] (-318.095) (-316.457) (-317.236) * (-317.989) [-316.107] (-320.245) (-317.594) -- 0:00:26
51000 -- (-320.050) [-316.633] (-316.841) (-318.346) * (-321.549) [-317.326] (-316.866) (-318.396) -- 0:00:26
51500 -- (-316.328) (-318.211) [-316.598] (-317.057) * (-318.320) (-316.557) [-317.495] (-317.169) -- 0:00:26
52000 -- (-317.917) (-317.558) [-316.324] (-316.903) * [-319.595] (-317.620) (-318.522) (-319.082) -- 0:00:25
52500 -- (-316.293) (-316.046) [-316.642] (-316.412) * (-317.116) [-316.390] (-325.027) (-320.939) -- 0:00:34
53000 -- (-320.284) (-316.369) [-315.700] (-318.514) * (-315.154) (-317.295) (-322.496) [-315.635] -- 0:00:33
53500 -- (-318.113) (-318.180) [-317.659] (-321.119) * (-317.654) [-318.184] (-318.101) (-316.597) -- 0:00:33
54000 -- (-318.144) (-318.174) [-317.762] (-315.742) * (-317.014) (-315.858) [-317.497] (-317.527) -- 0:00:33
54500 -- (-317.162) (-318.836) [-316.112] (-319.764) * (-316.024) [-316.624] (-316.565) (-316.169) -- 0:00:32
55000 -- [-317.049] (-320.406) (-321.360) (-322.769) * (-319.940) [-316.838] (-317.663) (-315.518) -- 0:00:32
Average standard deviation of split frequencies: 0.018099
55500 -- (-316.177) [-317.034] (-320.590) (-319.157) * [-319.919] (-315.496) (-315.548) (-316.162) -- 0:00:32
56000 -- (-316.401) [-320.688] (-315.960) (-315.874) * (-318.867) [-318.150] (-317.801) (-317.598) -- 0:00:31
56500 -- (-316.912) (-319.669) [-316.496] (-320.543) * (-321.369) (-316.407) (-316.394) [-316.100] -- 0:00:31
57000 -- [-316.965] (-318.858) (-315.284) (-318.419) * (-317.666) [-317.530] (-320.637) (-316.434) -- 0:00:31
57500 -- (-321.156) [-317.518] (-316.612) (-317.654) * (-316.723) [-319.234] (-318.407) (-319.723) -- 0:00:30
58000 -- [-317.193] (-317.389) (-319.466) (-315.778) * (-316.947) (-315.494) (-316.396) [-317.569] -- 0:00:30
58500 -- [-318.329] (-317.339) (-318.885) (-320.275) * (-317.015) (-316.681) (-318.766) [-315.971] -- 0:00:30
59000 -- (-316.099) (-315.693) (-318.251) [-315.782] * (-316.379) (-318.740) (-318.004) [-315.323] -- 0:00:29
59500 -- (-316.682) (-316.686) (-314.887) [-316.266] * (-317.790) (-315.678) [-317.154] (-316.042) -- 0:00:29
60000 -- [-317.270] (-316.091) (-318.427) (-317.179) * (-315.938) [-323.672] (-317.109) (-316.209) -- 0:00:29
Average standard deviation of split frequencies: 0.020203
60500 -- [-319.013] (-319.116) (-316.350) (-316.610) * (-316.068) (-317.309) (-320.665) [-315.844] -- 0:00:29
61000 -- (-317.104) (-320.582) (-316.286) [-319.265] * (-318.103) (-317.174) (-316.720) [-316.037] -- 0:00:28
61500 -- (-317.516) [-317.266] (-319.229) (-320.794) * (-321.424) (-315.556) (-314.936) [-317.657] -- 0:00:28
62000 -- [-318.452] (-315.405) (-319.362) (-318.839) * (-317.509) (-315.649) [-315.803] (-317.401) -- 0:00:28
62500 -- (-317.880) [-316.073] (-316.557) (-318.073) * (-316.641) (-317.982) (-318.357) [-315.724] -- 0:00:28
63000 -- (-319.854) (-319.256) [-320.782] (-316.055) * (-320.861) [-315.333] (-316.792) (-316.531) -- 0:00:27
63500 -- (-321.174) (-315.650) (-317.636) [-319.088] * (-319.131) [-316.297] (-316.847) (-315.194) -- 0:00:27
64000 -- (-318.529) (-317.014) (-316.784) [-318.764] * (-322.671) (-318.563) (-319.469) [-315.738] -- 0:00:27
64500 -- (-318.598) [-316.633] (-316.711) (-319.528) * (-321.496) [-316.563] (-315.290) (-317.584) -- 0:00:27
65000 -- (-317.398) [-316.132] (-320.174) (-316.421) * (-316.430) (-315.190) [-317.417] (-315.227) -- 0:00:26
Average standard deviation of split frequencies: 0.021070
65500 -- [-319.312] (-321.206) (-318.153) (-317.298) * (-320.580) (-319.081) [-315.677] (-317.950) -- 0:00:26
66000 -- (-319.641) (-318.755) [-315.313] (-316.007) * (-320.264) (-318.605) [-315.440] (-318.216) -- 0:00:26
66500 -- (-316.576) (-317.981) (-315.539) [-317.261] * (-318.698) [-316.940] (-316.841) (-320.278) -- 0:00:26
67000 -- [-317.949] (-317.020) (-316.374) (-318.147) * (-316.176) (-316.148) (-321.687) [-318.045] -- 0:00:25
67500 -- (-318.807) (-320.144) [-317.946] (-321.958) * [-317.859] (-317.051) (-315.925) (-319.322) -- 0:00:25
68000 -- (-315.222) (-316.710) [-315.721] (-317.266) * [-315.875] (-317.801) (-320.529) (-317.668) -- 0:00:25
68500 -- [-316.953] (-318.369) (-318.974) (-318.981) * (-319.383) (-318.318) (-318.115) [-320.581] -- 0:00:31
69000 -- (-315.799) (-320.787) (-317.693) [-316.177] * (-318.573) (-316.439) (-315.144) [-318.697] -- 0:00:31
69500 -- [-315.576] (-316.061) (-319.009) (-318.387) * (-316.905) [-317.485] (-315.134) (-318.127) -- 0:00:30
70000 -- (-317.068) [-317.339] (-316.825) (-317.397) * (-320.205) (-316.716) (-318.908) [-315.488] -- 0:00:30
Average standard deviation of split frequencies: 0.020648
70500 -- (-317.979) (-316.951) [-316.443] (-318.507) * (-317.048) [-317.579] (-315.489) (-316.682) -- 0:00:30
71000 -- [-315.696] (-318.338) (-318.368) (-318.087) * (-317.487) [-317.328] (-316.017) (-315.858) -- 0:00:30
71500 -- (-317.100) [-316.335] (-322.873) (-318.750) * (-318.921) (-316.430) (-317.960) [-316.517] -- 0:00:29
72000 -- (-315.622) (-317.749) (-319.017) [-315.814] * (-317.787) (-319.536) [-318.064] (-319.190) -- 0:00:29
72500 -- (-315.854) [-316.508] (-319.101) (-315.340) * [-317.974] (-321.440) (-321.021) (-318.424) -- 0:00:29
73000 -- (-316.247) (-317.043) (-317.653) [-316.237] * (-317.097) (-317.248) (-325.710) [-315.028] -- 0:00:29
73500 -- (-316.407) [-318.467] (-320.718) (-316.643) * (-319.406) (-316.456) (-319.310) [-316.723] -- 0:00:29
74000 -- (-315.451) (-315.990) [-318.166] (-317.387) * (-316.877) [-316.393] (-317.170) (-316.270) -- 0:00:28
74500 -- (-317.745) (-317.116) [-316.150] (-317.368) * (-316.661) [-315.649] (-316.653) (-320.913) -- 0:00:28
75000 -- [-317.335] (-315.659) (-320.570) (-319.108) * (-317.478) [-318.106] (-317.504) (-315.168) -- 0:00:28
Average standard deviation of split frequencies: 0.018918
75500 -- (-316.505) [-317.719] (-318.090) (-316.127) * [-315.931] (-316.630) (-316.756) (-318.031) -- 0:00:28
76000 -- [-316.002] (-317.269) (-317.890) (-323.793) * [-317.644] (-317.723) (-317.819) (-315.327) -- 0:00:27
76500 -- (-315.824) [-317.566] (-317.711) (-316.960) * (-315.712) [-318.038] (-321.684) (-316.968) -- 0:00:27
77000 -- (-317.444) [-317.501] (-317.596) (-317.862) * (-319.421) [-319.314] (-316.163) (-316.900) -- 0:00:27
77500 -- (-316.315) (-316.155) [-315.649] (-315.960) * [-315.083] (-316.485) (-319.195) (-317.475) -- 0:00:27
78000 -- (-316.264) (-316.591) (-316.110) [-319.373] * [-316.612] (-315.598) (-318.058) (-319.678) -- 0:00:27
78500 -- [-316.106] (-317.331) (-315.936) (-316.844) * (-316.228) (-316.588) [-315.361] (-316.347) -- 0:00:26
79000 -- (-319.213) (-315.556) (-316.117) [-316.240] * (-316.483) (-316.862) (-316.164) [-317.786] -- 0:00:26
79500 -- [-320.180] (-315.839) (-315.834) (-317.926) * [-316.882] (-318.158) (-315.989) (-315.277) -- 0:00:26
80000 -- (-319.755) (-317.115) (-320.083) [-318.283] * (-315.908) [-317.333] (-319.042) (-317.649) -- 0:00:26
Average standard deviation of split frequencies: 0.018923
80500 -- (-321.560) [-315.309] (-317.792) (-318.230) * [-318.725] (-315.746) (-320.137) (-317.581) -- 0:00:26
81000 -- [-318.219] (-323.289) (-316.622) (-317.166) * (-316.292) (-317.949) [-318.427] (-317.224) -- 0:00:25
81500 -- (-316.839) (-318.099) [-316.006] (-320.259) * (-319.716) (-316.280) (-316.507) [-316.056] -- 0:00:25
82000 -- (-317.723) (-317.737) [-318.300] (-317.246) * (-317.132) [-316.684] (-317.007) (-319.703) -- 0:00:25
82500 -- [-316.999] (-316.272) (-320.097) (-315.026) * [-319.872] (-318.614) (-317.398) (-315.383) -- 0:00:25
83000 -- [-316.931] (-315.559) (-318.145) (-319.075) * [-317.165] (-318.406) (-316.667) (-317.800) -- 0:00:25
83500 -- (-315.698) (-318.902) [-317.368] (-319.272) * (-317.888) (-317.252) (-317.987) [-318.706] -- 0:00:29
84000 -- (-318.464) (-315.459) (-316.840) [-316.326] * (-318.140) (-317.934) (-316.154) [-315.826] -- 0:00:29
84500 -- [-316.929] (-318.450) (-316.476) (-316.492) * [-316.996] (-319.698) (-317.272) (-319.924) -- 0:00:29
85000 -- (-315.192) (-315.309) (-317.751) [-319.060] * (-315.553) (-318.043) [-315.442] (-318.153) -- 0:00:29
Average standard deviation of split frequencies: 0.021104
85500 -- (-318.795) (-319.445) (-319.194) [-318.506] * [-316.505] (-318.135) (-318.268) (-317.660) -- 0:00:29
86000 -- (-316.061) (-319.971) [-318.904] (-318.330) * (-314.962) [-319.053] (-315.703) (-318.854) -- 0:00:28
86500 -- (-315.757) (-321.213) (-315.517) [-317.365] * (-315.175) [-315.746] (-317.542) (-319.865) -- 0:00:28
87000 -- [-315.597] (-316.640) (-317.548) (-316.722) * (-317.601) (-316.387) (-315.639) [-318.806] -- 0:00:28
87500 -- [-317.089] (-318.287) (-320.763) (-320.164) * (-315.612) [-319.507] (-317.337) (-316.956) -- 0:00:28
88000 -- (-316.561) (-318.642) [-315.271] (-319.165) * (-315.901) (-318.785) (-320.814) [-316.936] -- 0:00:28
88500 -- (-315.621) [-320.459] (-316.512) (-316.608) * (-318.208) (-316.143) (-319.397) [-318.795] -- 0:00:27
89000 -- (-318.266) (-317.332) [-317.379] (-317.845) * (-319.516) (-315.736) (-320.013) [-317.066] -- 0:00:27
89500 -- [-315.768] (-317.847) (-316.804) (-320.697) * (-317.311) [-315.933] (-318.438) (-318.183) -- 0:00:27
90000 -- (-318.673) [-316.382] (-317.554) (-315.662) * [-317.431] (-316.828) (-316.808) (-317.227) -- 0:00:27
Average standard deviation of split frequencies: 0.020017
90500 -- [-317.145] (-322.086) (-319.419) (-317.235) * (-315.304) (-316.919) [-315.252] (-319.649) -- 0:00:27
91000 -- (-320.878) [-318.584] (-321.206) (-320.546) * (-319.840) (-316.127) (-316.868) [-318.261] -- 0:00:26
91500 -- (-316.418) (-317.759) (-322.593) [-319.720] * (-318.029) (-316.347) (-318.853) [-317.179] -- 0:00:26
92000 -- (-315.590) (-318.467) [-318.296] (-316.239) * (-316.403) (-324.286) [-316.875] (-316.638) -- 0:00:26
92500 -- (-320.878) (-319.719) [-317.246] (-318.301) * (-319.780) [-317.317] (-317.008) (-315.393) -- 0:00:26
93000 -- (-319.962) (-320.677) (-316.164) [-315.777] * (-320.988) (-319.214) (-316.096) [-315.754] -- 0:00:26
93500 -- [-318.389] (-322.210) (-316.915) (-319.018) * (-314.917) [-317.957] (-316.408) (-315.881) -- 0:00:26
94000 -- (-315.417) (-318.048) (-317.976) [-321.171] * [-316.453] (-317.094) (-317.250) (-315.965) -- 0:00:25
94500 -- [-318.048] (-316.682) (-315.609) (-319.204) * (-320.715) (-317.534) [-318.441] (-322.147) -- 0:00:25
95000 -- (-316.599) [-316.110] (-318.504) (-317.901) * (-315.848) [-320.834] (-316.033) (-318.190) -- 0:00:25
Average standard deviation of split frequencies: 0.018905
95500 -- (-317.534) (-319.202) [-318.500] (-318.510) * (-317.214) (-324.290) [-316.062] (-316.331) -- 0:00:25
96000 -- [-317.368] (-318.080) (-316.439) (-319.281) * (-317.136) (-315.108) [-316.420] (-319.225) -- 0:00:25
96500 -- (-319.388) (-319.151) (-316.950) [-315.290] * (-316.401) (-316.655) (-316.729) [-318.601] -- 0:00:25
97000 -- (-316.524) [-315.514] (-318.553) (-319.029) * (-320.057) (-316.180) (-321.933) [-316.267] -- 0:00:24
97500 -- (-315.965) (-316.622) (-315.418) [-320.014] * (-319.396) (-317.377) (-321.222) [-317.306] -- 0:00:24
98000 -- (-316.652) [-318.640] (-315.525) (-320.164) * [-315.876] (-317.246) (-321.430) (-317.152) -- 0:00:24
98500 -- (-317.316) [-318.277] (-317.751) (-317.974) * (-316.774) [-318.450] (-318.437) (-317.215) -- 0:00:28
99000 -- [-317.655] (-323.046) (-316.464) (-317.316) * [-317.180] (-316.206) (-323.702) (-316.855) -- 0:00:28
99500 -- (-318.026) (-318.045) [-315.449] (-318.176) * (-315.873) (-317.741) [-319.810] (-315.880) -- 0:00:28
100000 -- (-315.520) (-319.160) [-318.347] (-319.640) * (-316.005) (-316.835) (-318.070) [-318.785] -- 0:00:27
Average standard deviation of split frequencies: 0.014295
100500 -- (-315.419) [-318.126] (-318.154) (-316.767) * (-319.247) [-316.808] (-316.191) (-317.016) -- 0:00:27
101000 -- [-316.533] (-317.488) (-317.853) (-316.478) * (-315.957) (-316.417) [-315.818] (-318.670) -- 0:00:27
101500 -- (-319.522) [-316.375] (-318.756) (-320.833) * [-316.413] (-315.475) (-317.151) (-318.940) -- 0:00:27
102000 -- (-315.704) (-318.365) (-318.528) [-315.848] * (-317.630) [-318.761] (-320.988) (-316.146) -- 0:00:27
102500 -- [-315.283] (-323.195) (-317.255) (-317.201) * (-315.712) (-315.727) [-318.615] (-316.069) -- 0:00:27
103000 -- [-318.533] (-318.299) (-316.590) (-316.021) * (-315.540) (-318.588) (-320.120) [-315.359] -- 0:00:26
103500 -- [-317.566] (-316.907) (-321.012) (-317.509) * [-315.902] (-321.614) (-320.586) (-315.947) -- 0:00:26
104000 -- [-322.079] (-320.627) (-318.009) (-318.706) * (-317.964) (-319.091) (-315.258) [-318.065] -- 0:00:26
104500 -- (-318.581) [-317.219] (-324.966) (-320.953) * [-316.628] (-318.184) (-315.678) (-316.286) -- 0:00:26
105000 -- (-315.990) [-318.531] (-317.160) (-318.795) * (-316.367) [-317.272] (-315.981) (-317.819) -- 0:00:26
Average standard deviation of split frequencies: 0.017587
105500 -- [-319.770] (-316.939) (-315.701) (-318.133) * (-320.061) (-321.331) (-316.783) [-316.637] -- 0:00:26
106000 -- (-322.059) [-321.355] (-318.595) (-316.674) * (-317.381) (-316.770) (-315.783) [-315.667] -- 0:00:26
106500 -- (-318.907) [-315.439] (-318.312) (-317.039) * (-321.503) (-317.662) (-316.987) [-316.469] -- 0:00:25
107000 -- [-315.104] (-317.571) (-318.021) (-317.514) * (-317.266) (-315.544) [-315.961] (-319.742) -- 0:00:25
107500 -- (-315.467) (-322.120) (-319.599) [-315.525] * (-319.516) [-316.223] (-316.114) (-317.253) -- 0:00:25
108000 -- (-319.204) (-323.144) (-316.859) [-317.060] * (-318.175) [-319.838] (-316.344) (-317.427) -- 0:00:25
108500 -- (-316.895) (-319.197) (-315.275) [-320.824] * (-315.948) (-316.579) (-317.242) [-319.868] -- 0:00:25
109000 -- (-320.148) [-315.788] (-315.983) (-317.896) * (-318.248) [-319.762] (-315.823) (-320.472) -- 0:00:25
109500 -- (-322.629) [-316.183] (-316.649) (-316.190) * (-316.096) [-319.868] (-317.656) (-315.842) -- 0:00:24
110000 -- (-320.905) (-317.007) (-316.273) [-316.575] * (-318.265) (-315.993) (-320.761) [-318.961] -- 0:00:24
Average standard deviation of split frequencies: 0.018588
110500 -- (-319.710) (-319.688) [-317.878] (-316.441) * (-321.191) [-315.676] (-317.513) (-316.464) -- 0:00:24
111000 -- [-317.550] (-316.572) (-318.616) (-316.178) * [-317.917] (-315.977) (-317.988) (-318.767) -- 0:00:24
111500 -- [-316.880] (-317.550) (-315.346) (-315.870) * (-315.952) [-315.655] (-315.907) (-322.881) -- 0:00:24
112000 -- (-320.866) [-317.186] (-316.124) (-316.440) * (-316.989) (-315.529) [-316.258] (-317.898) -- 0:00:24
112500 -- (-317.472) [-318.313] (-318.118) (-319.311) * (-323.476) (-317.322) [-317.611] (-318.372) -- 0:00:24
113000 -- (-318.031) [-320.398] (-318.189) (-318.437) * (-316.268) (-319.759) (-316.353) [-315.882] -- 0:00:23
113500 -- [-315.918] (-315.869) (-317.144) (-317.776) * (-319.808) [-315.808] (-317.838) (-317.831) -- 0:00:27
114000 -- (-318.661) (-319.658) (-318.425) [-319.698] * [-318.695] (-316.851) (-318.387) (-320.280) -- 0:00:27
114500 -- (-317.093) (-317.814) [-317.718] (-317.164) * [-315.929] (-316.895) (-317.549) (-319.968) -- 0:00:26
115000 -- (-317.667) (-319.301) (-315.776) [-315.606] * (-315.910) (-315.526) [-316.630] (-318.566) -- 0:00:26
Average standard deviation of split frequencies: 0.019211
115500 -- (-316.511) (-318.728) (-315.976) [-315.259] * (-316.099) [-317.224] (-315.357) (-316.483) -- 0:00:26
116000 -- (-316.236) (-315.525) [-315.405] (-319.908) * (-317.239) [-319.465] (-320.153) (-316.324) -- 0:00:26
116500 -- (-317.429) (-318.615) [-315.323] (-324.070) * (-318.638) (-317.685) (-318.622) [-317.924] -- 0:00:26
117000 -- (-317.137) (-316.232) [-317.334] (-319.604) * [-316.123] (-318.409) (-316.065) (-319.473) -- 0:00:26
117500 -- (-315.879) (-322.324) [-314.744] (-315.868) * (-317.736) [-318.380] (-319.633) (-317.069) -- 0:00:26
118000 -- (-317.373) (-324.248) (-318.605) [-319.455] * (-318.613) (-315.174) [-317.923] (-317.850) -- 0:00:25
118500 -- (-315.461) (-324.552) (-319.873) [-317.403] * (-316.262) [-316.056] (-316.843) (-319.691) -- 0:00:25
119000 -- (-315.813) (-321.530) [-317.997] (-318.740) * (-316.202) (-316.436) [-316.393] (-320.329) -- 0:00:25
119500 -- [-316.729] (-319.707) (-317.857) (-316.419) * [-318.038] (-317.997) (-317.374) (-320.010) -- 0:00:25
120000 -- (-319.455) (-320.085) (-318.168) [-316.819] * (-317.177) [-318.125] (-318.178) (-315.479) -- 0:00:25
Average standard deviation of split frequencies: 0.020463
120500 -- (-316.222) [-316.870] (-318.846) (-315.780) * (-316.880) (-317.856) (-318.707) [-318.046] -- 0:00:25
121000 -- (-317.802) [-317.058] (-315.988) (-315.711) * [-316.293] (-318.597) (-319.966) (-315.086) -- 0:00:25
121500 -- (-317.714) (-317.090) (-317.294) [-316.395] * [-315.773] (-318.598) (-318.479) (-318.121) -- 0:00:24
122000 -- (-316.186) (-316.350) (-323.492) [-316.100] * (-322.228) (-320.695) [-315.675] (-319.645) -- 0:00:24
122500 -- [-318.094] (-316.713) (-322.599) (-316.674) * [-316.828] (-317.123) (-315.978) (-315.739) -- 0:00:24
123000 -- (-319.660) (-316.094) (-315.410) [-317.293] * (-315.951) (-316.591) [-318.553] (-316.989) -- 0:00:24
123500 -- [-319.217] (-321.072) (-315.057) (-316.493) * [-316.938] (-316.348) (-320.095) (-321.527) -- 0:00:24
124000 -- [-316.274] (-317.041) (-316.603) (-317.958) * (-317.307) (-316.642) (-316.073) [-316.028] -- 0:00:24
124500 -- (-319.697) (-318.090) [-316.623] (-314.995) * (-316.589) (-317.871) [-315.799] (-316.056) -- 0:00:24
125000 -- [-315.523] (-319.176) (-319.058) (-319.434) * (-318.354) (-316.991) (-316.631) [-317.880] -- 0:00:24
Average standard deviation of split frequencies: 0.020844
125500 -- (-315.178) (-319.780) [-316.336] (-316.214) * (-317.626) [-319.238] (-317.657) (-319.505) -- 0:00:23
126000 -- [-316.568] (-315.792) (-318.602) (-315.061) * (-316.181) [-319.679] (-315.494) (-318.365) -- 0:00:23
126500 -- (-318.957) (-315.685) (-318.119) [-316.399] * (-315.208) (-317.378) (-315.765) [-317.420] -- 0:00:23
127000 -- (-318.218) (-316.646) (-316.694) [-317.184] * (-316.740) (-320.554) [-317.570] (-315.374) -- 0:00:23
127500 -- [-316.341] (-317.445) (-316.566) (-317.154) * [-316.241] (-317.064) (-320.400) (-320.801) -- 0:00:23
128000 -- (-316.697) [-317.510] (-317.121) (-316.598) * (-316.542) (-315.952) (-316.211) [-317.498] -- 0:00:23
128500 -- [-318.274] (-317.968) (-320.766) (-318.295) * (-321.876) (-317.384) [-316.928] (-315.701) -- 0:00:26
129000 -- (-318.019) (-316.605) (-320.533) [-316.324] * (-315.611) (-318.331) [-314.970] (-321.235) -- 0:00:25
129500 -- [-319.780] (-319.459) (-317.749) (-316.194) * (-317.039) (-316.662) [-318.182] (-315.897) -- 0:00:25
130000 -- (-318.915) [-320.312] (-317.802) (-316.178) * [-318.377] (-322.772) (-319.985) (-318.399) -- 0:00:25
Average standard deviation of split frequencies: 0.022162
130500 -- (-316.264) [-317.630] (-319.337) (-315.144) * [-322.289] (-318.255) (-316.463) (-316.955) -- 0:00:25
131000 -- [-315.893] (-317.923) (-317.300) (-316.409) * (-319.897) (-317.722) [-317.571] (-317.094) -- 0:00:25
131500 -- [-315.476] (-317.264) (-316.953) (-317.504) * [-319.477] (-317.675) (-317.261) (-317.586) -- 0:00:25
132000 -- (-315.967) (-317.581) (-315.835) [-316.825] * (-320.561) (-315.925) [-316.440] (-319.484) -- 0:00:25
132500 -- (-318.040) (-315.585) [-315.631] (-316.296) * (-318.647) [-316.314] (-316.145) (-320.990) -- 0:00:24
133000 -- [-316.328] (-318.058) (-315.619) (-316.204) * [-318.717] (-320.145) (-315.515) (-319.335) -- 0:00:24
133500 -- (-316.947) (-318.834) (-316.973) [-316.481] * [-317.196] (-317.558) (-316.949) (-319.783) -- 0:00:24
134000 -- (-318.262) (-321.002) (-319.149) [-318.117] * [-317.152] (-316.333) (-317.080) (-317.417) -- 0:00:24
134500 -- (-316.019) (-317.592) [-320.337] (-321.021) * (-319.332) (-317.396) (-318.938) [-317.046] -- 0:00:24
135000 -- (-317.258) [-317.372] (-315.380) (-319.455) * (-323.055) [-324.639] (-320.101) (-319.381) -- 0:00:24
Average standard deviation of split frequencies: 0.022704
135500 -- [-316.595] (-320.433) (-316.950) (-316.736) * [-320.441] (-317.123) (-316.378) (-318.978) -- 0:00:24
136000 -- (-317.048) (-316.883) [-317.858] (-315.578) * (-317.043) [-317.876] (-317.770) (-316.186) -- 0:00:24
136500 -- (-321.386) (-316.315) (-320.040) [-316.702] * (-317.975) [-315.322] (-316.180) (-315.902) -- 0:00:23
137000 -- (-315.738) (-317.689) (-319.370) [-317.918] * (-317.973) (-315.303) [-318.149] (-316.146) -- 0:00:23
137500 -- (-316.565) (-318.951) (-320.118) [-317.834] * (-316.385) [-315.867] (-315.586) (-318.103) -- 0:00:23
138000 -- (-316.069) (-324.644) [-315.523] (-320.403) * (-315.968) (-319.623) [-315.351] (-318.092) -- 0:00:23
138500 -- (-317.371) (-321.715) (-315.615) [-317.617] * (-318.132) [-316.052] (-318.060) (-321.533) -- 0:00:23
139000 -- (-315.416) [-318.734] (-316.405) (-316.531) * [-317.102] (-319.893) (-321.222) (-320.215) -- 0:00:23
139500 -- [-319.376] (-317.524) (-315.640) (-316.102) * (-316.686) (-317.365) [-320.804] (-318.756) -- 0:00:23
140000 -- (-315.869) (-318.360) (-318.198) [-322.381] * (-319.934) [-315.173] (-321.920) (-316.115) -- 0:00:23
Average standard deviation of split frequencies: 0.022118
140500 -- (-318.704) [-317.163] (-320.926) (-320.178) * (-317.929) (-315.438) (-317.040) [-316.042] -- 0:00:23
141000 -- (-322.202) (-317.743) [-317.855] (-317.633) * (-317.793) (-323.295) [-315.961] (-317.975) -- 0:00:22
141500 -- (-315.761) (-318.701) [-318.200] (-316.464) * (-317.964) [-322.268] (-318.381) (-321.483) -- 0:00:22
142000 -- (-317.271) [-315.881] (-317.022) (-316.975) * (-321.755) [-315.880] (-317.684) (-317.273) -- 0:00:22
142500 -- (-319.411) (-317.257) [-316.376] (-319.932) * (-322.703) (-321.004) (-316.283) [-319.742] -- 0:00:25
143000 -- (-319.492) (-319.249) [-315.341] (-315.070) * (-316.644) (-316.534) (-316.421) [-315.440] -- 0:00:24
143500 -- (-315.564) (-316.520) [-316.544] (-315.898) * (-320.559) (-317.658) (-317.874) [-315.386] -- 0:00:24
144000 -- (-317.908) (-317.786) (-315.569) [-317.093] * (-321.762) (-317.623) [-318.100] (-318.941) -- 0:00:24
144500 -- (-319.114) (-315.260) (-315.544) [-315.546] * [-317.332] (-316.290) (-317.090) (-317.478) -- 0:00:24
145000 -- (-315.191) (-315.360) [-317.018] (-316.855) * [-317.382] (-317.770) (-321.072) (-317.634) -- 0:00:24
Average standard deviation of split frequencies: 0.022440
145500 -- (-319.822) (-316.066) (-317.810) [-315.463] * (-316.386) (-317.121) (-316.322) [-317.760] -- 0:00:24
146000 -- (-315.276) [-319.094] (-317.262) (-317.495) * (-317.222) (-316.341) [-316.281] (-317.739) -- 0:00:24
146500 -- (-317.384) (-316.930) (-316.637) [-316.011] * (-318.460) (-316.097) (-316.953) [-317.393] -- 0:00:24
147000 -- (-317.131) (-318.221) [-317.451] (-315.732) * (-321.961) [-319.630] (-318.432) (-318.297) -- 0:00:24
147500 -- [-321.806] (-316.067) (-316.776) (-318.388) * (-323.905) (-319.578) [-318.893] (-316.455) -- 0:00:23
148000 -- [-319.609] (-316.114) (-319.558) (-316.181) * (-318.885) (-316.949) [-316.848] (-319.698) -- 0:00:23
148500 -- (-321.347) (-318.384) (-318.329) [-316.268] * (-317.119) (-319.093) [-321.082] (-317.869) -- 0:00:23
149000 -- (-318.406) [-319.772] (-317.893) (-317.144) * (-315.428) [-315.764] (-315.101) (-322.173) -- 0:00:23
149500 -- (-326.476) (-317.496) [-318.497] (-322.218) * (-320.745) (-318.878) [-316.304] (-320.921) -- 0:00:23
150000 -- [-321.554] (-317.347) (-315.527) (-315.680) * (-316.208) (-317.378) (-316.744) [-315.100] -- 0:00:23
Average standard deviation of split frequencies: 0.021432
150500 -- (-316.707) [-316.355] (-315.828) (-316.364) * (-317.980) [-316.313] (-318.265) (-316.612) -- 0:00:23
151000 -- (-315.980) [-316.142] (-318.568) (-317.999) * (-316.657) (-319.800) [-319.106] (-317.272) -- 0:00:23
151500 -- [-316.590] (-316.636) (-318.641) (-315.619) * [-316.473] (-316.130) (-316.330) (-315.557) -- 0:00:23
152000 -- [-318.196] (-316.189) (-315.617) (-316.399) * (-316.507) (-315.886) [-315.740] (-318.024) -- 0:00:22
152500 -- (-319.428) (-317.991) [-315.988] (-316.995) * (-318.964) (-317.361) (-319.081) [-316.908] -- 0:00:22
153000 -- [-319.781] (-316.314) (-318.944) (-316.070) * (-319.315) (-319.622) (-321.241) [-315.632] -- 0:00:22
153500 -- (-322.463) (-318.825) [-319.689] (-316.982) * (-317.289) (-316.845) (-317.263) [-319.618] -- 0:00:22
154000 -- (-317.671) (-316.506) [-320.872] (-318.246) * [-317.858] (-316.646) (-316.695) (-318.639) -- 0:00:22
154500 -- (-320.895) (-315.155) [-317.456] (-318.137) * (-317.764) (-316.273) (-318.472) [-317.293] -- 0:00:22
155000 -- [-316.730] (-317.257) (-316.357) (-321.305) * (-317.465) (-317.317) [-321.052] (-317.456) -- 0:00:22
Average standard deviation of split frequencies: 0.022513
155500 -- (-317.621) (-315.201) [-316.343] (-319.817) * (-318.449) (-317.197) (-320.197) [-315.247] -- 0:00:22
156000 -- (-316.839) (-317.263) [-317.234] (-319.843) * [-318.913] (-316.368) (-319.135) (-317.708) -- 0:00:22
156500 -- [-316.175] (-317.818) (-316.001) (-316.416) * (-316.594) (-317.294) [-318.119] (-317.873) -- 0:00:21
157000 -- (-315.476) (-316.462) (-316.091) [-316.501] * (-316.990) [-316.663] (-316.331) (-318.221) -- 0:00:21
157500 -- [-318.973] (-315.091) (-319.064) (-316.175) * (-317.737) [-317.852] (-315.883) (-317.115) -- 0:00:21
158000 -- [-316.609] (-318.605) (-319.516) (-316.865) * [-315.792] (-317.667) (-316.547) (-316.060) -- 0:00:23
158500 -- [-315.968] (-315.955) (-318.277) (-316.414) * (-319.362) (-316.468) (-315.532) [-315.295] -- 0:00:23
159000 -- (-317.340) (-316.621) [-316.726] (-317.876) * (-316.564) (-315.187) (-316.491) [-317.685] -- 0:00:23
159500 -- (-316.682) (-316.803) (-317.991) [-319.522] * (-316.737) [-315.611] (-317.140) (-318.957) -- 0:00:23
160000 -- (-316.757) [-317.350] (-318.991) (-318.097) * (-316.785) [-322.332] (-322.146) (-316.675) -- 0:00:23
Average standard deviation of split frequencies: 0.024353
160500 -- (-316.240) (-316.983) [-318.771] (-317.892) * (-319.577) (-316.878) [-316.523] (-318.177) -- 0:00:23
161000 -- [-316.914] (-317.072) (-315.246) (-320.524) * (-320.166) [-316.309] (-317.852) (-317.039) -- 0:00:23
161500 -- (-317.425) (-318.764) [-318.088] (-318.803) * (-320.128) (-316.007) (-319.332) [-320.348] -- 0:00:23
162000 -- (-315.273) (-315.486) [-316.096] (-315.805) * (-318.896) (-316.578) (-320.726) [-315.627] -- 0:00:22
162500 -- (-316.116) [-316.357] (-317.593) (-316.639) * (-318.326) (-317.675) (-321.374) [-315.327] -- 0:00:22
163000 -- (-317.187) (-317.341) [-317.719] (-322.944) * (-319.762) (-316.025) (-320.157) [-322.460] -- 0:00:22
163500 -- (-319.182) (-321.463) [-323.203] (-317.359) * (-316.590) [-317.105] (-320.633) (-315.587) -- 0:00:22
164000 -- (-318.024) (-319.606) (-322.218) [-316.451] * (-315.598) [-315.338] (-320.450) (-317.718) -- 0:00:22
164500 -- (-319.357) (-319.090) (-318.229) [-315.476] * [-319.359] (-315.875) (-318.633) (-315.575) -- 0:00:22
165000 -- [-316.500] (-316.670) (-317.579) (-315.859) * [-314.951] (-315.426) (-315.768) (-317.378) -- 0:00:22
Average standard deviation of split frequencies: 0.024848
165500 -- (-316.757) (-315.624) [-316.755] (-315.567) * (-316.937) [-316.614] (-316.901) (-316.759) -- 0:00:22
166000 -- (-315.438) (-318.320) (-321.001) [-317.132] * (-316.318) (-318.789) [-315.041] (-319.108) -- 0:00:22
166500 -- (-315.241) [-316.495] (-317.394) (-316.396) * [-316.802] (-317.598) (-316.893) (-315.534) -- 0:00:22
167000 -- (-317.827) [-314.950] (-316.964) (-318.301) * (-319.030) (-318.509) (-317.858) [-316.543] -- 0:00:21
167500 -- (-315.625) (-315.976) [-316.940] (-316.917) * [-318.349] (-317.297) (-319.799) (-317.353) -- 0:00:21
168000 -- (-316.240) (-317.546) (-318.005) [-316.425] * (-319.814) (-317.987) [-315.798] (-315.286) -- 0:00:21
168500 -- (-318.323) (-317.267) (-318.165) [-318.779] * [-320.041] (-315.829) (-317.032) (-318.636) -- 0:00:21
169000 -- (-317.496) [-316.883] (-316.292) (-316.918) * (-317.661) [-315.381] (-317.033) (-319.099) -- 0:00:21
169500 -- [-316.377] (-317.982) (-316.117) (-318.574) * (-320.036) (-317.185) (-316.936) [-319.764] -- 0:00:21
170000 -- [-317.485] (-315.917) (-317.664) (-317.285) * (-315.337) (-316.431) [-316.115] (-317.909) -- 0:00:21
Average standard deviation of split frequencies: 0.024583
170500 -- (-316.747) [-322.172] (-317.379) (-315.099) * (-315.692) (-317.290) (-317.202) [-316.746] -- 0:00:21
171000 -- [-317.635] (-316.468) (-319.040) (-316.581) * [-315.300] (-315.909) (-317.423) (-316.365) -- 0:00:21
171500 -- (-316.706) (-316.040) [-315.321] (-319.419) * (-316.111) (-318.389) [-317.550] (-317.285) -- 0:00:21
172000 -- [-317.393] (-315.766) (-317.093) (-321.221) * [-317.631] (-318.592) (-318.983) (-315.628) -- 0:00:20
172500 -- (-317.567) [-319.024] (-316.373) (-316.564) * (-323.915) (-320.252) (-317.584) [-316.289] -- 0:00:22
173000 -- (-317.948) [-319.603] (-315.450) (-315.829) * (-318.797) (-322.545) [-316.658] (-315.532) -- 0:00:22
173500 -- (-318.707) (-318.351) [-316.755] (-316.252) * [-318.354] (-322.458) (-317.675) (-316.971) -- 0:00:22
174000 -- (-318.092) (-315.809) [-316.912] (-317.828) * (-316.853) (-321.878) [-317.334] (-317.354) -- 0:00:22
174500 -- (-315.256) [-317.009] (-316.376) (-319.254) * [-318.913] (-317.205) (-320.097) (-320.552) -- 0:00:22
175000 -- (-316.055) (-316.953) (-316.975) [-315.467] * (-316.061) [-315.519] (-319.016) (-319.759) -- 0:00:22
Average standard deviation of split frequencies: 0.025177
175500 -- (-318.579) (-316.529) [-317.029] (-316.290) * (-316.510) [-315.777] (-315.449) (-316.753) -- 0:00:22
176000 -- (-320.576) [-318.128] (-316.195) (-317.006) * (-316.434) (-315.709) [-315.788] (-316.345) -- 0:00:22
176500 -- (-318.332) (-316.485) (-316.770) [-316.165] * [-317.073] (-319.978) (-317.043) (-317.086) -- 0:00:21
177000 -- (-316.846) (-316.879) [-315.871] (-316.356) * (-316.891) (-319.557) (-325.485) [-315.387] -- 0:00:21
177500 -- (-318.189) (-318.637) (-319.853) [-315.191] * [-317.206] (-315.898) (-322.493) (-316.132) -- 0:00:21
178000 -- (-316.389) (-317.656) (-318.541) [-316.029] * (-317.248) [-316.140] (-316.055) (-316.291) -- 0:00:21
178500 -- (-316.573) (-321.085) (-317.255) [-316.152] * [-319.266] (-315.890) (-315.475) (-315.643) -- 0:00:21
179000 -- (-315.595) (-318.732) (-316.010) [-316.845] * (-318.800) (-317.057) (-317.684) [-315.313] -- 0:00:21
179500 -- (-316.062) (-315.988) [-319.471] (-317.983) * (-318.305) [-316.131] (-317.204) (-315.361) -- 0:00:21
180000 -- (-323.284) (-316.742) [-317.725] (-315.827) * (-317.432) [-316.469] (-318.229) (-316.430) -- 0:00:21
Average standard deviation of split frequencies: 0.024105
180500 -- (-314.953) (-316.242) [-315.504] (-318.800) * (-319.703) (-316.371) (-315.164) [-316.788] -- 0:00:21
181000 -- (-318.336) (-317.642) [-316.138] (-321.235) * (-320.584) (-318.453) [-315.559] (-319.179) -- 0:00:21
181500 -- [-317.005] (-315.354) (-319.039) (-317.178) * (-317.534) (-317.047) [-317.504] (-316.870) -- 0:00:21
182000 -- (-317.996) [-321.489] (-316.744) (-315.693) * (-325.701) [-315.047] (-316.888) (-316.975) -- 0:00:20
182500 -- (-316.217) [-317.523] (-316.470) (-316.202) * (-315.209) [-315.825] (-316.207) (-316.138) -- 0:00:20
183000 -- (-316.992) (-316.788) [-317.212] (-319.491) * [-316.867] (-317.581) (-319.151) (-318.459) -- 0:00:20
183500 -- (-318.378) [-317.624] (-316.106) (-320.839) * (-316.323) [-318.021] (-316.671) (-318.556) -- 0:00:20
184000 -- (-316.636) (-317.946) (-316.664) [-316.520] * (-320.460) [-316.213] (-317.277) (-315.546) -- 0:00:20
184500 -- (-320.555) [-316.874] (-316.905) (-318.917) * (-318.599) [-316.857] (-316.191) (-316.174) -- 0:00:20
185000 -- (-318.248) (-316.452) [-315.497] (-317.614) * (-316.398) (-317.334) (-319.766) [-315.255] -- 0:00:20
Average standard deviation of split frequencies: 0.021312
185500 -- (-316.486) (-317.259) [-315.678] (-317.416) * (-316.901) (-319.739) (-316.600) [-315.416] -- 0:00:20
186000 -- [-317.413] (-318.623) (-319.625) (-317.341) * (-317.907) (-319.547) (-317.995) [-318.202] -- 0:00:20
186500 -- (-316.909) (-317.370) [-318.307] (-316.672) * (-317.878) (-317.174) (-316.153) [-315.457] -- 0:00:20
187000 -- (-316.570) (-315.801) (-317.610) [-316.466] * (-318.367) (-317.445) [-316.826] (-316.593) -- 0:00:21
187500 -- (-316.352) (-315.751) (-321.501) [-318.438] * (-317.732) (-316.684) [-316.848] (-318.052) -- 0:00:21
188000 -- (-316.228) (-316.478) [-316.914] (-315.919) * (-317.351) (-315.832) [-315.583] (-317.497) -- 0:00:21
188500 -- (-316.447) (-316.045) (-319.416) [-316.368] * (-315.564) (-320.079) [-318.290] (-320.396) -- 0:00:21
189000 -- (-316.785) (-319.068) (-316.343) [-320.241] * [-316.199] (-319.047) (-320.256) (-316.277) -- 0:00:21
189500 -- (-318.090) [-318.068] (-316.543) (-315.579) * (-315.691) (-318.103) (-318.074) [-317.207] -- 0:00:21
190000 -- [-320.722] (-317.108) (-320.915) (-318.948) * (-316.110) (-315.225) [-317.766] (-318.401) -- 0:00:21
Average standard deviation of split frequencies: 0.019897
190500 -- (-321.751) (-317.501) (-315.737) [-317.304] * [-315.877] (-317.926) (-317.011) (-315.722) -- 0:00:21
191000 -- (-315.508) (-318.865) (-316.312) [-316.251] * (-316.308) [-316.077] (-316.430) (-317.545) -- 0:00:21
191500 -- (-316.089) (-316.905) [-320.412] (-316.375) * [-319.457] (-316.283) (-319.051) (-320.348) -- 0:00:20
192000 -- (-318.941) (-317.318) (-317.269) [-317.554] * (-315.842) (-316.093) (-318.540) [-316.312] -- 0:00:20
192500 -- (-318.111) [-318.065] (-319.424) (-315.791) * [-316.077] (-316.845) (-319.100) (-317.078) -- 0:00:20
193000 -- (-316.361) [-315.495] (-318.985) (-315.339) * (-317.772) (-316.359) [-316.609] (-319.092) -- 0:00:20
193500 -- (-319.322) (-317.194) (-316.080) [-317.174] * (-317.355) (-325.946) [-314.929] (-319.449) -- 0:00:20
194000 -- [-318.638] (-316.421) (-322.399) (-317.740) * (-317.535) [-319.883] (-316.079) (-316.405) -- 0:00:20
194500 -- (-319.038) (-315.998) (-321.194) [-317.606] * (-317.509) (-320.123) (-315.947) [-316.754] -- 0:00:20
195000 -- [-316.219] (-315.533) (-317.059) (-316.535) * (-317.660) (-329.102) [-314.877] (-316.619) -- 0:00:20
Average standard deviation of split frequencies: 0.019361
195500 -- (-317.592) (-315.270) [-315.161] (-317.709) * (-315.561) (-320.100) (-317.794) [-315.720] -- 0:00:20
196000 -- (-315.187) [-317.661] (-315.862) (-323.313) * (-315.401) (-317.019) [-317.488] (-318.262) -- 0:00:20
196500 -- (-315.616) (-319.499) [-316.973] (-320.488) * (-323.257) [-316.639] (-317.600) (-323.909) -- 0:00:20
197000 -- (-317.805) [-317.154] (-318.349) (-315.851) * (-318.814) [-317.041] (-322.023) (-325.811) -- 0:00:19
197500 -- (-318.442) (-318.183) (-323.080) [-315.270] * (-318.830) (-319.857) (-319.586) [-317.685] -- 0:00:19
198000 -- (-319.291) (-317.386) [-316.119] (-317.914) * (-317.018) [-315.321] (-318.152) (-315.753) -- 0:00:19
198500 -- (-315.206) (-319.378) [-315.926] (-319.962) * [-316.965] (-316.295) (-318.222) (-318.344) -- 0:00:19
199000 -- (-317.050) (-316.665) [-318.711] (-317.877) * [-315.732] (-318.721) (-316.085) (-322.119) -- 0:00:19
199500 -- (-315.553) (-319.596) [-315.876] (-319.016) * [-317.857] (-315.378) (-316.074) (-316.895) -- 0:00:19
200000 -- (-318.472) (-318.636) [-315.654] (-316.930) * (-317.246) (-321.322) [-318.197] (-318.854) -- 0:00:19
Average standard deviation of split frequencies: 0.019164
200500 -- (-315.416) [-319.769] (-317.965) (-315.358) * (-315.283) (-315.966) (-319.284) [-315.753] -- 0:00:19
201000 -- [-315.413] (-320.478) (-316.551) (-318.011) * (-319.124) (-315.945) [-316.051] (-315.708) -- 0:00:19
201500 -- (-317.489) (-316.236) (-317.919) [-318.263] * (-318.690) (-316.253) [-318.668] (-319.048) -- 0:00:20
202000 -- (-316.623) (-315.511) [-316.871] (-316.923) * (-317.338) (-315.913) (-316.767) [-319.567] -- 0:00:20
202500 -- (-319.508) (-315.853) [-315.681] (-316.107) * [-315.211] (-315.757) (-316.517) (-319.513) -- 0:00:20
203000 -- (-318.443) [-318.796] (-315.929) (-317.845) * [-317.032] (-317.260) (-323.220) (-315.106) -- 0:00:20
203500 -- [-317.867] (-317.871) (-317.120) (-316.940) * (-316.369) [-316.889] (-320.946) (-318.972) -- 0:00:20
204000 -- [-316.667] (-320.234) (-314.958) (-319.816) * (-317.776) (-317.248) (-316.458) [-316.494] -- 0:00:20
204500 -- (-316.340) [-319.049] (-321.085) (-318.079) * (-317.965) [-315.721] (-315.953) (-317.222) -- 0:00:20
205000 -- (-316.788) [-319.274] (-315.931) (-315.568) * (-323.159) [-317.572] (-316.881) (-317.364) -- 0:00:20
Average standard deviation of split frequencies: 0.021140
205500 -- (-316.945) (-317.481) (-317.359) [-316.026] * (-317.689) (-317.097) [-319.085] (-317.448) -- 0:00:20
206000 -- (-319.987) [-316.159] (-316.786) (-316.692) * (-315.524) [-315.478] (-322.418) (-318.394) -- 0:00:19
206500 -- (-317.632) (-316.315) [-315.313] (-318.679) * [-315.554] (-319.543) (-321.085) (-316.852) -- 0:00:19
207000 -- (-317.145) [-317.114] (-318.739) (-316.539) * (-317.382) (-318.559) (-317.112) [-316.019] -- 0:00:19
207500 -- (-316.734) (-315.940) [-317.868] (-316.741) * (-316.511) [-317.984] (-322.193) (-315.351) -- 0:00:19
208000 -- (-317.611) (-319.851) [-315.275] (-317.848) * (-317.367) (-317.764) (-321.391) [-316.957] -- 0:00:19
208500 -- [-315.708] (-318.621) (-316.500) (-316.339) * [-318.180] (-320.778) (-321.700) (-317.582) -- 0:00:19
209000 -- (-321.120) (-319.720) [-315.054] (-322.844) * [-318.826] (-316.879) (-323.798) (-315.351) -- 0:00:19
209500 -- [-316.250] (-320.321) (-316.565) (-319.957) * [-317.491] (-314.874) (-317.496) (-315.690) -- 0:00:19
210000 -- (-319.154) (-319.178) (-317.096) [-315.230] * (-317.020) (-315.512) [-319.392] (-316.352) -- 0:00:19
Average standard deviation of split frequencies: 0.020672
210500 -- (-318.717) (-315.624) (-317.254) [-315.521] * [-317.516] (-315.342) (-319.737) (-317.460) -- 0:00:19
211000 -- (-320.668) [-316.942] (-317.222) (-315.510) * (-314.961) (-315.971) (-316.442) [-316.361] -- 0:00:19
211500 -- (-315.565) (-317.164) [-316.340] (-320.425) * [-316.224] (-316.735) (-320.824) (-317.039) -- 0:00:19
212000 -- (-319.489) (-316.718) (-315.751) [-319.709] * (-316.330) [-316.686] (-318.729) (-322.113) -- 0:00:19
212500 -- (-320.996) (-318.698) (-316.693) [-318.964] * [-317.188] (-315.750) (-316.709) (-317.438) -- 0:00:18
213000 -- (-318.150) [-319.658] (-319.223) (-316.497) * [-316.883] (-317.016) (-321.761) (-319.854) -- 0:00:18
213500 -- (-320.324) [-318.118] (-317.913) (-318.030) * (-318.151) [-318.298] (-318.103) (-317.653) -- 0:00:18
214000 -- [-318.985] (-315.768) (-317.161) (-317.651) * [-317.765] (-321.851) (-317.047) (-317.844) -- 0:00:18
214500 -- (-316.312) [-316.204] (-316.126) (-317.025) * (-319.755) [-317.243] (-318.035) (-318.236) -- 0:00:18
215000 -- (-318.428) (-316.447) (-317.206) [-316.931] * [-319.700] (-318.531) (-316.828) (-320.881) -- 0:00:18
Average standard deviation of split frequencies: 0.019642
215500 -- (-317.174) [-317.591] (-319.780) (-317.764) * (-319.243) [-318.344] (-319.271) (-318.734) -- 0:00:18
216000 -- (-317.225) (-317.825) (-317.895) [-320.653] * (-319.676) (-317.728) [-317.205] (-316.006) -- 0:00:18
216500 -- (-316.943) [-319.918] (-319.479) (-316.158) * (-317.596) (-316.588) (-320.655) [-316.560] -- 0:00:19
217000 -- (-316.118) (-320.964) (-316.887) [-316.040] * (-319.014) (-316.417) (-317.722) [-315.497] -- 0:00:19
217500 -- (-315.998) (-318.798) [-316.319] (-317.604) * (-315.452) (-322.004) (-316.877) [-317.778] -- 0:00:19
218000 -- [-315.929] (-317.730) (-315.705) (-315.737) * [-317.834] (-320.836) (-319.968) (-317.350) -- 0:00:19
218500 -- (-314.914) [-317.264] (-318.122) (-316.594) * [-318.601] (-321.153) (-315.384) (-316.282) -- 0:00:19
219000 -- (-315.908) [-317.085] (-320.043) (-318.420) * (-319.382) [-318.642] (-318.856) (-316.751) -- 0:00:19
219500 -- (-316.852) (-318.229) [-315.347] (-316.618) * (-316.567) [-317.086] (-317.225) (-317.174) -- 0:00:19
220000 -- (-318.626) (-318.287) (-319.371) [-318.194] * (-318.190) (-316.761) (-315.756) [-318.791] -- 0:00:19
Average standard deviation of split frequencies: 0.018277
220500 -- (-317.707) (-318.088) (-318.262) [-315.709] * (-322.904) [-316.805] (-317.357) (-315.858) -- 0:00:19
221000 -- (-316.838) (-317.022) [-317.274] (-317.562) * (-318.700) (-316.856) [-318.127] (-315.524) -- 0:00:18
221500 -- (-317.134) [-316.059] (-319.332) (-320.355) * (-317.314) [-315.469] (-318.501) (-316.808) -- 0:00:18
222000 -- (-323.745) [-316.060] (-319.932) (-317.480) * (-318.110) (-316.362) (-320.460) [-317.552] -- 0:00:18
222500 -- (-320.188) (-317.841) [-320.084] (-318.780) * (-321.475) (-316.787) (-318.584) [-318.843] -- 0:00:18
223000 -- (-317.593) (-317.831) [-317.499] (-315.885) * (-320.145) (-318.300) (-315.261) [-316.963] -- 0:00:18
223500 -- (-318.612) (-315.742) [-315.073] (-315.513) * [-315.999] (-316.740) (-315.814) (-316.540) -- 0:00:18
224000 -- (-316.072) [-319.992] (-318.810) (-315.793) * (-315.956) [-318.803] (-318.808) (-319.164) -- 0:00:18
224500 -- (-318.837) [-317.784] (-316.650) (-316.369) * (-316.620) (-318.319) (-319.882) [-317.937] -- 0:00:18
225000 -- (-316.619) (-319.959) [-316.866] (-316.462) * (-316.267) [-315.910] (-316.150) (-317.332) -- 0:00:18
Average standard deviation of split frequencies: 0.018334
225500 -- (-317.733) [-317.612] (-319.991) (-315.739) * (-317.869) (-319.239) [-317.575] (-320.857) -- 0:00:18
226000 -- (-317.730) (-318.244) (-317.594) [-316.939] * [-316.660] (-317.272) (-318.149) (-315.483) -- 0:00:18
226500 -- (-317.058) (-317.620) (-317.659) [-316.232] * (-317.925) [-316.772] (-315.217) (-318.551) -- 0:00:18
227000 -- (-318.234) (-316.659) [-315.924] (-315.938) * [-318.244] (-316.646) (-317.620) (-320.575) -- 0:00:18
227500 -- (-318.383) (-319.019) [-317.866] (-317.076) * (-315.737) [-317.621] (-320.116) (-318.477) -- 0:00:17
228000 -- [-316.133] (-317.988) (-316.047) (-315.782) * [-315.662] (-315.509) (-321.985) (-316.047) -- 0:00:17
228500 -- (-316.191) (-318.611) [-316.084] (-318.830) * (-315.746) (-317.130) (-326.342) [-321.441] -- 0:00:17
229000 -- [-315.789] (-315.766) (-319.594) (-316.046) * (-316.800) (-317.170) (-321.156) [-323.474] -- 0:00:17
229500 -- (-318.087) [-315.317] (-315.617) (-315.876) * (-319.054) [-317.425] (-320.565) (-318.779) -- 0:00:17
230000 -- (-317.534) (-319.098) (-314.973) [-316.570] * [-317.180] (-318.003) (-317.343) (-319.309) -- 0:00:17
Average standard deviation of split frequencies: 0.018285
230500 -- [-318.078] (-320.598) (-315.655) (-320.294) * (-317.957) (-315.857) [-324.448] (-316.121) -- 0:00:17
231000 -- (-316.092) (-319.172) [-319.588] (-325.146) * [-317.303] (-317.520) (-326.140) (-317.009) -- 0:00:18
231500 -- (-319.383) [-315.769] (-316.038) (-317.294) * (-317.913) (-316.975) (-323.262) [-316.095] -- 0:00:18
232000 -- [-320.681] (-317.448) (-318.247) (-315.189) * (-317.231) (-318.703) [-321.237] (-319.832) -- 0:00:18
232500 -- [-315.818] (-316.035) (-317.615) (-316.261) * (-315.266) [-316.429] (-316.056) (-323.724) -- 0:00:18
233000 -- (-318.296) [-315.949] (-315.316) (-318.731) * [-316.128] (-315.455) (-321.351) (-316.738) -- 0:00:18
233500 -- (-316.162) (-321.135) [-315.309] (-319.352) * (-319.033) (-315.811) (-318.962) [-317.482] -- 0:00:18
234000 -- [-315.632] (-317.250) (-321.560) (-317.371) * (-317.939) (-318.801) (-321.262) [-317.834] -- 0:00:18
234500 -- [-315.274] (-315.945) (-317.728) (-318.376) * (-318.511) [-318.173] (-318.386) (-316.813) -- 0:00:18
235000 -- (-316.311) (-317.402) (-316.834) [-316.176] * (-317.535) (-317.104) (-316.561) [-315.645] -- 0:00:18
Average standard deviation of split frequencies: 0.017872
235500 -- (-316.382) (-318.840) [-317.705] (-315.438) * (-317.108) [-315.486] (-317.249) (-315.092) -- 0:00:17
236000 -- [-318.900] (-319.766) (-317.372) (-315.940) * (-317.360) (-317.953) [-317.646] (-321.094) -- 0:00:17
236500 -- (-316.303) [-319.611] (-319.248) (-319.496) * [-316.809] (-316.526) (-321.718) (-317.392) -- 0:00:17
237000 -- (-316.996) (-316.947) [-315.363] (-318.687) * [-317.519] (-316.795) (-317.749) (-319.565) -- 0:00:17
237500 -- (-318.097) [-316.035] (-317.026) (-317.104) * (-320.015) [-317.454] (-324.034) (-316.299) -- 0:00:17
238000 -- (-318.929) (-315.273) [-317.186] (-318.322) * (-319.261) (-316.628) (-317.013) [-315.294] -- 0:00:17
238500 -- (-320.144) (-319.162) (-319.331) [-319.673] * (-315.686) [-315.760] (-316.306) (-317.507) -- 0:00:17
239000 -- (-315.661) [-315.605] (-316.811) (-325.133) * (-318.391) (-318.604) (-316.593) [-316.416] -- 0:00:17
239500 -- (-316.469) (-316.317) [-315.923] (-319.689) * (-315.990) (-318.100) (-316.305) [-318.222] -- 0:00:17
240000 -- (-317.422) (-317.433) (-316.956) [-320.449] * [-317.770] (-318.173) (-318.241) (-315.366) -- 0:00:17
Average standard deviation of split frequencies: 0.018173
240500 -- (-319.243) (-319.192) (-320.387) [-320.282] * [-316.695] (-318.258) (-317.190) (-316.901) -- 0:00:17
241000 -- [-317.065] (-315.470) (-317.566) (-317.265) * [-317.175] (-317.376) (-319.598) (-317.718) -- 0:00:17
241500 -- (-316.305) (-317.985) [-316.624] (-318.358) * (-318.294) (-316.670) (-316.737) [-317.205] -- 0:00:17
242000 -- (-316.761) (-315.547) (-317.062) [-318.110] * (-318.387) [-317.105] (-315.725) (-317.051) -- 0:00:17
242500 -- (-317.683) [-315.581] (-318.573) (-317.330) * (-315.324) (-315.964) [-316.015] (-321.479) -- 0:00:16
243000 -- [-320.083] (-315.577) (-317.253) (-315.630) * [-315.425] (-318.078) (-319.084) (-317.361) -- 0:00:16
243500 -- (-315.402) [-317.698] (-316.995) (-317.769) * [-315.739] (-318.393) (-317.739) (-322.401) -- 0:00:16
244000 -- (-316.659) [-317.483] (-317.274) (-315.204) * [-316.043] (-318.244) (-317.989) (-324.820) -- 0:00:16
244500 -- [-318.043] (-315.768) (-316.398) (-315.662) * (-319.743) [-317.458] (-320.329) (-317.674) -- 0:00:16
245000 -- (-319.480) [-318.996] (-319.593) (-320.202) * (-315.777) [-316.728] (-315.177) (-316.125) -- 0:00:16
Average standard deviation of split frequencies: 0.017885
245500 -- (-316.278) (-316.033) [-316.024] (-317.889) * (-316.247) [-318.265] (-317.256) (-315.491) -- 0:00:16
246000 -- (-316.304) [-317.174] (-316.616) (-317.029) * (-319.122) [-317.782] (-317.872) (-319.555) -- 0:00:16
246500 -- [-318.797] (-316.158) (-315.349) (-319.402) * (-316.648) (-317.404) (-318.611) [-316.456] -- 0:00:16
247000 -- [-315.554] (-315.451) (-316.729) (-316.051) * (-321.655) [-319.827] (-315.980) (-316.559) -- 0:00:17
247500 -- (-315.328) [-317.379] (-319.402) (-315.910) * [-316.170] (-324.163) (-316.366) (-319.727) -- 0:00:17
248000 -- (-315.915) [-316.562] (-318.359) (-318.709) * (-319.990) (-316.773) [-317.346] (-315.525) -- 0:00:17
248500 -- (-316.959) [-316.835] (-318.028) (-317.896) * [-319.278] (-316.277) (-316.996) (-318.624) -- 0:00:17
249000 -- [-315.611] (-316.737) (-325.035) (-321.975) * [-315.835] (-317.639) (-318.217) (-319.096) -- 0:00:17
249500 -- (-317.765) (-318.666) (-322.981) [-317.565] * [-315.822] (-318.162) (-324.343) (-318.486) -- 0:00:17
250000 -- (-315.314) (-319.969) [-316.624] (-317.050) * (-321.147) (-318.283) (-319.456) [-316.275] -- 0:00:17
Average standard deviation of split frequencies: 0.017239
250500 -- [-315.485] (-317.374) (-318.015) (-316.217) * (-319.691) (-316.159) [-317.535] (-319.902) -- 0:00:16
251000 -- (-318.619) (-317.374) (-321.866) [-316.811] * (-319.303) (-319.489) (-316.907) [-318.801] -- 0:00:16
251500 -- (-317.867) (-317.493) [-317.790] (-315.491) * (-316.020) (-315.389) (-318.294) [-317.538] -- 0:00:16
252000 -- (-319.555) (-319.173) [-316.204] (-318.129) * (-316.696) (-317.693) (-321.360) [-316.895] -- 0:00:16
252500 -- (-317.678) [-316.779] (-316.868) (-318.641) * (-317.732) (-318.924) (-317.837) [-315.945] -- 0:00:16
253000 -- (-319.288) (-316.474) [-318.500] (-316.914) * (-320.233) (-317.903) [-318.140] (-316.306) -- 0:00:16
253500 -- (-318.634) (-315.319) [-318.432] (-316.283) * (-316.073) (-318.057) [-316.046] (-319.958) -- 0:00:16
254000 -- (-317.579) (-316.277) (-316.024) [-317.277] * (-320.044) [-315.033] (-321.769) (-316.075) -- 0:00:16
254500 -- (-318.410) (-316.534) [-317.014] (-315.545) * (-318.491) (-317.979) [-320.032] (-318.854) -- 0:00:16
255000 -- (-315.862) (-315.344) (-317.638) [-317.377] * (-315.854) (-316.287) [-316.277] (-318.812) -- 0:00:16
Average standard deviation of split frequencies: 0.017698
255500 -- (-319.984) [-316.510] (-315.602) (-318.418) * (-317.785) (-316.495) (-318.334) [-318.590] -- 0:00:16
256000 -- (-316.009) [-315.984] (-317.250) (-320.770) * (-319.145) (-322.790) [-316.605] (-323.384) -- 0:00:16
256500 -- (-317.376) (-316.933) [-315.852] (-321.499) * [-316.474] (-316.793) (-316.900) (-324.437) -- 0:00:16
257000 -- (-318.343) [-316.538] (-316.159) (-322.632) * (-316.911) (-319.322) (-317.584) [-316.978] -- 0:00:16
257500 -- (-316.347) (-320.151) [-319.210] (-317.956) * [-317.355] (-318.088) (-316.031) (-321.470) -- 0:00:16
258000 -- (-316.643) [-317.320] (-315.628) (-319.995) * (-319.229) (-318.934) [-316.419] (-317.528) -- 0:00:15
258500 -- [-318.024] (-315.602) (-316.324) (-317.985) * [-316.781] (-316.206) (-321.164) (-315.975) -- 0:00:15
259000 -- [-317.032] (-315.667) (-316.199) (-315.625) * (-316.632) (-315.959) (-318.017) [-315.682] -- 0:00:15
259500 -- (-318.331) (-318.355) (-318.233) [-316.757] * (-318.773) (-323.360) [-315.944] (-315.190) -- 0:00:15
260000 -- (-318.167) (-317.846) (-316.292) [-318.342] * (-318.055) (-321.481) [-318.978] (-317.657) -- 0:00:15
Average standard deviation of split frequencies: 0.016979
260500 -- [-315.527] (-317.397) (-318.475) (-318.237) * (-315.551) (-320.158) (-316.343) [-318.200] -- 0:00:15
261000 -- [-316.098] (-320.650) (-317.343) (-316.414) * (-315.386) [-316.470] (-317.887) (-321.222) -- 0:00:15
261500 -- (-317.512) (-318.125) (-317.775) [-316.863] * (-317.853) (-315.749) (-317.047) [-316.603] -- 0:00:15
262000 -- (-318.642) (-317.054) (-316.843) [-315.254] * (-320.973) [-316.979] (-318.573) (-316.178) -- 0:00:15
262500 -- [-321.287] (-316.074) (-316.855) (-316.078) * (-318.742) (-319.427) (-316.149) [-320.864] -- 0:00:15
263000 -- [-316.323] (-317.487) (-318.175) (-318.830) * (-315.983) [-316.156] (-317.480) (-319.032) -- 0:00:16
263500 -- (-317.419) (-316.638) [-316.580] (-316.452) * (-316.812) (-319.796) (-318.365) [-316.934] -- 0:00:16
264000 -- (-316.502) [-315.049] (-315.460) (-316.498) * (-318.982) (-317.539) [-316.007] (-318.442) -- 0:00:16
264500 -- (-319.142) (-318.866) [-316.349] (-316.869) * (-317.110) (-317.642) [-315.347] (-318.067) -- 0:00:16
265000 -- (-318.263) (-317.526) (-317.604) [-321.949] * (-316.202) (-319.613) (-314.992) [-320.581] -- 0:00:15
Average standard deviation of split frequencies: 0.016836
265500 -- (-317.905) [-315.864] (-319.207) (-320.552) * (-317.185) [-317.292] (-318.857) (-318.308) -- 0:00:15
266000 -- [-316.429] (-319.192) (-322.447) (-317.556) * [-315.633] (-317.663) (-318.692) (-318.189) -- 0:00:15
266500 -- (-319.810) (-317.927) (-315.807) [-316.352] * [-316.121] (-318.978) (-316.315) (-316.421) -- 0:00:15
267000 -- (-321.328) (-318.092) (-315.480) [-318.027] * (-318.364) (-315.816) (-317.235) [-316.627] -- 0:00:15
267500 -- (-316.005) (-318.011) (-316.376) [-318.750] * [-316.203] (-315.455) (-316.007) (-318.013) -- 0:00:15
268000 -- [-315.397] (-316.486) (-317.493) (-316.133) * [-318.917] (-321.257) (-315.517) (-317.717) -- 0:00:15
268500 -- (-315.798) [-316.252] (-319.199) (-317.178) * [-315.135] (-317.101) (-321.372) (-317.407) -- 0:00:15
269000 -- (-317.507) (-316.175) [-319.009] (-314.897) * (-316.403) (-317.252) [-317.491] (-315.745) -- 0:00:15
269500 -- (-316.946) (-321.777) (-318.862) [-315.649] * (-315.462) [-316.736] (-317.855) (-315.746) -- 0:00:15
270000 -- [-316.273] (-317.051) (-316.920) (-318.564) * (-316.750) (-318.169) (-316.033) [-316.758] -- 0:00:15
Average standard deviation of split frequencies: 0.016392
270500 -- (-315.653) (-315.543) [-318.963] (-317.783) * (-317.665) (-316.650) [-317.542] (-316.430) -- 0:00:15
271000 -- (-318.032) (-317.422) [-317.912] (-322.311) * (-317.786) (-317.102) (-317.691) [-316.077] -- 0:00:15
271500 -- (-319.913) [-315.824] (-316.506) (-315.888) * (-318.243) (-315.887) [-319.357] (-320.377) -- 0:00:15
272000 -- (-320.079) (-320.999) (-317.373) [-316.086] * (-318.675) (-315.927) (-320.743) [-316.493] -- 0:00:15
272500 -- (-321.862) (-318.580) [-319.379] (-321.047) * [-315.199] (-317.856) (-317.873) (-317.881) -- 0:00:15
273000 -- (-318.006) [-315.156] (-315.804) (-317.137) * (-317.549) (-317.319) [-318.098] (-317.618) -- 0:00:14
273500 -- (-318.070) [-317.685] (-319.945) (-315.863) * (-316.487) (-318.709) [-317.401] (-316.893) -- 0:00:14
274000 -- (-318.399) (-315.970) (-317.533) [-316.913] * (-316.253) (-318.809) [-318.279] (-316.514) -- 0:00:14
274500 -- [-317.280] (-317.050) (-318.865) (-317.130) * (-317.088) (-327.787) [-316.496] (-317.701) -- 0:00:14
275000 -- (-318.918) (-317.900) [-317.543] (-317.623) * (-316.176) (-319.740) (-317.878) [-318.299] -- 0:00:14
Average standard deviation of split frequencies: 0.016477
275500 -- (-319.394) (-317.630) (-319.362) [-316.836] * [-317.003] (-317.745) (-317.599) (-322.240) -- 0:00:14
276000 -- [-315.751] (-317.771) (-317.620) (-318.458) * (-315.890) (-317.091) [-315.520] (-317.893) -- 0:00:14
276500 -- (-315.645) [-318.790] (-318.835) (-316.617) * (-316.900) (-315.999) [-319.816] (-316.922) -- 0:00:14
277000 -- (-315.998) (-317.283) (-315.174) [-317.445] * [-316.824] (-317.018) (-323.409) (-318.145) -- 0:00:14
277500 -- [-316.095] (-319.509) (-317.344) (-316.245) * (-317.583) [-315.652] (-318.216) (-319.226) -- 0:00:14
278000 -- (-321.866) (-316.314) [-317.678] (-315.658) * (-316.020) (-315.779) [-316.660] (-316.386) -- 0:00:15
278500 -- (-315.080) (-321.060) (-317.326) [-315.625] * (-316.326) [-317.029] (-316.747) (-315.616) -- 0:00:15
279000 -- (-318.272) (-319.312) [-319.501] (-319.688) * (-315.403) (-317.231) [-316.795] (-316.287) -- 0:00:15
279500 -- (-315.810) [-318.746] (-315.853) (-319.447) * [-315.474] (-315.237) (-317.074) (-319.653) -- 0:00:14
280000 -- [-318.145] (-315.657) (-320.013) (-318.881) * (-315.445) (-316.163) (-319.066) [-316.557] -- 0:00:14
Average standard deviation of split frequencies: 0.016005
280500 -- [-315.750] (-316.882) (-319.807) (-315.751) * (-315.529) [-318.903] (-316.810) (-318.158) -- 0:00:14
281000 -- [-317.262] (-315.207) (-316.300) (-317.497) * (-321.439) [-316.827] (-316.541) (-319.376) -- 0:00:14
281500 -- (-318.332) [-316.465] (-316.290) (-324.359) * (-327.120) [-318.840] (-320.502) (-317.185) -- 0:00:14
282000 -- (-316.548) [-315.888] (-318.682) (-320.134) * (-323.302) (-322.199) (-316.032) [-316.860] -- 0:00:14
282500 -- [-317.103] (-316.153) (-319.630) (-316.520) * (-317.245) (-317.438) (-318.686) [-317.328] -- 0:00:14
283000 -- [-317.468] (-315.546) (-319.956) (-315.747) * (-316.094) (-317.065) (-316.914) [-315.009] -- 0:00:14
283500 -- (-316.265) (-318.197) (-318.391) [-319.978] * (-317.666) (-320.801) (-320.181) [-317.456] -- 0:00:14
284000 -- (-315.889) [-316.812] (-320.736) (-316.335) * (-317.132) [-318.707] (-317.719) (-316.793) -- 0:00:14
284500 -- (-319.204) (-316.369) (-316.623) [-316.147] * (-315.816) (-317.898) [-317.012] (-316.396) -- 0:00:14
285000 -- (-316.606) [-315.156] (-318.620) (-316.862) * [-317.348] (-316.959) (-317.567) (-316.092) -- 0:00:14
Average standard deviation of split frequencies: 0.015416
285500 -- (-318.039) (-315.898) (-317.102) [-316.567] * (-315.712) (-316.888) [-317.967] (-317.106) -- 0:00:14
286000 -- (-320.885) [-315.002] (-317.501) (-319.287) * (-316.479) (-317.348) [-315.896] (-315.882) -- 0:00:14
286500 -- (-319.070) (-316.052) (-316.220) [-318.349] * (-316.505) (-322.921) [-318.522] (-316.500) -- 0:00:14
287000 -- (-319.459) (-318.342) [-315.360] (-317.165) * (-317.725) [-316.405] (-318.212) (-316.499) -- 0:00:14
287500 -- (-317.144) [-318.974] (-317.148) (-314.986) * (-318.435) (-318.528) [-315.777] (-315.160) -- 0:00:14
288000 -- [-316.795] (-317.536) (-315.652) (-316.678) * (-316.183) [-316.002] (-317.649) (-322.139) -- 0:00:13
288500 -- (-316.911) (-315.808) (-315.558) [-316.035] * (-326.149) [-315.211] (-317.521) (-319.444) -- 0:00:13
289000 -- (-322.813) (-316.289) (-317.359) [-316.822] * (-320.562) (-316.571) (-317.248) [-315.830] -- 0:00:13
289500 -- [-319.037] (-317.014) (-316.102) (-317.805) * (-316.024) (-316.387) (-319.656) [-315.691] -- 0:00:13
290000 -- (-317.667) [-315.388] (-316.913) (-319.455) * (-318.776) [-317.317] (-324.861) (-317.111) -- 0:00:13
Average standard deviation of split frequencies: 0.015359
290500 -- (-316.877) (-315.923) [-315.618] (-316.233) * (-318.232) (-315.310) (-323.584) [-316.039] -- 0:00:13
291000 -- (-316.209) [-315.685] (-316.962) (-315.520) * [-317.863] (-315.573) (-320.660) (-320.128) -- 0:00:13
291500 -- (-315.850) [-315.484] (-318.724) (-314.964) * (-317.393) (-322.359) (-317.636) [-315.748] -- 0:00:13
292000 -- (-315.677) [-319.283] (-320.739) (-319.362) * (-316.750) (-319.893) (-318.691) [-317.617] -- 0:00:13
292500 -- [-315.412] (-319.484) (-317.696) (-317.410) * (-317.064) [-318.320] (-321.521) (-316.818) -- 0:00:13
293000 -- [-316.445] (-316.065) (-315.391) (-319.084) * (-316.140) (-317.880) [-315.875] (-316.483) -- 0:00:13
293500 -- (-321.221) [-315.150] (-317.827) (-318.752) * (-315.688) (-317.119) (-319.336) [-317.289] -- 0:00:13
294000 -- (-317.422) (-316.553) (-317.801) [-315.558] * [-318.652] (-318.295) (-319.163) (-315.059) -- 0:00:14
294500 -- (-316.558) [-316.534] (-321.154) (-315.318) * (-318.509) (-319.532) (-318.353) [-316.828] -- 0:00:13
295000 -- (-316.727) (-319.292) [-318.381] (-316.646) * (-323.280) [-319.027] (-317.121) (-316.826) -- 0:00:13
Average standard deviation of split frequencies: 0.013396
295500 -- (-315.884) (-317.271) (-317.404) [-321.418] * [-316.683] (-316.535) (-317.132) (-316.663) -- 0:00:13
296000 -- (-317.490) [-316.757] (-319.786) (-318.738) * [-317.056] (-315.400) (-317.931) (-316.514) -- 0:00:13
296500 -- (-315.942) (-320.512) (-319.905) [-316.633] * (-322.461) (-316.783) [-316.068] (-316.202) -- 0:00:13
297000 -- (-315.726) (-316.280) (-317.680) [-316.785] * [-316.591] (-314.921) (-315.454) (-317.236) -- 0:00:13
297500 -- (-316.751) (-318.087) (-319.535) [-315.219] * (-316.211) (-318.704) (-315.806) [-315.983] -- 0:00:13
298000 -- (-318.630) (-318.897) (-316.494) [-315.790] * [-318.165] (-315.728) (-319.300) (-317.523) -- 0:00:13
298500 -- (-317.875) (-316.434) [-315.273] (-318.026) * (-318.669) (-321.536) [-321.113] (-320.311) -- 0:00:13
299000 -- (-316.504) (-316.941) [-317.982] (-318.988) * (-317.372) [-315.410] (-317.205) (-316.420) -- 0:00:13
299500 -- (-321.171) [-318.165] (-321.673) (-317.729) * (-317.168) (-317.643) (-318.803) [-319.422] -- 0:00:13
300000 -- (-319.459) (-319.866) (-320.646) [-315.443] * (-316.739) [-316.948] (-319.730) (-316.273) -- 0:00:13
Average standard deviation of split frequencies: 0.011528
300500 -- (-320.986) (-319.114) (-317.482) [-315.885] * (-317.260) (-318.632) (-318.586) [-315.309] -- 0:00:13
301000 -- (-317.630) (-317.353) (-317.392) [-321.789] * (-318.469) [-316.545] (-316.025) (-317.338) -- 0:00:13
301500 -- (-316.760) [-316.006] (-315.733) (-318.910) * (-316.542) (-315.982) [-319.412] (-319.778) -- 0:00:13
302000 -- (-315.851) [-318.114] (-317.290) (-316.895) * (-321.475) (-320.335) (-319.375) [-318.070] -- 0:00:13
302500 -- (-323.029) (-317.993) (-320.771) [-318.304] * (-319.782) (-315.660) (-315.328) [-317.232] -- 0:00:13
303000 -- (-316.897) [-316.222] (-319.545) (-318.758) * (-316.423) (-316.943) [-318.260] (-324.852) -- 0:00:13
303500 -- (-321.396) (-316.725) [-315.493] (-316.767) * [-321.235] (-318.326) (-320.319) (-318.659) -- 0:00:12
304000 -- [-318.328] (-316.409) (-316.297) (-317.312) * [-320.563] (-317.808) (-318.901) (-318.615) -- 0:00:12
304500 -- (-319.960) (-315.630) [-315.950] (-319.356) * (-318.528) (-319.396) [-315.604] (-315.331) -- 0:00:12
305000 -- (-319.027) (-319.165) (-316.530) [-320.333] * [-318.242] (-322.067) (-315.375) (-316.728) -- 0:00:12
Average standard deviation of split frequencies: 0.010240
305500 -- (-318.753) [-319.622] (-318.251) (-317.321) * [-319.083] (-315.992) (-315.797) (-316.347) -- 0:00:12
306000 -- [-315.339] (-319.508) (-317.954) (-323.077) * (-316.699) (-319.839) [-318.116] (-315.302) -- 0:00:12
306500 -- (-316.135) [-315.231] (-317.430) (-318.433) * [-315.913] (-317.752) (-315.740) (-317.589) -- 0:00:12
307000 -- (-318.085) (-318.628) (-317.767) [-321.253] * [-318.377] (-319.729) (-320.475) (-319.841) -- 0:00:12
307500 -- [-318.416] (-315.570) (-315.568) (-319.098) * [-316.985] (-317.685) (-316.724) (-318.797) -- 0:00:12
308000 -- (-316.100) [-316.556] (-315.705) (-319.304) * (-315.720) (-315.904) [-316.734] (-316.216) -- 0:00:12
308500 -- (-316.698) (-316.654) (-321.503) [-319.054] * (-314.984) (-315.485) [-315.330] (-317.284) -- 0:00:12
309000 -- [-316.617] (-324.174) (-319.197) (-316.380) * (-316.587) [-317.546] (-317.353) (-318.655) -- 0:00:12
309500 -- (-316.300) (-315.598) [-315.906] (-316.622) * (-315.592) [-317.794] (-316.965) (-321.704) -- 0:00:12
310000 -- (-320.042) (-317.296) [-317.102] (-316.369) * (-316.805) (-315.781) [-317.762] (-316.487) -- 0:00:12
Average standard deviation of split frequencies: 0.010711
310500 -- [-318.834] (-317.009) (-318.654) (-315.582) * [-316.560] (-319.230) (-315.271) (-319.558) -- 0:00:12
311000 -- (-320.207) (-317.320) (-319.541) [-317.267] * (-316.894) (-317.188) [-321.752] (-317.734) -- 0:00:12
311500 -- (-315.538) (-317.165) [-320.829] (-316.602) * (-318.039) [-316.685] (-321.155) (-316.264) -- 0:00:12
312000 -- (-316.127) [-318.073] (-315.997) (-318.804) * (-317.199) (-316.131) (-316.445) [-316.265] -- 0:00:12
312500 -- (-317.853) (-318.006) (-318.893) [-317.409] * [-320.921] (-316.249) (-315.049) (-316.256) -- 0:00:12
313000 -- (-322.091) (-315.995) (-318.520) [-317.717] * (-318.439) (-317.534) [-316.229] (-318.309) -- 0:00:12
313500 -- (-315.058) (-318.285) (-318.324) [-316.896] * (-317.758) (-315.494) (-317.907) [-322.390] -- 0:00:12
314000 -- (-316.269) (-316.346) [-318.008] (-318.472) * (-317.139) [-315.048] (-318.451) (-316.859) -- 0:00:12
314500 -- (-318.732) [-319.545] (-315.382) (-316.706) * (-315.937) [-316.354] (-315.863) (-321.634) -- 0:00:12
315000 -- [-318.331] (-317.604) (-316.959) (-319.042) * [-315.749] (-320.046) (-317.106) (-318.475) -- 0:00:12
Average standard deviation of split frequencies: 0.010355
315500 -- (-319.322) (-317.558) [-315.499] (-315.316) * (-316.394) (-320.935) [-316.550] (-315.937) -- 0:00:12
316000 -- (-317.452) (-320.465) [-315.407] (-317.585) * (-319.397) (-319.110) [-317.485] (-316.691) -- 0:00:12
316500 -- [-316.875] (-316.634) (-317.167) (-318.892) * [-319.939] (-318.401) (-318.746) (-317.425) -- 0:00:12
317000 -- [-318.349] (-316.844) (-319.771) (-320.226) * (-317.464) (-318.136) (-317.963) [-317.151] -- 0:00:12
317500 -- (-318.809) (-315.992) (-315.898) [-316.968] * (-316.683) (-318.942) [-316.107] (-317.399) -- 0:00:12
318000 -- (-318.753) (-317.329) [-318.658] (-316.034) * (-318.339) [-315.880] (-317.024) (-317.517) -- 0:00:12
318500 -- (-319.775) (-315.986) (-315.609) [-317.218] * [-319.952] (-317.061) (-316.418) (-317.411) -- 0:00:11
319000 -- [-317.443] (-318.403) (-315.848) (-317.497) * (-319.624) (-321.575) [-320.077] (-317.335) -- 0:00:11
319500 -- (-317.993) (-316.417) [-316.790] (-317.111) * [-316.480] (-316.809) (-330.472) (-316.148) -- 0:00:11
320000 -- (-318.165) [-318.103] (-319.911) (-315.789) * (-318.364) (-321.340) (-316.801) [-317.335] -- 0:00:11
Average standard deviation of split frequencies: 0.009372
320500 -- [-318.310] (-318.636) (-315.285) (-315.449) * (-316.831) [-316.218] (-316.195) (-317.475) -- 0:00:11
321000 -- (-318.460) [-315.471] (-316.724) (-318.182) * [-316.476] (-319.809) (-315.138) (-315.772) -- 0:00:11
321500 -- (-317.556) (-318.599) [-316.708] (-323.012) * [-316.006] (-318.754) (-317.485) (-316.376) -- 0:00:11
322000 -- [-320.022] (-316.699) (-317.808) (-317.987) * (-317.401) (-315.573) [-319.022] (-318.343) -- 0:00:11
322500 -- (-320.716) [-315.248] (-318.753) (-317.786) * (-318.141) (-315.746) [-316.534] (-316.445) -- 0:00:11
323000 -- [-316.479] (-315.825) (-320.740) (-317.622) * [-317.092] (-315.908) (-316.818) (-317.074) -- 0:00:11
323500 -- [-316.122] (-317.022) (-322.189) (-317.628) * [-316.376] (-317.392) (-318.515) (-317.037) -- 0:00:11
324000 -- (-315.655) (-315.284) (-318.827) [-318.484] * (-315.437) (-316.767) (-321.315) [-318.199] -- 0:00:11
324500 -- (-318.639) [-315.631] (-315.823) (-319.725) * [-316.239] (-316.406) (-316.745) (-315.624) -- 0:00:11
325000 -- (-316.694) (-316.820) (-315.399) [-316.550] * (-318.090) (-317.116) (-316.727) [-316.661] -- 0:00:11
Average standard deviation of split frequencies: 0.009101
325500 -- [-315.460] (-318.776) (-315.843) (-316.572) * (-316.317) (-317.662) (-314.893) [-316.773] -- 0:00:11
326000 -- [-319.428] (-317.192) (-315.695) (-320.379) * (-319.607) [-315.430] (-316.199) (-317.528) -- 0:00:11
326500 -- (-319.005) [-316.216] (-319.676) (-319.653) * (-317.409) [-316.155] (-315.788) (-317.520) -- 0:00:11
327000 -- (-319.312) (-317.933) (-319.860) [-315.929] * (-315.718) (-320.578) [-317.227] (-317.205) -- 0:00:11
327500 -- (-315.226) (-316.609) [-317.259] (-316.116) * (-317.830) [-319.796] (-317.423) (-316.099) -- 0:00:11
328000 -- (-317.085) (-319.576) [-317.876] (-316.680) * (-316.163) [-317.170] (-318.088) (-317.030) -- 0:00:11
328500 -- (-316.923) (-318.290) (-315.986) [-318.612] * (-315.204) (-318.012) [-316.225] (-320.575) -- 0:00:11
329000 -- (-320.848) (-315.895) [-315.536] (-317.094) * [-315.326] (-315.747) (-319.037) (-319.496) -- 0:00:11
329500 -- (-315.357) (-319.124) [-315.169] (-315.805) * (-316.082) (-316.099) [-318.195] (-318.102) -- 0:00:11
330000 -- (-316.899) (-317.763) [-319.613] (-317.685) * [-315.207] (-316.760) (-316.718) (-317.234) -- 0:00:11
Average standard deviation of split frequencies: 0.008019
330500 -- (-318.111) (-317.214) [-318.907] (-316.215) * [-321.441] (-315.695) (-315.762) (-323.694) -- 0:00:11
331000 -- (-317.806) (-316.205) (-316.441) [-317.225] * (-317.827) [-316.084] (-317.062) (-316.013) -- 0:00:11
331500 -- (-322.077) [-317.126] (-316.423) (-321.668) * (-321.748) (-316.474) (-315.377) [-317.572] -- 0:00:11
332000 -- [-320.053] (-318.161) (-316.088) (-318.878) * [-319.082] (-316.188) (-317.111) (-317.058) -- 0:00:11
332500 -- (-316.728) (-317.086) (-315.459) [-318.731] * [-317.595] (-316.688) (-316.903) (-316.643) -- 0:00:11
333000 -- [-315.250] (-320.805) (-315.265) (-316.190) * (-316.447) (-319.271) [-316.218] (-315.666) -- 0:00:11
333500 -- (-315.258) (-317.170) (-315.642) [-317.846] * (-318.430) (-316.972) [-316.194] (-324.672) -- 0:00:10
334000 -- (-320.506) [-318.064] (-318.088) (-317.048) * [-317.835] (-318.607) (-317.483) (-322.041) -- 0:00:10
334500 -- [-318.592] (-317.529) (-315.972) (-318.602) * (-315.688) [-317.345] (-318.034) (-317.892) -- 0:00:10
335000 -- [-315.594] (-319.307) (-317.925) (-316.396) * (-317.553) (-317.048) (-320.812) [-317.538] -- 0:00:10
Average standard deviation of split frequencies: 0.008699
335500 -- (-318.295) (-317.303) (-316.369) [-319.376] * (-316.571) (-317.456) [-315.857] (-315.979) -- 0:00:10
336000 -- (-315.784) [-316.211] (-318.154) (-318.315) * (-315.759) [-316.590] (-316.778) (-316.257) -- 0:00:10
336500 -- (-317.592) (-317.826) [-315.063] (-316.107) * (-319.533) [-315.979] (-315.124) (-316.069) -- 0:00:10
337000 -- [-317.292] (-315.899) (-315.258) (-316.362) * (-317.176) [-317.855] (-316.019) (-315.197) -- 0:00:10
337500 -- (-317.685) [-317.068] (-315.299) (-316.533) * (-318.393) (-315.505) [-317.616] (-316.316) -- 0:00:10
338000 -- (-319.253) (-318.703) [-317.263] (-319.822) * (-317.335) [-319.458] (-316.530) (-317.765) -- 0:00:10
338500 -- (-317.194) [-317.140] (-317.926) (-316.395) * (-316.810) (-319.185) [-319.124] (-315.871) -- 0:00:10
339000 -- [-317.695] (-316.169) (-316.696) (-319.598) * (-316.626) (-318.547) (-316.875) [-317.741] -- 0:00:10
339500 -- (-320.442) (-317.195) (-315.520) [-316.751] * (-318.585) (-316.239) (-317.612) [-317.546] -- 0:00:10
340000 -- (-315.576) (-320.786) [-319.588] (-315.575) * (-316.351) [-316.683] (-316.354) (-315.663) -- 0:00:10
Average standard deviation of split frequencies: 0.008487
340500 -- (-315.338) (-316.439) [-317.294] (-315.553) * (-316.271) (-316.441) (-324.119) [-316.391] -- 0:00:10
341000 -- (-319.998) (-315.855) [-317.262] (-318.366) * (-316.202) (-317.202) (-320.443) [-315.690] -- 0:00:10
341500 -- (-317.141) (-315.851) (-315.317) [-316.095] * (-315.487) (-317.048) (-316.570) [-318.774] -- 0:00:10
342000 -- [-317.394] (-315.884) (-317.089) (-318.445) * (-320.553) [-321.887] (-316.670) (-318.528) -- 0:00:10
342500 -- (-319.416) (-317.374) (-315.806) [-317.331] * [-315.409] (-319.067) (-319.333) (-318.307) -- 0:00:10
343000 -- (-319.644) (-318.712) [-315.095] (-316.419) * (-317.264) (-317.670) (-315.426) [-316.430] -- 0:00:10
343500 -- (-319.711) (-319.409) (-317.368) [-316.505] * (-315.619) (-316.947) [-315.832] (-317.956) -- 0:00:10
344000 -- (-318.060) (-316.116) (-316.367) [-316.194] * (-320.239) [-318.623] (-317.889) (-315.969) -- 0:00:10
344500 -- (-316.248) (-317.529) [-315.967] (-318.395) * (-316.838) (-317.687) (-315.814) [-316.031] -- 0:00:10
345000 -- (-316.111) [-319.709] (-321.454) (-319.856) * [-316.718] (-315.972) (-316.166) (-320.482) -- 0:00:10
Average standard deviation of split frequencies: 0.008265
345500 -- (-320.390) (-317.867) (-316.697) [-316.136] * [-315.915] (-315.735) (-321.272) (-316.564) -- 0:00:10
346000 -- (-320.603) [-319.877] (-322.361) (-317.286) * (-316.806) (-318.063) (-324.665) [-317.305] -- 0:00:10
346500 -- (-319.476) (-319.387) (-323.121) [-315.805] * (-320.971) [-315.796] (-319.781) (-318.872) -- 0:00:10
347000 -- [-316.480] (-317.889) (-319.452) (-321.870) * (-318.198) [-315.655] (-319.488) (-316.331) -- 0:00:10
347500 -- [-316.249] (-316.586) (-315.987) (-319.209) * (-315.338) (-320.650) [-317.436] (-315.694) -- 0:00:10
348000 -- (-319.657) [-317.293] (-316.312) (-316.009) * (-318.508) (-318.616) (-319.991) [-315.273] -- 0:00:10
348500 -- [-318.811] (-316.604) (-319.220) (-317.085) * (-325.124) (-318.479) (-318.088) [-320.343] -- 0:00:09
349000 -- [-315.561] (-318.267) (-316.622) (-320.829) * (-318.285) (-317.310) (-315.593) [-316.763] -- 0:00:09
349500 -- (-316.096) [-315.263] (-316.316) (-316.417) * (-316.069) (-318.662) [-316.386] (-320.257) -- 0:00:09
350000 -- (-315.780) (-322.464) (-319.311) [-320.396] * (-323.217) [-316.564] (-317.519) (-315.731) -- 0:00:09
Average standard deviation of split frequencies: 0.008335
350500 -- [-317.897] (-316.439) (-318.409) (-317.128) * (-317.365) (-316.768) [-324.863] (-316.781) -- 0:00:09
351000 -- (-319.679) (-317.623) [-318.802] (-320.611) * (-316.324) (-317.493) [-315.538] (-316.199) -- 0:00:09
351500 -- (-316.561) (-316.377) (-317.041) [-317.683] * (-317.615) (-316.286) (-315.928) [-319.562] -- 0:00:09
352000 -- (-318.398) (-321.086) (-320.977) [-315.570] * (-318.875) (-317.417) [-318.915] (-317.976) -- 0:00:09
352500 -- (-315.171) (-317.513) (-321.076) [-315.975] * (-315.481) (-317.020) (-319.038) [-318.575] -- 0:00:09
353000 -- [-315.210] (-315.362) (-317.783) (-321.307) * (-316.198) [-316.793] (-318.067) (-318.478) -- 0:00:09
353500 -- (-316.958) [-316.085] (-321.158) (-324.196) * [-320.017] (-316.841) (-316.824) (-318.377) -- 0:00:09
354000 -- (-315.389) (-317.279) [-319.814] (-319.279) * (-317.738) (-317.748) [-316.076] (-319.654) -- 0:00:09
354500 -- [-317.730] (-319.412) (-316.126) (-319.577) * (-315.241) (-315.876) [-317.572] (-320.168) -- 0:00:09
355000 -- (-314.881) [-318.360] (-317.035) (-321.272) * (-317.460) (-319.982) (-317.742) [-320.576] -- 0:00:09
Average standard deviation of split frequencies: 0.007857
355500 -- (-315.897) [-317.455] (-315.230) (-318.098) * (-319.277) (-320.854) (-316.739) [-317.693] -- 0:00:09
356000 -- (-317.706) (-316.495) (-320.904) [-315.317] * (-316.827) [-315.876] (-316.834) (-316.840) -- 0:00:09
356500 -- (-316.146) (-319.102) (-316.668) [-319.660] * (-316.879) (-316.244) [-316.639] (-317.029) -- 0:00:09
357000 -- [-315.984] (-315.072) (-315.989) (-315.535) * (-319.348) [-317.196] (-322.868) (-316.740) -- 0:00:09
357500 -- (-316.552) (-315.805) [-315.648] (-316.689) * (-315.537) (-318.882) [-315.941] (-318.251) -- 0:00:09
358000 -- (-322.136) (-318.086) [-316.100] (-315.466) * [-316.099] (-318.118) (-318.352) (-318.449) -- 0:00:09
358500 -- (-319.098) [-316.061] (-318.087) (-316.469) * (-316.875) [-317.486] (-315.319) (-315.172) -- 0:00:09
359000 -- (-316.775) [-321.570] (-319.695) (-315.831) * (-317.434) (-315.941) [-315.748] (-318.758) -- 0:00:09
359500 -- (-318.909) [-316.043] (-317.852) (-316.983) * (-316.448) [-317.707] (-317.144) (-320.437) -- 0:00:09
360000 -- (-317.067) [-315.580] (-316.596) (-317.659) * (-318.415) [-318.724] (-316.900) (-317.033) -- 0:00:09
Average standard deviation of split frequencies: 0.008801
360500 -- [-317.598] (-317.152) (-316.255) (-317.183) * (-317.824) [-317.245] (-316.859) (-315.270) -- 0:00:09
361000 -- [-316.698] (-315.983) (-315.926) (-317.408) * [-317.202] (-320.495) (-316.972) (-315.858) -- 0:00:09
361500 -- (-317.562) (-317.198) [-315.552] (-317.251) * (-315.963) (-321.155) [-316.578] (-317.624) -- 0:00:09
362000 -- (-315.365) (-317.610) [-318.101] (-317.192) * (-318.105) (-317.395) (-318.450) [-317.615] -- 0:00:09
362500 -- (-317.034) [-315.742] (-315.742) (-318.435) * [-315.843] (-317.479) (-321.237) (-316.743) -- 0:00:09
363000 -- (-318.957) (-318.184) [-315.814] (-316.112) * (-320.370) (-317.582) (-318.460) [-317.320] -- 0:00:09
363500 -- (-316.277) (-317.717) (-316.359) [-316.312] * [-316.015] (-316.660) (-317.545) (-315.905) -- 0:00:09
364000 -- (-318.277) (-316.557) (-318.452) [-317.237] * (-319.076) [-315.867] (-316.453) (-317.780) -- 0:00:08
364500 -- (-316.570) [-317.427] (-317.642) (-316.309) * (-316.618) (-317.055) (-315.709) [-316.639] -- 0:00:08
365000 -- (-315.466) [-321.205] (-318.159) (-315.515) * [-317.284] (-317.314) (-317.712) (-318.893) -- 0:00:08
Average standard deviation of split frequencies: 0.009531
365500 -- [-318.042] (-318.659) (-316.390) (-316.144) * (-318.159) [-315.574] (-316.131) (-315.907) -- 0:00:08
366000 -- [-320.122] (-321.862) (-316.929) (-319.728) * [-316.675] (-319.972) (-315.778) (-317.418) -- 0:00:08
366500 -- (-317.084) (-319.119) [-317.091] (-315.802) * (-316.712) (-319.646) (-315.944) [-316.512] -- 0:00:08
367000 -- (-315.507) (-317.984) (-319.005) [-321.002] * [-317.229] (-315.615) (-316.287) (-317.000) -- 0:00:08
367500 -- (-318.803) [-317.275] (-317.030) (-318.751) * (-318.174) (-314.895) [-319.560] (-316.493) -- 0:00:08
368000 -- (-315.840) [-316.334] (-315.415) (-319.279) * (-319.850) [-316.093] (-318.597) (-316.259) -- 0:00:08
368500 -- (-317.169) (-315.167) (-318.262) [-317.006] * (-315.980) (-315.822) [-319.608] (-315.506) -- 0:00:08
369000 -- (-317.010) [-317.506] (-315.544) (-316.666) * (-318.334) (-317.109) (-315.974) [-316.787] -- 0:00:08
369500 -- (-317.580) (-319.629) (-318.437) [-315.618] * [-316.049] (-318.085) (-317.403) (-318.714) -- 0:00:08
370000 -- (-317.144) [-315.325] (-315.746) (-315.919) * (-317.322) [-320.642] (-316.973) (-317.087) -- 0:00:08
Average standard deviation of split frequencies: 0.009411
370500 -- (-318.118) [-317.214] (-317.325) (-315.356) * (-315.695) (-320.703) (-316.214) [-317.589] -- 0:00:08
371000 -- (-319.963) (-316.915) (-316.809) [-315.983] * [-315.583] (-318.988) (-319.955) (-317.870) -- 0:00:08
371500 -- (-317.048) (-317.260) (-315.940) [-317.340] * (-318.872) [-316.490] (-318.302) (-317.951) -- 0:00:08
372000 -- (-318.001) (-316.188) [-315.640] (-316.445) * (-315.994) [-318.389] (-315.442) (-316.868) -- 0:00:08
372500 -- [-318.360] (-324.533) (-319.486) (-317.720) * (-315.541) (-317.510) (-318.232) [-316.170] -- 0:00:08
373000 -- (-319.942) (-323.972) [-316.078] (-319.251) * [-317.667] (-316.491) (-316.211) (-315.642) -- 0:00:08
373500 -- (-316.345) (-316.351) [-316.417] (-315.147) * (-317.872) [-316.773] (-316.478) (-319.531) -- 0:00:08
374000 -- (-320.142) (-315.634) (-320.016) [-317.260] * [-318.842] (-315.118) (-315.913) (-318.925) -- 0:00:08
374500 -- (-316.678) (-317.745) (-317.206) [-322.274] * (-322.012) (-317.617) [-317.027] (-316.907) -- 0:00:08
375000 -- (-315.789) (-316.572) [-316.076] (-318.421) * (-317.739) (-318.959) [-316.679] (-321.167) -- 0:00:08
Average standard deviation of split frequencies: 0.010500
375500 -- [-315.652] (-316.670) (-320.161) (-318.665) * (-318.685) (-318.961) [-317.507] (-316.666) -- 0:00:08
376000 -- (-319.465) [-319.314] (-316.860) (-317.275) * (-317.239) [-315.784] (-317.974) (-318.479) -- 0:00:08
376500 -- (-317.196) (-316.648) (-318.714) [-318.508] * (-317.204) [-315.697] (-316.368) (-317.599) -- 0:00:08
377000 -- (-315.773) (-318.315) [-315.855] (-316.249) * (-315.569) (-318.835) [-315.655] (-317.034) -- 0:00:08
377500 -- [-315.507] (-317.633) (-316.095) (-316.676) * (-315.810) [-319.204] (-319.400) (-315.743) -- 0:00:08
378000 -- (-316.690) (-315.979) [-316.171] (-321.405) * (-318.667) (-316.527) (-320.113) [-316.974] -- 0:00:08
378500 -- (-319.747) [-317.188] (-318.417) (-323.694) * [-320.118] (-318.333) (-321.506) (-318.443) -- 0:00:08
379000 -- [-317.412] (-315.084) (-317.329) (-320.348) * (-320.718) [-318.190] (-317.613) (-320.941) -- 0:00:07
379500 -- (-316.451) [-316.853] (-316.936) (-316.434) * (-321.092) (-315.930) [-317.847] (-317.159) -- 0:00:07
380000 -- (-316.396) (-316.657) [-317.212] (-316.462) * (-315.938) (-316.017) (-317.552) [-318.828] -- 0:00:07
Average standard deviation of split frequencies: 0.008503
380500 -- (-320.059) (-317.808) [-316.771] (-320.271) * [-316.389] (-315.237) (-318.891) (-319.488) -- 0:00:07
381000 -- (-318.355) [-317.867] (-319.817) (-319.229) * (-321.534) [-317.255] (-319.244) (-320.003) -- 0:00:07
381500 -- (-318.753) (-318.367) [-318.439] (-315.909) * (-319.941) [-316.055] (-321.271) (-315.419) -- 0:00:07
382000 -- (-323.275) (-319.782) (-319.565) [-315.545] * (-317.085) [-316.477] (-320.531) (-319.238) -- 0:00:07
382500 -- (-318.477) (-319.086) [-319.249] (-315.737) * [-316.298] (-316.441) (-315.728) (-317.197) -- 0:00:07
383000 -- (-318.003) (-315.765) (-317.900) [-318.717] * [-317.867] (-317.608) (-316.424) (-316.440) -- 0:00:07
383500 -- (-318.376) [-317.038] (-315.209) (-319.335) * (-318.281) (-315.931) [-319.096] (-318.601) -- 0:00:07
384000 -- (-319.064) (-316.032) (-316.401) [-317.458] * (-317.971) (-322.768) (-320.788) [-316.702] -- 0:00:07
384500 -- (-315.945) (-316.965) [-319.379] (-319.491) * (-320.666) (-318.434) (-317.534) [-316.293] -- 0:00:07
385000 -- (-317.473) (-317.456) (-316.165) [-316.979] * (-322.279) [-319.095] (-318.171) (-315.695) -- 0:00:07
Average standard deviation of split frequencies: 0.009465
385500 -- (-317.375) (-317.125) (-316.479) [-320.186] * (-319.141) (-317.628) [-317.064] (-319.504) -- 0:00:07
386000 -- [-315.222] (-317.045) (-316.381) (-315.346) * (-321.133) (-321.978) [-319.066] (-324.260) -- 0:00:07
386500 -- (-315.670) (-318.106) (-318.786) [-317.860] * (-315.152) (-315.932) [-320.175] (-315.992) -- 0:00:07
387000 -- [-318.853] (-317.434) (-318.474) (-316.966) * [-316.486] (-318.126) (-316.792) (-315.640) -- 0:00:07
387500 -- (-319.733) (-317.106) [-315.378] (-317.307) * (-317.718) (-315.541) [-316.465] (-317.374) -- 0:00:07
388000 -- (-317.436) (-317.205) (-329.601) [-315.442] * [-318.444] (-315.180) (-315.811) (-317.136) -- 0:00:07
388500 -- [-318.546] (-317.119) (-326.886) (-317.230) * [-316.976] (-319.062) (-318.495) (-317.853) -- 0:00:07
389000 -- (-318.761) (-317.798) (-317.014) [-315.953] * (-318.545) [-318.449] (-319.126) (-316.294) -- 0:00:07
389500 -- (-317.674) [-316.248] (-316.798) (-317.226) * [-315.450] (-316.188) (-322.298) (-317.509) -- 0:00:07
390000 -- (-316.342) [-318.015] (-320.740) (-321.271) * (-316.547) (-316.251) [-316.254] (-320.156) -- 0:00:07
Average standard deviation of split frequencies: 0.007964
390500 -- (-318.110) [-315.941] (-315.166) (-320.890) * (-316.515) (-319.097) (-316.583) [-318.302] -- 0:00:07
391000 -- (-316.953) (-317.396) [-317.189] (-317.506) * (-316.496) (-316.810) (-317.281) [-315.733] -- 0:00:07
391500 -- (-320.270) [-316.855] (-315.406) (-319.595) * (-317.002) (-318.378) (-319.795) [-317.559] -- 0:00:07
392000 -- (-319.710) [-318.924] (-317.226) (-319.438) * (-321.983) [-315.279] (-318.348) (-317.368) -- 0:00:07
392500 -- (-317.691) (-317.550) [-316.850] (-316.660) * [-317.984] (-315.699) (-319.150) (-315.832) -- 0:00:07
393000 -- (-318.261) [-317.070] (-322.873) (-319.856) * (-317.178) (-318.464) (-316.602) [-315.458] -- 0:00:07
393500 -- (-316.780) (-316.545) [-318.706] (-318.174) * [-316.600] (-317.536) (-320.451) (-316.074) -- 0:00:07
394000 -- (-315.233) (-318.808) (-317.180) [-317.020] * (-318.431) (-318.936) [-317.089] (-315.446) -- 0:00:06
394500 -- (-317.299) (-317.954) [-316.399] (-315.893) * [-317.160] (-319.807) (-315.974) (-317.129) -- 0:00:06
395000 -- (-317.240) [-319.431] (-323.278) (-317.912) * (-315.328) [-318.950] (-316.415) (-315.814) -- 0:00:06
Average standard deviation of split frequencies: 0.008254
395500 -- (-320.408) (-317.119) (-319.455) [-316.919] * (-318.740) (-320.312) (-317.132) [-320.067] -- 0:00:06
396000 -- (-316.884) (-317.998) [-320.739] (-317.419) * (-318.323) (-315.076) (-316.239) [-315.304] -- 0:00:06
396500 -- (-317.181) [-317.925] (-320.601) (-317.230) * (-319.319) (-319.259) (-317.128) [-317.703] -- 0:00:06
397000 -- (-317.256) [-316.698] (-315.746) (-318.901) * (-315.985) (-316.149) [-317.674] (-316.163) -- 0:00:06
397500 -- (-315.211) (-316.865) (-318.488) [-317.383] * (-315.200) [-316.323] (-327.152) (-319.272) -- 0:00:06
398000 -- [-316.041] (-315.622) (-316.334) (-317.232) * [-315.220] (-317.288) (-316.213) (-317.177) -- 0:00:06
398500 -- (-317.919) [-316.348] (-319.119) (-320.331) * [-315.389] (-317.583) (-316.406) (-315.497) -- 0:00:06
399000 -- (-316.733) [-315.541] (-317.733) (-315.217) * (-319.558) (-321.450) (-316.419) [-315.340] -- 0:00:06
399500 -- (-317.037) (-315.574) (-320.048) [-316.110] * (-318.674) (-316.173) [-317.400] (-320.052) -- 0:00:06
400000 -- (-315.398) [-315.123] (-318.686) (-318.211) * [-319.856] (-319.511) (-317.107) (-318.942) -- 0:00:06
Average standard deviation of split frequencies: 0.007687
400500 -- [-316.841] (-319.491) (-317.919) (-316.583) * [-316.189] (-318.412) (-315.795) (-319.059) -- 0:00:06
401000 -- (-316.264) [-316.368] (-316.148) (-320.078) * (-316.573) [-317.773] (-317.623) (-318.282) -- 0:00:06
401500 -- (-315.979) (-323.926) (-321.377) [-318.904] * [-318.039] (-321.741) (-319.520) (-319.080) -- 0:00:06
402000 -- (-317.580) (-320.759) [-314.927] (-317.524) * [-317.721] (-317.423) (-317.382) (-324.793) -- 0:00:06
402500 -- (-318.123) (-319.435) (-314.858) [-317.548] * (-318.110) [-317.054] (-315.974) (-319.491) -- 0:00:06
403000 -- (-315.819) (-317.716) [-315.157] (-315.873) * (-319.088) (-319.148) [-316.215] (-315.842) -- 0:00:06
403500 -- (-316.567) [-317.207] (-317.482) (-318.739) * (-315.180) [-319.823] (-316.096) (-317.875) -- 0:00:06
404000 -- (-317.727) (-320.615) [-315.562] (-317.706) * (-316.289) [-317.171] (-317.255) (-315.112) -- 0:00:06
404500 -- (-316.508) [-315.965] (-318.547) (-321.627) * (-317.844) [-315.947] (-316.848) (-319.596) -- 0:00:06
405000 -- [-317.967] (-318.114) (-316.188) (-316.335) * (-316.401) (-318.709) [-315.836] (-320.829) -- 0:00:06
Average standard deviation of split frequencies: 0.007895
405500 -- (-316.781) (-318.526) [-316.434] (-319.332) * (-316.648) (-319.949) (-317.486) [-318.789] -- 0:00:06
406000 -- (-316.371) (-317.235) (-318.544) [-317.094] * [-315.341] (-317.144) (-317.908) (-315.889) -- 0:00:06
406500 -- (-316.587) (-319.804) (-316.225) [-315.236] * (-316.894) (-317.213) [-316.521] (-320.190) -- 0:00:06
407000 -- (-318.283) [-315.473] (-317.012) (-319.568) * [-315.600] (-317.422) (-316.443) (-316.393) -- 0:00:06
407500 -- (-316.929) (-315.758) (-319.665) [-316.251] * (-317.391) (-316.499) [-317.034] (-316.679) -- 0:00:06
408000 -- (-315.805) [-315.476] (-315.473) (-318.703) * (-317.086) (-318.425) (-316.947) [-317.070] -- 0:00:06
408500 -- (-316.809) (-316.165) [-316.756] (-315.630) * (-316.527) (-319.755) [-318.859] (-317.545) -- 0:00:06
409000 -- (-322.467) (-316.109) (-320.268) [-317.721] * (-323.511) [-315.838] (-318.882) (-318.813) -- 0:00:06
409500 -- [-315.216] (-316.930) (-324.843) (-317.252) * (-322.477) (-316.871) [-315.835] (-318.230) -- 0:00:05
410000 -- (-315.546) (-316.997) (-317.901) [-315.256] * (-317.990) (-316.993) (-315.325) [-318.064] -- 0:00:05
Average standard deviation of split frequencies: 0.008824
410500 -- (-315.070) [-317.250] (-319.345) (-317.050) * [-316.005] (-318.316) (-319.782) (-317.509) -- 0:00:05
411000 -- (-315.564) [-318.864] (-319.910) (-316.813) * (-319.258) (-316.050) (-316.166) [-318.228] -- 0:00:05
411500 -- (-318.092) (-319.805) (-317.250) [-317.258] * (-317.836) [-319.488] (-315.334) (-317.618) -- 0:00:05
412000 -- (-317.025) (-317.108) [-315.985] (-316.993) * [-316.187] (-321.834) (-318.045) (-316.183) -- 0:00:05
412500 -- [-318.958] (-316.420) (-316.379) (-318.067) * (-321.006) (-317.965) (-322.778) [-316.429] -- 0:00:05
413000 -- (-318.528) (-316.006) (-318.053) [-318.076] * [-318.212] (-316.595) (-319.465) (-320.157) -- 0:00:05
413500 -- [-317.747] (-315.973) (-319.273) (-316.138) * (-318.605) [-316.482] (-316.731) (-316.256) -- 0:00:05
414000 -- [-317.145] (-319.472) (-319.120) (-316.992) * (-318.231) (-317.198) [-316.819] (-317.084) -- 0:00:05
414500 -- (-315.612) [-318.282] (-316.022) (-317.842) * (-318.225) [-317.127] (-320.277) (-315.861) -- 0:00:05
415000 -- [-315.059] (-321.632) (-319.098) (-316.325) * (-318.540) (-316.737) (-316.373) [-321.920] -- 0:00:05
Average standard deviation of split frequencies: 0.008074
415500 -- (-317.483) (-317.975) [-317.148] (-317.458) * (-315.828) (-316.356) (-315.281) [-317.293] -- 0:00:05
416000 -- (-315.478) [-316.217] (-316.215) (-315.155) * (-316.290) (-317.081) [-318.844] (-318.832) -- 0:00:05
416500 -- (-317.003) [-316.642] (-317.397) (-317.135) * (-324.372) [-316.295] (-319.731) (-317.994) -- 0:00:05
417000 -- [-315.132] (-316.763) (-317.787) (-316.644) * (-317.543) [-316.216] (-315.820) (-316.364) -- 0:00:05
417500 -- [-316.757] (-318.246) (-316.732) (-317.730) * (-315.928) [-316.984] (-315.476) (-316.029) -- 0:00:05
418000 -- [-319.440] (-316.364) (-316.140) (-319.926) * [-316.288] (-315.912) (-315.344) (-315.128) -- 0:00:05
418500 -- (-316.293) (-317.911) [-317.513] (-315.769) * (-315.287) [-316.120] (-316.046) (-316.243) -- 0:00:05
419000 -- (-317.632) [-318.635] (-316.880) (-316.548) * (-317.027) [-315.116] (-318.614) (-318.545) -- 0:00:05
419500 -- (-317.876) [-316.779] (-316.804) (-316.401) * (-318.032) [-317.524] (-317.159) (-317.486) -- 0:00:05
420000 -- (-316.581) (-315.412) [-317.226] (-319.830) * (-316.005) (-318.895) [-317.153] (-317.551) -- 0:00:05
Average standard deviation of split frequencies: 0.008825
420500 -- [-316.101] (-315.195) (-319.807) (-317.449) * (-315.909) (-315.545) [-316.856] (-316.683) -- 0:00:05
421000 -- (-319.588) [-317.080] (-318.855) (-319.897) * (-319.983) (-317.190) (-319.597) [-315.064] -- 0:00:05
421500 -- (-316.632) (-317.446) [-317.469] (-316.017) * (-326.686) (-316.510) [-319.565] (-317.025) -- 0:00:05
422000 -- (-317.199) (-318.549) [-317.913] (-315.805) * (-319.714) (-318.847) [-320.579] (-316.762) -- 0:00:05
422500 -- (-317.758) [-317.370] (-317.825) (-317.063) * (-316.657) (-320.393) (-320.222) [-316.924] -- 0:00:05
423000 -- [-318.587] (-317.496) (-321.578) (-318.638) * (-315.470) (-322.360) (-317.487) [-316.818] -- 0:00:05
423500 -- (-316.301) [-317.099] (-319.827) (-319.822) * (-319.923) (-316.956) [-319.411] (-316.465) -- 0:00:05
424000 -- (-319.055) (-317.520) (-316.429) [-319.113] * [-316.893] (-315.481) (-316.216) (-317.662) -- 0:00:05
424500 -- (-315.483) (-316.523) [-319.905] (-319.730) * (-319.317) (-318.534) (-317.002) [-315.838] -- 0:00:04
425000 -- (-316.938) (-317.010) (-315.796) [-320.377] * (-319.541) [-316.879] (-317.492) (-315.175) -- 0:00:04
Average standard deviation of split frequencies: 0.010740
425500 -- (-319.523) [-317.381] (-317.258) (-316.402) * [-318.764] (-317.665) (-315.545) (-315.230) -- 0:00:04
426000 -- [-317.814] (-320.376) (-317.100) (-316.607) * (-317.472) [-319.912] (-315.791) (-316.506) -- 0:00:04
426500 -- (-315.707) (-316.403) [-319.285] (-317.619) * (-314.953) (-319.830) (-319.159) [-315.560] -- 0:00:04
427000 -- (-319.969) (-315.668) [-316.139] (-318.710) * (-315.191) (-316.777) [-318.996] (-315.398) -- 0:00:04
427500 -- (-315.845) [-315.507] (-320.485) (-317.415) * (-317.291) (-316.655) (-319.296) [-317.815] -- 0:00:04
428000 -- (-320.610) [-318.276] (-317.289) (-318.495) * (-316.059) (-315.720) (-316.511) [-315.987] -- 0:00:04
428500 -- (-316.672) (-321.284) [-316.495] (-318.533) * [-315.876] (-319.284) (-317.297) (-318.265) -- 0:00:04
429000 -- (-316.630) (-315.636) [-317.153] (-317.805) * (-318.700) (-316.553) (-316.539) [-316.329] -- 0:00:04
429500 -- [-315.807] (-317.915) (-320.840) (-317.002) * (-318.592) [-318.025] (-317.489) (-318.117) -- 0:00:04
430000 -- [-315.134] (-315.990) (-319.892) (-319.246) * [-317.401] (-316.142) (-315.739) (-319.471) -- 0:00:04
Average standard deviation of split frequencies: 0.010238
430500 -- (-321.129) [-318.547] (-314.979) (-320.311) * (-324.097) (-318.860) (-317.219) [-320.390] -- 0:00:04
431000 -- [-319.024] (-320.003) (-315.972) (-316.767) * (-320.510) [-316.512] (-317.070) (-320.436) -- 0:00:04
431500 -- (-317.193) [-316.490] (-319.866) (-321.298) * (-317.155) (-316.523) [-317.093] (-316.858) -- 0:00:04
432000 -- [-318.085] (-315.659) (-317.457) (-317.892) * [-316.763] (-315.880) (-318.606) (-318.581) -- 0:00:04
432500 -- (-316.832) (-314.977) [-317.201] (-319.814) * [-319.065] (-317.532) (-321.486) (-317.848) -- 0:00:04
433000 -- [-315.629] (-314.820) (-318.653) (-317.182) * (-316.076) [-315.850] (-320.583) (-314.982) -- 0:00:04
433500 -- (-317.569) (-316.728) (-316.923) [-319.250] * (-320.050) (-316.646) (-316.362) [-317.712] -- 0:00:04
434000 -- [-316.886] (-317.669) (-317.173) (-321.155) * (-316.523) (-319.269) (-315.732) [-315.578] -- 0:00:04
434500 -- [-321.405] (-317.465) (-317.571) (-316.247) * (-315.348) (-319.861) [-315.070] (-315.495) -- 0:00:04
435000 -- (-318.214) (-316.023) [-316.223] (-316.994) * (-319.512) (-318.195) (-319.363) [-317.214] -- 0:00:04
Average standard deviation of split frequencies: 0.010992
435500 -- (-316.703) [-315.999] (-316.883) (-316.729) * (-316.665) (-317.258) (-317.760) [-316.037] -- 0:00:04
436000 -- (-319.950) (-315.431) (-317.468) [-320.189] * [-315.325] (-318.352) (-315.688) (-316.113) -- 0:00:04
436500 -- (-315.342) (-315.496) [-315.960] (-318.907) * (-315.028) [-316.992] (-316.799) (-316.581) -- 0:00:04
437000 -- [-318.764] (-315.559) (-316.111) (-317.249) * (-316.167) (-316.285) [-315.253] (-315.148) -- 0:00:04
437500 -- (-320.184) (-316.194) (-316.770) [-318.005] * (-316.583) [-316.007] (-316.061) (-316.547) -- 0:00:04
438000 -- [-316.876] (-318.523) (-315.977) (-318.340) * [-316.446] (-315.690) (-318.408) (-317.665) -- 0:00:04
438500 -- (-317.142) (-319.188) [-317.190] (-320.363) * [-315.082] (-315.939) (-316.924) (-315.994) -- 0:00:04
439000 -- [-315.192] (-320.440) (-323.433) (-315.606) * (-316.932) (-318.114) (-315.745) [-316.041] -- 0:00:04
439500 -- (-317.565) [-317.871] (-318.114) (-316.347) * (-315.798) (-316.887) (-318.912) [-317.619] -- 0:00:03
440000 -- [-318.975] (-318.021) (-323.602) (-317.222) * (-317.312) (-319.269) [-320.703] (-317.413) -- 0:00:03
Average standard deviation of split frequencies: 0.011138
440500 -- [-316.442] (-317.709) (-318.080) (-317.996) * [-321.276] (-319.431) (-321.504) (-319.408) -- 0:00:03
441000 -- (-315.616) (-318.309) [-317.343] (-317.121) * (-318.692) [-324.347] (-320.100) (-318.928) -- 0:00:03
441500 -- (-318.307) [-316.277] (-319.188) (-318.192) * (-318.901) (-321.649) (-317.672) [-319.901] -- 0:00:03
442000 -- (-316.244) [-317.577] (-316.912) (-316.063) * [-322.200] (-316.358) (-316.895) (-324.495) -- 0:00:03
442500 -- (-315.433) [-317.955] (-318.595) (-319.943) * [-318.348] (-316.399) (-318.350) (-317.882) -- 0:00:03
443000 -- (-316.306) (-316.696) [-316.722] (-315.904) * (-317.608) [-315.956] (-319.048) (-320.396) -- 0:00:03
443500 -- (-316.947) (-316.900) (-321.020) [-318.028] * [-318.368] (-316.170) (-316.731) (-316.182) -- 0:00:03
444000 -- (-316.464) (-319.496) (-319.006) [-317.748] * (-316.714) (-315.539) [-316.032] (-315.821) -- 0:00:03
444500 -- (-319.356) (-316.944) [-316.685] (-318.603) * (-322.619) (-318.579) [-317.985] (-315.369) -- 0:00:03
445000 -- (-317.277) [-315.843] (-317.968) (-315.933) * [-318.267] (-315.892) (-318.106) (-316.489) -- 0:00:03
Average standard deviation of split frequencies: 0.012096
445500 -- [-317.015] (-317.727) (-317.129) (-319.259) * (-316.089) [-316.236] (-316.212) (-320.078) -- 0:00:03
446000 -- (-317.726) (-316.747) (-315.840) [-317.601] * [-318.608] (-317.239) (-318.585) (-316.539) -- 0:00:03
446500 -- (-316.679) (-316.167) (-318.214) [-316.129] * (-315.723) (-316.843) [-317.948] (-316.930) -- 0:00:03
447000 -- (-316.658) [-316.011] (-318.893) (-320.155) * (-316.001) [-315.613] (-317.484) (-317.389) -- 0:00:03
447500 -- (-315.504) [-316.604] (-318.880) (-318.813) * [-316.870] (-315.446) (-316.654) (-315.965) -- 0:00:03
448000 -- [-315.157] (-317.930) (-321.194) (-315.817) * (-320.559) [-317.057] (-318.032) (-314.974) -- 0:00:03
448500 -- [-315.582] (-318.132) (-321.061) (-318.495) * (-316.688) (-317.569) [-315.871] (-317.875) -- 0:00:03
449000 -- (-315.589) (-315.339) (-317.348) [-315.562] * (-316.804) (-320.032) (-318.420) [-316.108] -- 0:00:03
449500 -- (-316.908) [-316.688] (-318.371) (-315.620) * (-316.252) (-322.100) [-317.087] (-317.260) -- 0:00:03
450000 -- [-316.489] (-318.451) (-316.496) (-316.451) * (-315.281) (-318.657) (-316.373) [-316.873] -- 0:00:03
Average standard deviation of split frequencies: 0.011506
450500 -- (-323.548) (-318.453) [-316.570] (-316.062) * (-315.965) (-316.759) (-316.144) [-315.938] -- 0:00:03
451000 -- [-316.447] (-316.087) (-318.841) (-318.217) * (-317.863) [-318.315] (-316.485) (-316.721) -- 0:00:03
451500 -- (-315.680) (-316.111) [-317.336] (-323.092) * (-318.756) (-318.148) (-316.399) [-315.932] -- 0:00:03
452000 -- (-315.902) [-316.903] (-318.449) (-316.470) * [-315.051] (-320.295) (-316.630) (-316.913) -- 0:00:03
452500 -- (-317.342) (-317.708) [-316.633] (-315.938) * (-314.904) [-318.974] (-316.613) (-320.679) -- 0:00:03
453000 -- [-316.219] (-316.755) (-317.157) (-318.915) * (-316.016) (-315.222) (-315.841) [-316.700] -- 0:00:03
453500 -- [-316.620] (-317.234) (-317.585) (-316.354) * [-320.620] (-315.411) (-316.818) (-320.565) -- 0:00:03
454000 -- (-319.076) (-318.201) [-317.319] (-316.759) * [-317.639] (-317.165) (-320.345) (-316.561) -- 0:00:03
454500 -- (-318.349) (-318.876) [-316.501] (-319.246) * (-316.801) [-317.049] (-319.020) (-319.335) -- 0:00:03
455000 -- (-318.459) (-316.646) (-317.465) [-318.242] * (-315.064) (-319.916) [-315.631] (-317.819) -- 0:00:02
Average standard deviation of split frequencies: 0.010642
455500 -- [-318.033] (-322.676) (-315.016) (-321.699) * [-318.664] (-317.712) (-315.366) (-316.261) -- 0:00:02
456000 -- (-316.424) [-316.791] (-323.894) (-317.686) * (-321.645) (-319.223) [-318.022] (-317.447) -- 0:00:02
456500 -- (-319.699) [-322.444] (-317.000) (-318.752) * (-321.162) (-316.611) [-319.546] (-317.625) -- 0:00:02
457000 -- [-319.350] (-317.180) (-317.210) (-315.728) * (-323.333) (-315.668) [-316.872] (-315.151) -- 0:00:02
457500 -- (-316.704) [-316.882] (-314.865) (-316.128) * (-319.592) [-316.672] (-316.014) (-315.934) -- 0:00:02
458000 -- (-318.605) (-316.855) [-315.060] (-320.616) * (-316.238) [-319.298] (-318.550) (-316.940) -- 0:00:02
458500 -- (-317.333) [-315.826] (-315.345) (-319.090) * [-314.949] (-316.249) (-321.022) (-316.311) -- 0:00:02
459000 -- (-315.962) [-319.664] (-318.971) (-317.635) * [-316.637] (-317.439) (-316.666) (-318.682) -- 0:00:02
459500 -- [-316.607] (-315.819) (-319.740) (-316.677) * [-316.014] (-321.880) (-315.467) (-318.628) -- 0:00:02
460000 -- (-317.542) (-315.469) (-317.882) [-316.254] * (-319.172) [-316.189] (-318.473) (-319.214) -- 0:00:02
Average standard deviation of split frequencies: 0.009402
460500 -- (-319.123) (-317.214) (-318.016) [-315.469] * (-317.751) [-317.438] (-318.025) (-320.307) -- 0:00:02
461000 -- (-316.836) (-317.780) [-315.693] (-316.302) * (-318.269) (-316.631) (-316.559) [-315.903] -- 0:00:02
461500 -- (-316.967) (-318.941) [-318.001] (-318.770) * (-321.814) [-315.632] (-315.758) (-321.721) -- 0:00:02
462000 -- (-317.543) (-320.848) (-316.012) [-317.367] * (-317.208) (-319.868) (-318.488) [-317.850] -- 0:00:02
462500 -- (-318.557) (-316.219) (-316.831) [-315.670] * (-315.546) (-316.876) (-317.096) [-315.536] -- 0:00:02
463000 -- (-317.751) (-319.779) (-322.109) [-316.395] * [-315.800] (-319.258) (-316.999) (-316.605) -- 0:00:02
463500 -- [-316.242] (-318.429) (-320.952) (-315.392) * (-318.963) [-315.824] (-316.811) (-317.738) -- 0:00:02
464000 -- (-316.950) [-315.976] (-315.245) (-318.620) * (-323.155) (-324.560) (-315.708) [-316.634] -- 0:00:02
464500 -- (-318.109) [-316.954] (-316.403) (-316.328) * (-317.095) [-317.754] (-318.678) (-317.802) -- 0:00:02
465000 -- (-318.011) (-316.149) (-316.299) [-319.020] * (-318.312) (-316.497) [-315.356] (-319.042) -- 0:00:02
Average standard deviation of split frequencies: 0.009484
465500 -- (-316.802) (-315.665) (-316.146) [-324.134] * (-316.623) (-317.596) (-321.387) [-320.443] -- 0:00:02
466000 -- (-316.106) [-318.062] (-316.341) (-315.743) * (-316.047) (-320.246) (-321.726) [-316.361] -- 0:00:02
466500 -- [-315.729] (-316.908) (-315.455) (-315.304) * (-317.014) [-320.619] (-316.738) (-318.592) -- 0:00:02
467000 -- (-319.177) [-316.609] (-316.336) (-316.300) * (-316.281) [-316.904] (-320.689) (-318.777) -- 0:00:02
467500 -- [-317.596] (-315.441) (-316.333) (-315.513) * [-318.529] (-316.005) (-318.130) (-315.063) -- 0:00:02
468000 -- (-316.126) [-316.950] (-315.736) (-316.664) * [-317.381] (-316.391) (-316.407) (-316.504) -- 0:00:02
468500 -- [-318.135] (-315.549) (-318.582) (-319.695) * (-319.711) (-319.299) [-319.071] (-318.996) -- 0:00:02
469000 -- [-315.589] (-318.885) (-324.252) (-317.557) * (-318.266) (-317.143) (-318.387) [-320.624] -- 0:00:02
469500 -- (-317.507) (-318.261) (-317.422) [-315.809] * [-317.980] (-319.783) (-316.863) (-318.245) -- 0:00:02
470000 -- (-316.646) [-316.285] (-324.008) (-318.259) * [-315.886] (-324.294) (-319.572) (-316.116) -- 0:00:01
Average standard deviation of split frequencies: 0.010428
470500 -- [-315.748] (-316.016) (-315.877) (-317.244) * (-317.309) [-318.058] (-318.650) (-318.029) -- 0:00:01
471000 -- (-315.148) [-318.340] (-316.003) (-317.215) * (-315.936) [-317.330] (-316.881) (-318.145) -- 0:00:01
471500 -- [-318.247] (-325.324) (-322.483) (-316.310) * [-318.464] (-317.687) (-316.076) (-317.883) -- 0:00:01
472000 -- (-315.904) (-321.246) [-316.052] (-320.635) * (-319.583) (-318.141) (-315.791) [-315.142] -- 0:00:01
472500 -- (-317.143) (-318.807) [-323.783] (-316.536) * (-315.854) (-321.879) [-318.474] (-316.138) -- 0:00:01
473000 -- [-316.228] (-318.929) (-318.623) (-316.787) * (-315.880) [-317.259] (-319.102) (-316.238) -- 0:00:01
473500 -- (-317.762) [-317.155] (-316.289) (-316.023) * [-315.846] (-320.012) (-318.320) (-316.056) -- 0:00:01
474000 -- [-316.122] (-317.586) (-315.222) (-316.009) * (-314.925) [-319.380] (-317.965) (-317.298) -- 0:00:01
474500 -- (-316.313) [-315.882] (-318.218) (-319.433) * (-320.232) [-323.322] (-318.054) (-317.810) -- 0:00:01
475000 -- [-317.355] (-320.886) (-321.630) (-318.979) * (-319.636) (-326.396) (-317.196) [-317.513] -- 0:00:01
Average standard deviation of split frequencies: 0.009670
475500 -- (-317.961) [-316.244] (-317.044) (-319.006) * [-315.524] (-318.223) (-318.176) (-319.128) -- 0:00:01
476000 -- (-315.519) [-320.064] (-317.109) (-318.082) * (-317.013) (-319.180) [-317.605] (-315.897) -- 0:00:01
476500 -- [-317.238] (-317.807) (-316.519) (-317.361) * (-318.032) (-315.634) (-317.001) [-317.778] -- 0:00:01
477000 -- (-317.276) (-317.452) (-315.091) [-319.935] * (-318.915) (-315.577) (-320.303) [-318.513] -- 0:00:01
477500 -- [-316.854] (-316.412) (-316.737) (-316.895) * (-316.768) (-316.071) [-320.303] (-316.847) -- 0:00:01
478000 -- (-317.757) (-317.149) [-317.193] (-317.758) * (-319.297) (-318.796) (-316.210) [-315.321] -- 0:00:01
478500 -- (-315.798) [-319.260] (-315.393) (-317.101) * [-319.461] (-315.750) (-316.997) (-317.069) -- 0:00:01
479000 -- (-317.890) (-316.473) [-318.069] (-316.396) * (-320.031) [-315.824] (-320.008) (-321.655) -- 0:00:01
479500 -- [-317.415] (-319.739) (-316.457) (-317.650) * (-315.660) [-316.419] (-317.787) (-318.358) -- 0:00:01
480000 -- (-318.722) (-315.551) (-318.777) [-317.418] * [-316.763] (-316.517) (-315.931) (-322.287) -- 0:00:01
Average standard deviation of split frequencies: 0.010359
480500 -- [-315.437] (-318.575) (-318.035) (-317.476) * [-317.340] (-318.459) (-318.217) (-316.268) -- 0:00:01
481000 -- [-316.984] (-317.146) (-318.774) (-317.924) * (-316.324) [-316.342] (-317.921) (-315.783) -- 0:00:01
481500 -- (-327.093) (-316.892) [-320.752] (-317.397) * (-317.755) (-318.177) (-317.544) [-315.898] -- 0:00:01
482000 -- (-319.280) [-322.453] (-316.877) (-317.750) * (-316.903) [-318.003] (-316.904) (-317.242) -- 0:00:01
482500 -- (-315.649) [-316.864] (-321.191) (-316.142) * (-319.126) (-318.769) [-320.066] (-316.542) -- 0:00:01
483000 -- [-317.254] (-319.522) (-321.351) (-319.689) * (-317.705) (-317.269) (-318.095) [-315.498] -- 0:00:01
483500 -- (-315.247) (-317.161) (-317.465) [-315.089] * (-315.126) (-317.770) (-319.505) [-316.233] -- 0:00:01
484000 -- [-316.616] (-316.534) (-315.316) (-316.453) * (-316.394) (-321.717) (-317.403) [-316.616] -- 0:00:01
484500 -- (-317.909) (-318.086) [-320.450] (-316.556) * (-318.252) (-318.950) (-317.757) [-317.369] -- 0:00:01
485000 -- [-317.559] (-317.334) (-318.596) (-316.377) * [-316.063] (-316.007) (-318.342) (-320.571) -- 0:00:00
Average standard deviation of split frequencies: 0.010609
485500 -- [-315.499] (-318.308) (-322.005) (-316.578) * (-317.036) (-319.380) [-318.536] (-320.314) -- 0:00:00
486000 -- (-316.270) (-318.145) [-319.801] (-321.942) * (-319.116) (-317.096) (-317.477) [-316.743] -- 0:00:00
486500 -- [-315.530] (-316.023) (-315.786) (-317.062) * (-321.862) (-315.786) (-316.219) [-318.614] -- 0:00:00
487000 -- (-317.445) [-319.440] (-317.990) (-316.575) * [-317.485] (-318.957) (-316.596) (-316.468) -- 0:00:00
487500 -- [-315.527] (-317.144) (-320.153) (-315.327) * (-318.481) [-319.064] (-321.181) (-316.211) -- 0:00:00
488000 -- [-316.710] (-318.305) (-317.071) (-318.362) * (-321.687) [-322.185] (-321.147) (-316.534) -- 0:00:00
488500 -- [-317.289] (-318.572) (-318.592) (-316.438) * [-318.694] (-317.778) (-317.150) (-316.484) -- 0:00:00
489000 -- (-316.939) [-317.108] (-319.187) (-316.017) * [-316.228] (-318.084) (-316.270) (-317.135) -- 0:00:00
489500 -- [-317.438] (-318.937) (-316.995) (-317.294) * [-317.040] (-317.740) (-319.333) (-315.038) -- 0:00:00
490000 -- (-316.932) (-321.822) (-318.505) [-316.232] * [-315.775] (-317.813) (-317.807) (-318.988) -- 0:00:00
Average standard deviation of split frequencies: 0.011229
490500 -- (-317.272) [-316.386] (-318.073) (-317.430) * (-318.592) (-316.916) (-316.935) [-317.756] -- 0:00:00
491000 -- [-317.073] (-319.870) (-317.673) (-316.888) * [-316.028] (-319.599) (-318.365) (-317.008) -- 0:00:00
491500 -- [-315.185] (-315.217) (-316.070) (-316.314) * [-316.171] (-314.899) (-317.686) (-319.335) -- 0:00:00
492000 -- (-317.711) [-318.443] (-321.794) (-315.232) * [-317.081] (-315.582) (-316.650) (-318.167) -- 0:00:00
492500 -- (-316.531) (-318.590) [-317.005] (-320.639) * [-317.064] (-321.099) (-316.759) (-315.697) -- 0:00:00
493000 -- [-317.396] (-319.922) (-316.536) (-317.192) * (-315.617) (-316.153) (-316.756) [-317.019] -- 0:00:00
493500 -- [-316.598] (-315.992) (-317.982) (-316.049) * (-320.188) [-315.676] (-321.205) (-316.192) -- 0:00:00
494000 -- (-316.440) (-320.400) [-315.849] (-315.434) * (-316.610) (-319.318) (-315.238) [-316.514] -- 0:00:00
494500 -- (-316.821) (-322.587) (-316.880) [-316.597] * (-316.908) [-318.594] (-315.206) (-315.772) -- 0:00:00
495000 -- (-317.186) (-320.428) (-316.672) [-318.201] * [-315.280] (-316.042) (-317.065) (-316.640) -- 0:00:00
Average standard deviation of split frequencies: 0.010573
495500 -- (-315.749) (-316.405) (-318.715) [-317.100] * (-315.806) (-316.916) [-318.759] (-317.126) -- 0:00:00
496000 -- [-315.768] (-318.753) (-321.985) (-318.620) * [-315.701] (-315.818) (-315.508) (-317.031) -- 0:00:00
496500 -- [-315.672] (-316.439) (-320.574) (-320.396) * (-318.298) [-316.813] (-319.212) (-321.009) -- 0:00:00
497000 -- (-320.668) (-319.729) [-318.440] (-315.895) * (-315.934) [-316.175] (-317.033) (-315.653) -- 0:00:00
497500 -- (-317.248) (-327.735) (-319.601) [-314.968] * (-315.635) (-318.250) (-319.611) [-316.216] -- 0:00:00
498000 -- (-319.334) (-322.789) [-316.757] (-319.713) * (-315.982) [-317.669] (-317.825) (-316.928) -- 0:00:00
498500 -- [-318.644] (-322.714) (-322.422) (-315.163) * (-315.503) [-324.249] (-317.173) (-320.870) -- 0:00:00
499000 -- (-321.318) (-321.255) [-316.961] (-315.374) * (-315.823) (-318.740) [-316.529] (-321.002) -- 0:00:00
499500 -- (-315.776) (-317.069) (-316.464) [-318.312] * [-316.195] (-316.449) (-318.019) (-317.012) -- 0:00:00
500000 -- (-316.794) [-322.974] (-319.079) (-317.988) * (-315.590) (-319.817) (-320.422) [-315.998] -- 0:00:00
Average standard deviation of split frequencies: 0.010828
Analysis completed in 33 seconds
Analysis used 32.34 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -314.74
Likelihood of best state for "cold" chain of run 2 was -314.74
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
78.7 % ( 73 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
51.2 % ( 40 %) Dirichlet(Pi{all})
50.5 % ( 40 %) Slider(Pi{all})
88.4 % ( 83 %) Multiplier(Alpha{1,2})
87.7 % ( 82 %) Multiplier(Alpha{3})
28.1 % ( 21 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 60 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 88 %) ParsSPR(Tau{all},V{all})
30.9 % ( 27 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
35.5 % ( 33 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
78.0 % ( 78 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
50.2 % ( 56 %) Dirichlet(Pi{all})
50.8 % ( 47 %) Slider(Pi{all})
88.0 % ( 83 %) Multiplier(Alpha{1,2})
88.2 % ( 81 %) Multiplier(Alpha{3})
27.6 % ( 21 %) Slider(Pinvar{all})
98.5 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 85 %) ParsSPR(Tau{all},V{all})
30.7 % ( 28 %) Multiplier(V{all})
97.5 % (100 %) Nodeslider(V{all})
36.2 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.49
2 | 83326 0.82 0.66
3 | 83040 83346 0.83
4 | 83617 83343 83328
Chain swap information for run 2:
1 2 3 4
------------------------------
1 | 0.80 0.64 0.50
2 | 83178 0.82 0.66
3 | 83242 82904 0.84
4 | 83565 83603 83508
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 1250
Summarizing parameters in files /data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -316.34
| 22 1 1 1 |
| 1 2 * 1 2 |
| 21 1 1 |
| 2 11 * * 2 1 2 12 |
| 2 2 1 2 2 1 12 * 1 12 2 2 1 |
|11 *2 1 2 *2 * 2121 1 1 |
| 2* 1 12 1 12 2 1 22 2 22 1 212 222*|
| 1 1 1 2 1 1 |
| 1 1 22 1 2 2 2 21 1 |
| * 1 1 |
|2 1 1 1 1 1 |
| 2 2 1 |
| 2 |
| 2 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -318.64
^ ^
125000 500000
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -316.46 -319.30
2 -316.49 -320.01
--------------------------------------
TOTAL -316.47 -319.72
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882957 0.078944 0.354770 1.406311 0.851771 693.66 722.33 1.001
r(A<->C){all} 0.169197 0.021232 0.000005 0.462508 0.131077 75.05 91.13 1.008
r(A<->G){all} 0.149080 0.015859 0.000035 0.391437 0.115234 80.27 126.90 1.001
r(A<->T){all} 0.174540 0.021005 0.000018 0.445091 0.139390 86.11 89.64 1.000
r(C<->G){all} 0.167789 0.017375 0.000356 0.412330 0.135706 84.09 105.35 1.001
r(C<->T){all} 0.168523 0.022154 0.000044 0.477345 0.126398 72.08 95.43 0.999
r(G<->T){all} 0.170870 0.018035 0.000121 0.443461 0.140111 96.55 102.39 1.003
pi(A){all} 0.221556 0.000686 0.173301 0.273655 0.220827 465.39 579.40 1.000
pi(C){all} 0.267531 0.000834 0.212241 0.327065 0.266050 463.48 607.24 0.999
pi(G){all} 0.283887 0.000830 0.231044 0.343209 0.283098 556.38 653.69 1.000
pi(T){all} 0.227026 0.000748 0.170150 0.276118 0.226673 579.89 614.34 0.999
alpha{1,2} 0.397072 0.235812 0.000124 1.406478 0.232424 327.83 412.79 1.000
alpha{3} 0.455561 0.246717 0.000728 1.432927 0.292828 514.79 632.90 1.000
pinvar{all} 0.992036 0.000097 0.972172 0.999999 0.995388 531.53 641.27 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 1250
Summarizing trees in files "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 2002 trees in 2 files (sampling 1502 of them)
(Each file contained 1001 trees of which 751 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..**..
8 -- ..****
9 -- .*.***
10 -- ....**
11 -- .****.
12 -- .*...*
13 -- ...*.*
14 -- .*..*.
15 -- .***.*
16 -- .*.*..
17 -- .**.**
18 -- ..*.*.
19 -- .**...
20 -- ...**.
21 -- ..*..*
22 -- ..***.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 249 0.165779 0.014123 0.155792 0.175766 2
8 226 0.150466 0.009416 0.143808 0.157124 2
9 226 0.150466 0.011299 0.142477 0.158455 2
10 222 0.147803 0.003766 0.145140 0.150466 2
11 219 0.145806 0.016006 0.134487 0.157124 2
12 218 0.145140 0.005649 0.141145 0.149134 2
13 218 0.145140 0.018831 0.131824 0.158455 2
14 217 0.144474 0.000942 0.143808 0.145140 2
15 213 0.141811 0.006591 0.137150 0.146471 2
16 211 0.140479 0.010357 0.133156 0.147803 2
17 209 0.139148 0.016006 0.127830 0.150466 2
18 206 0.137150 0.005649 0.133156 0.141145 2
19 201 0.133822 0.016006 0.122503 0.145140 2
20 200 0.133156 0.009416 0.126498 0.139814 2
21 197 0.131158 0.010357 0.123835 0.138482 2
22 132 0.087883 0.018831 0.074567 0.101198 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096110 0.008673 0.000023 0.283285 0.069008 1.000 2
length{all}[2] 0.100336 0.009785 0.000031 0.293121 0.069750 1.002 2
length{all}[3] 0.097341 0.008919 0.000012 0.295712 0.067160 0.999 2
length{all}[4] 0.098589 0.010933 0.000006 0.310491 0.066334 0.999 2
length{all}[5] 0.095329 0.008428 0.000224 0.283887 0.066213 1.000 2
length{all}[6] 0.099766 0.009627 0.000002 0.298715 0.068893 0.999 2
length{all}[7] 0.094869 0.008121 0.001312 0.270345 0.062188 1.000 2
length{all}[8] 0.099523 0.008350 0.001192 0.272223 0.077909 0.996 2
length{all}[9] 0.099641 0.009951 0.000432 0.284088 0.076775 1.014 2
length{all}[10] 0.097282 0.009457 0.000456 0.301954 0.063826 1.025 2
length{all}[11] 0.102369 0.011977 0.001154 0.334137 0.064521 0.996 2
length{all}[12] 0.103207 0.010874 0.001047 0.301358 0.078089 0.996 2
length{all}[13] 0.113943 0.013921 0.000584 0.304631 0.082975 1.000 2
length{all}[14] 0.094876 0.007564 0.000427 0.279304 0.069131 0.996 2
length{all}[15] 0.101281 0.010882 0.000527 0.296903 0.071021 0.995 2
length{all}[16] 0.097094 0.011074 0.000601 0.335625 0.062203 1.000 2
length{all}[17] 0.104300 0.010004 0.000227 0.285349 0.073799 1.000 2
length{all}[18] 0.093789 0.008076 0.000017 0.260851 0.067934 0.995 2
length{all}[19] 0.100556 0.008591 0.000424 0.289572 0.072024 1.001 2
length{all}[20] 0.091884 0.008264 0.000623 0.268735 0.064640 0.996 2
length{all}[21] 0.095681 0.009390 0.000400 0.301805 0.067006 0.999 2
length{all}[22] 0.097491 0.008033 0.000041 0.249821 0.067557 0.995 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.010828
Maximum standard deviation of split frequencies = 0.018831
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.025
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 42 trees
90 % credible set contains 89 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 228
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 41 patterns at 76 / 76 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 41 patterns at 76 / 76 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
40016 bytes for conP
3608 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.063881 0.033580 0.054130 0.093059 0.081173 0.073588 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -330.217247
Iterating by ming2
Initial: fx= 330.217247
x= 0.06388 0.03358 0.05413 0.09306 0.08117 0.07359 0.30000 1.30000
1 h-m-p 0.0000 0.0004 183.4036 +++ 315.178823 m 0.0004 14 | 1/8
2 h-m-p 0.0025 0.0501 29.2690 ------------.. | 1/8
3 h-m-p 0.0000 0.0003 168.2563 +++ 307.412126 m 0.0003 47 | 2/8
4 h-m-p 0.0015 0.0584 27.0088 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 150.9310 ++ 304.443956 m 0.0001 78 | 3/8
6 h-m-p 0.0007 0.0719 22.9596 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 130.8319 ++ 302.219917 m 0.0001 109 | 4/8
8 h-m-p 0.0008 0.0952 17.8732 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 106.9261 ++ 301.057656 m 0.0001 140 | 5/8
10 h-m-p 0.0006 0.1421 12.2694 -----------.. | 5/8
11 h-m-p 0.0000 0.0002 75.6309 ++ 300.144125 m 0.0002 171 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 -Y 300.144125 0 0.1000 183 | 6/8
13 h-m-p 0.0160 8.0000 0.0000 +++++ 300.144125 m 8.0000 199 | 6/8
14 h-m-p 0.0160 8.0000 0.0212 -------Y 300.144125 0 0.0000 219 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 ----Y 300.144125 0 0.0000 236 | 6/8
16 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/8
17 h-m-p 0.0160 8.0000 0.0000 +++++ 300.144125 m 8.0000 276 | 6/8
18 h-m-p 0.0012 0.6066 2.8607 +++++ 300.144075 m 0.6066 292 | 7/8
19 h-m-p 0.3413 1.7063 0.8497 ++ 300.143926 m 1.7063 303 | 8/8
20 h-m-p 0.0160 8.0000 0.0000 N 300.143926 0 0.0160 315
Out..
lnL = -300.143926
316 lfun, 316 eigenQcodon, 1896 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.074465 0.061985 0.052046 0.104891 0.032031 0.078523 0.000100 0.826196 0.104780
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 20.722328
np = 9
lnL0 = -326.465658
Iterating by ming2
Initial: fx= 326.465658
x= 0.07447 0.06198 0.05205 0.10489 0.03203 0.07852 0.00011 0.82620 0.10478
1 h-m-p 0.0000 0.0000 146.5022 ++ 326.419165 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0002 444.3556 +++ 314.279230 m 0.0002 27 | 2/9
3 h-m-p 0.0001 0.0003 149.0215 ++ 308.375527 m 0.0003 39 | 3/9
4 h-m-p 0.0001 0.0004 91.8749 ++ 306.171065 m 0.0004 51 | 4/9
5 h-m-p 0.0004 0.0021 29.8417 ++ 304.838269 m 0.0021 63 | 5/9
6 h-m-p 0.0000 0.0000 2422.9133 ++ 302.230709 m 0.0000 75 | 6/9
7 h-m-p 0.0009 0.0047 14.1576 ++ 301.463149 m 0.0047 87 | 7/9
8 h-m-p 0.0001 0.0004 319.3977 ++ 300.144045 m 0.0004 99 | 8/9
9 h-m-p 1.6000 8.0000 0.0001 -------------Y 300.144045 0 0.0000 124 | 8/9
10 h-m-p 0.0160 8.0000 0.0000 ---Y 300.144045 0 0.0001 140
Out..
lnL = -300.144045
141 lfun, 423 eigenQcodon, 1692 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.040800 0.012359 0.067685 0.041135 0.057979 0.058842 0.000100 1.459918 0.538830 0.139480 2.028512
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.291031
np = 11
lnL0 = -318.905379
Iterating by ming2
Initial: fx= 318.905379
x= 0.04080 0.01236 0.06768 0.04113 0.05798 0.05884 0.00011 1.45992 0.53883 0.13948 2.02851
1 h-m-p 0.0000 0.0000 149.4980 ++ 318.748499 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0014 66.3909 ++++ 313.708630 m 0.0014 32 | 2/11
3 h-m-p 0.0003 0.0015 48.4331 ++ 305.279583 m 0.0015 46 | 3/11
4 h-m-p 0.0001 0.0003 13.3630 ++ 305.184481 m 0.0003 60 | 4/11
5 h-m-p 0.0000 0.0000 800.3423 ++ 304.745724 m 0.0000 74 | 5/11
6 h-m-p 0.0018 0.0089 6.6993 ------------.. | 5/11
7 h-m-p 0.0000 0.0003 118.7628 +++ 301.078298 m 0.0003 113 | 6/11
8 h-m-p 0.0160 8.0000 3.0378 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 103.3274 ++ 300.927013 m 0.0000 152 | 7/11
10 h-m-p 0.0141 7.0312 1.6965 -------------.. | 7/11
11 h-m-p 0.0000 0.0001 73.0681 ++ 300.144090 m 0.0001 191 | 8/11
12 h-m-p 0.4065 8.0000 0.0000 +++ 300.144090 m 8.0000 206 | 8/11
13 h-m-p 0.0160 8.0000 0.0070 +++++ 300.144090 m 8.0000 226 | 8/11
14 h-m-p 0.0064 0.1211 8.7159 +++ 300.144083 m 0.1211 244 | 9/11
15 h-m-p 0.3315 8.0000 1.1692 +++ 300.143962 m 8.0000 259 | 9/11
16 h-m-p 1.6000 8.0000 2.1762 ++ 300.143928 m 8.0000 273 | 9/11
17 h-m-p 1.6000 8.0000 1.3012 ++ 300.143926 m 8.0000 287 | 9/11
18 h-m-p 1.6000 8.0000 2.1780 ++ 300.143925 m 8.0000 301 | 9/11
19 h-m-p 1.6000 8.0000 2.3594 ++ 300.143925 m 8.0000 315 | 9/11
20 h-m-p 1.6000 8.0000 0.0000 N 300.143925 0 1.6000 329 | 9/11
21 h-m-p 0.0160 8.0000 0.0000 N 300.143925 0 0.0160 345
Out..
lnL = -300.143925
346 lfun, 1384 eigenQcodon, 6228 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -300.161663 S = -300.144282 -0.006662
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:03
did 20 / 41 patterns 0:03
did 30 / 41 patterns 0:03
did 40 / 41 patterns 0:03
did 41 / 41 patterns 0:03
Time used: 0:03
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038025 0.075676 0.075170 0.014715 0.063957 0.073944 0.000100 0.196209 0.954385 0.000050 0.000109 0.000168
ntime & nrate & np: 6 4 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 41.299489
np = 12
lnL0 = -322.276560
Iterating by ming2
Initial: fx= 322.276560
x= 0.03803 0.07568 0.07517 0.01471 0.06396 0.07394 0.00011 0.19621 0.95438 0.00005 0.00011 0.00017
1 h-m-p 0.0000 0.0000 154.7682 ++ 322.248268 m 0.0000 17 | 1/12
2 h-m-p 0.0000 0.0000 601.0382 ++ 322.222252 m 0.0000 32 | 2/12
3 h-m-p 0.0000 0.0000 228.7331 ++ 322.220001 m 0.0000 47 | 3/12
4 h-m-p 0.0000 0.0000 60.2083 ++ 322.183742 m 0.0000 62 | 4/12
5 h-m-p 0.0000 0.0007 24.6149 +++ 320.914089 m 0.0007 78 | 5/12
6 h-m-p 0.0160 8.0000 2.8592 -------------.. | 5/12
7 h-m-p 0.0000 0.0005 139.4004 +++ 311.794348 m 0.0005 120 | 6/12
8 h-m-p 0.0351 8.0000 1.6165 --------------.. | 6/12
9 h-m-p 0.0000 0.0005 127.8144 +++ 303.050730 m 0.0005 163 | 7/12
10 h-m-p 0.0403 8.0000 1.4332 --------------.. | 7/12
11 h-m-p 0.0000 0.0002 114.8347 +++ 300.406169 m 0.0002 206 | 8/12
12 h-m-p 0.0160 8.0000 1.1854 -------------.. | 8/12
13 h-m-p 0.0000 0.0000 95.1864 ++ 300.192762 m 0.0000 247 | 9/12
14 h-m-p 0.0160 8.0000 0.8393 -------------.. | 9/12
15 h-m-p 0.0000 0.0000 67.4051 ++ 300.143925 m 0.0000 291 | 10/12
16 h-m-p 1.6000 8.0000 0.0000 C 300.143925 0 1.6000 306 | 10/12
17 h-m-p 0.0160 8.0000 0.0000 Y 300.143925 0 0.0160 323
Out..
lnL = -300.143925
324 lfun, 1296 eigenQcodon, 5832 P(t)
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.068907 0.025351 0.088401 0.012737 0.039139 0.027868 0.000100 0.420722 1.055867
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.834243
np = 9
lnL0 = -318.221346
Iterating by ming2
Initial: fx= 318.221346
x= 0.06891 0.02535 0.08840 0.01274 0.03914 0.02787 0.00011 0.42072 1.05587
1 h-m-p 0.0000 0.0000 160.8336 ++ 318.104991 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0073 30.5602 +++++ 312.699638 m 0.0073 29 | 2/9
3 h-m-p 0.0000 0.0002 503.1455 ++ 310.792162 m 0.0002 41 | 3/9
4 h-m-p 0.0001 0.0005 38.5590 ++ 309.917795 m 0.0005 53 | 4/9
5 h-m-p 0.0000 0.0001 792.8266 ++ 308.153960 m 0.0001 65 | 5/9
6 h-m-p 0.0000 0.0001 301.0729 ++ 306.779015 m 0.0001 77 | 6/9
7 h-m-p 0.0016 0.0079 15.4737 ++ 306.095881 m 0.0079 89 | 7/9
8 h-m-p 0.0730 0.7536 1.4218 --------------.. | 7/9
9 h-m-p 0.0000 0.0016 60.0130 ++++ 300.143925 m 0.0016 127 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 ---C 300.143925 0 0.0063 142 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 C 300.143925 0 1.6000 155
Out..
lnL = -300.143925
156 lfun, 1716 eigenQcodon, 9360 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.075066 0.072519 0.039512 0.069567 0.062157 0.013243 0.000100 0.900000 0.830646 1.058962 2.480909
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 11.956649
np = 11
lnL0 = -322.469571
Iterating by ming2
Initial: fx= 322.469571
x= 0.07507 0.07252 0.03951 0.06957 0.06216 0.01324 0.00011 0.90000 0.83065 1.05896 2.48091
1 h-m-p 0.0000 0.0000 150.3435 ++ 322.328936 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0007 97.8175 ++++ 317.177633 m 0.0007 32 | 2/11
3 h-m-p 0.0002 0.0012 63.2994 ++ 308.646992 m 0.0012 46 | 3/11
4 h-m-p 0.0039 0.0456 17.5637 ++ 300.407231 m 0.0456 60 | 4/11
5 h-m-p 0.0000 0.0000 8523.3344 ++ 300.327382 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0001 569.8868 ++ 300.252379 m 0.0001 88 | 6/11
7 h-m-p 0.0000 0.0000 1097.8667 ++ 300.144093 m 0.0000 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0005 ++ 300.144093 m 8.0000 116 | 7/11
9 h-m-p 0.0068 3.3808 0.9184 ---------Y 300.144093 0 0.0000 143 | 7/11
10 h-m-p 0.0160 8.0000 0.0044 +++++ 300.144092 m 8.0000 164 | 7/11
11 h-m-p 0.0637 5.6704 0.5531 -----------Y 300.144092 0 0.0000 193 | 7/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 300.144092 m 8.0000 214 | 7/11
13 h-m-p 0.0023 1.1437 0.4094 ------------.. | 7/11
14 h-m-p 0.0160 8.0000 0.0003 +++++ 300.144091 m 8.0000 263 | 7/11
15 h-m-p 0.0177 6.2067 0.1356 -----------C 300.144091 0 0.0000 292 | 7/11
16 h-m-p 0.0160 8.0000 0.0101 +++++ 300.144057 m 8.0000 313 | 7/11
17 h-m-p 0.4996 5.6505 0.1610 ---------------Y 300.144057 0 0.0000 346 | 7/11
18 h-m-p 0.0160 8.0000 0.0026 +++++ 300.144044 m 8.0000 367 | 7/11
19 h-m-p 0.1810 3.5521 0.1157 -------------N 300.144044 0 0.0000 398 | 7/11
20 h-m-p 0.0160 8.0000 0.0002 +++++ 300.144043 m 8.0000 419 | 7/11
21 h-m-p 0.0179 5.2445 0.0970 -----------Y 300.144043 0 0.0000 448 | 7/11
22 h-m-p 0.0160 8.0000 0.0003 --------N 300.144043 0 0.0000 474 | 7/11
23 h-m-p 0.0160 8.0000 0.0006 +++++ 300.144041 m 8.0000 495 | 7/11
24 h-m-p 0.0279 8.0000 0.1669 ------------C 300.144041 0 0.0000 525 | 7/11
25 h-m-p 0.0160 8.0000 0.0003 -------Y 300.144041 0 0.0000 550 | 7/11
26 h-m-p 0.0160 8.0000 0.0004 +++++ 300.144040 m 8.0000 571 | 7/11
27 h-m-p 0.0160 8.0000 0.2909 -----------C 300.144040 0 0.0000 600 | 7/11
28 h-m-p 0.0160 8.0000 0.0003 +++++ 300.144040 m 8.0000 621 | 7/11
29 h-m-p 0.0160 8.0000 0.3885 -----------C 300.144040 0 0.0000 650 | 7/11
30 h-m-p 0.0160 8.0000 0.0010 --------N 300.144040 0 0.0000 676 | 7/11
31 h-m-p 0.0160 8.0000 0.0001 +++++ 300.144039 m 8.0000 697 | 7/11
32 h-m-p 0.0026 1.0526 0.4298 ----------N 300.144039 0 0.0000 725 | 7/11
33 h-m-p 0.0160 8.0000 0.0002 +++++ 300.144039 m 8.0000 746 | 7/11
34 h-m-p 0.0048 1.3676 0.3282 ------------.. | 7/11
35 h-m-p 0.0160 8.0000 0.0008 +++++ 300.144034 m 8.0000 795 | 7/11
36 h-m-p 0.0770 8.0000 0.0840 --------------.. | 7/11
37 h-m-p 0.0160 8.0000 0.0009 +++++ 300.144027 m 8.0000 846 | 7/11
38 h-m-p 0.0867 8.0000 0.0809 ------------Y 300.144027 0 0.0000 876 | 7/11
39 h-m-p 0.0029 1.4533 0.0398 +++++ 300.143939 m 1.4533 897 | 8/11
40 h-m-p 0.6346 8.0000 0.0306 --------------N 300.143939 0 0.0000 929 | 8/11
41 h-m-p 0.0160 8.0000 0.0005 +++++ 300.143937 m 8.0000 949 | 8/11
42 h-m-p 0.0160 8.0000 0.3087 -------------.. | 8/11
43 h-m-p 0.0160 8.0000 0.0006 +++++ 300.143935 m 8.0000 997 | 8/11
44 h-m-p 0.0160 8.0000 1.3470 -------------.. | 8/11
45 h-m-p 0.0160 8.0000 0.0006 +++++ 300.143932 m 8.0000 1042 | 8/11
46 h-m-p 0.0204 0.1020 0.2005 ++ 300.143926 m 0.1020 1059 | 9/11
47 h-m-p 1.6000 8.0000 0.0000 Y 300.143926 0 1.6000 1076 | 9/11
48 h-m-p 0.0986 8.0000 0.0000 N 300.143926 0 0.0986 1092 | 9/11
49 h-m-p 0.1067 8.0000 0.0000 N 300.143926 0 0.0533 1108 | 9/11
50 h-m-p 0.0942 8.0000 0.0000 ---Y 300.143926 0 0.0004 1127
Out..
lnL = -300.143926
1128 lfun, 13536 eigenQcodon, 74448 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -300.166945 S = -300.144282 -0.009974
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:25
did 20 / 41 patterns 0:25
did 30 / 41 patterns 0:25
did 40 / 41 patterns 0:25
did 41 / 41 patterns 0:25
Time used: 0:25
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=76
NC_011896_1_WP_010908651_1_2103_MLBR_RS09990 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
NC_002677_1_NP_302331_1_1203_ML1972 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
NZ_LVXE01000003_1_WP_010908651_1_1312_A3216_RS02255 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
NZ_LYPH01000033_1_WP_010908651_1_1391_A8144_RS06645 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
NZ_CP029543_1_WP_010908651_1_2123_DIJ64_RS10810 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
NZ_AP014567_1_WP_010908651_1_2184_JK2ML_RS11115 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV
**************************************************
NC_011896_1_WP_010908651_1_2103_MLBR_RS09990 ILLSEVITRSEVTWWVLDLAGPGLKK
NC_002677_1_NP_302331_1_1203_ML1972 ILLSEVITRSEVTWWVLDLAGPGLKK
NZ_LVXE01000003_1_WP_010908651_1_1312_A3216_RS02255 ILLSEVITRSEVTWWVLDLAGPGLKK
NZ_LYPH01000033_1_WP_010908651_1_1391_A8144_RS06645 ILLSEVITRSEVTWWVLDLAGPGLKK
NZ_CP029543_1_WP_010908651_1_2123_DIJ64_RS10810 ILLSEVITRSEVTWWVLDLAGPGLKK
NZ_AP014567_1_WP_010908651_1_2184_JK2ML_RS11115 ILLSEVITRSEVTWWVLDLAGPGLKK
**************************
>NC_011896_1_WP_010908651_1_2103_MLBR_RS09990 TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT CGATTTAGCCGGCCCAGGCCTCAAAAAA >NC_002677_1_NP_302331_1_1203_ML1972 TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT CGATTTAGCCGGCCCAGGCCTCAAAAAA >NZ_LVXE01000003_1_WP_010908651_1_1312_A3216_RS02255 TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT CGATTTAGCCGGCCCAGGCCTCAAAAAA >NZ_LYPH01000033_1_WP_010908651_1_1391_A8144_RS06645 TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT CGATTTAGCCGGCCCAGGCCTCAAAAAA >NZ_CP029543_1_WP_010908651_1_2123_DIJ64_RS10810 TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT CGATTTAGCCGGCCCAGGCCTCAAAAAA >NZ_AP014567_1_WP_010908651_1_2184_JK2ML_RS11115 TTGCCGAGCAGGAACCGCGATGCCAATGTGGTTGACCTGACCGACTCGCA CTCCCGCGAAGCGTTCTTCAACGAAGCACTGGGCGGCGCTACGAAAGTGT TGGTGATGATCACCGAGGGTCTGGTTATGTACCTCGATGACCGTGACGTC ATCCTTTTATCTGAGGTGATTACACGATCCGAAGTCACCTGGTGGGTGCT CGATTTAGCCGGCCCAGGCCTCAAAAAA
>NC_011896_1_WP_010908651_1_2103_MLBR_RS09990 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV ILLSEVITRSEVTWWVLDLAGPGLKK >NC_002677_1_NP_302331_1_1203_ML1972 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV ILLSEVITRSEVTWWVLDLAGPGLKK >NZ_LVXE01000003_1_WP_010908651_1_1312_A3216_RS02255 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV ILLSEVITRSEVTWWVLDLAGPGLKK >NZ_LYPH01000033_1_WP_010908651_1_1391_A8144_RS06645 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV ILLSEVITRSEVTWWVLDLAGPGLKK >NZ_CP029543_1_WP_010908651_1_2123_DIJ64_RS10810 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV ILLSEVITRSEVTWWVLDLAGPGLKK >NZ_AP014567_1_WP_010908651_1_2184_JK2ML_RS11115 LPSRNRDANVVDLTDSHSREAFFNEALGGATKVLVMITEGLVMYLDDRDV ILLSEVITRSEVTWWVLDLAGPGLKK
#NEXUS
[ID: 5966703673]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908651_1_2103_MLBR_RS09990
NC_002677_1_NP_302331_1_1203_ML1972
NZ_LVXE01000003_1_WP_010908651_1_1312_A3216_RS02255
NZ_LYPH01000033_1_WP_010908651_1_1391_A8144_RS06645
NZ_CP029543_1_WP_010908651_1_2123_DIJ64_RS10810
NZ_AP014567_1_WP_010908651_1_2184_JK2ML_RS11115
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908651_1_2103_MLBR_RS09990,
2 NC_002677_1_NP_302331_1_1203_ML1972,
3 NZ_LVXE01000003_1_WP_010908651_1_1312_A3216_RS02255,
4 NZ_LYPH01000033_1_WP_010908651_1_1391_A8144_RS06645,
5 NZ_CP029543_1_WP_010908651_1_2123_DIJ64_RS10810,
6 NZ_AP014567_1_WP_010908651_1_2184_JK2ML_RS11115
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06900786,2:0.06974998,3:0.06715968,4:0.06633397,5:0.06621295,6:0.068893);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06900786,2:0.06974998,3:0.06715968,4:0.06633397,5:0.06621295,6:0.068893);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -316.46 -319.30
2 -316.49 -320.01
--------------------------------------
TOTAL -316.47 -319.72
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML1972/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882957 0.078944 0.354770 1.406311 0.851771 693.66 722.33 1.001
r(A<->C){all} 0.169197 0.021232 0.000005 0.462508 0.131077 75.05 91.13 1.008
r(A<->G){all} 0.149080 0.015859 0.000035 0.391437 0.115234 80.27 126.90 1.001
r(A<->T){all} 0.174540 0.021005 0.000018 0.445091 0.139390 86.11 89.64 1.000
r(C<->G){all} 0.167789 0.017375 0.000356 0.412330 0.135706 84.09 105.35 1.001
r(C<->T){all} 0.168523 0.022154 0.000044 0.477345 0.126398 72.08 95.43 0.999
r(G<->T){all} 0.170870 0.018035 0.000121 0.443461 0.140111 96.55 102.39 1.003
pi(A){all} 0.221556 0.000686 0.173301 0.273655 0.220827 465.39 579.40 1.000
pi(C){all} 0.267531 0.000834 0.212241 0.327065 0.266050 463.48 607.24 0.999
pi(G){all} 0.283887 0.000830 0.231044 0.343209 0.283098 556.38 653.69 1.000
pi(T){all} 0.227026 0.000748 0.170150 0.276118 0.226673 579.89 614.34 0.999
alpha{1,2} 0.397072 0.235812 0.000124 1.406478 0.232424 327.83 412.79 1.000
alpha{3} 0.455561 0.246717 0.000728 1.432927 0.292828 514.79 632.90 1.000
pinvar{all} 0.992036 0.000097 0.972172 0.999999 0.995388 531.53 641.27 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML1972/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 76
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 2 2 2 2 2 2 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 2 2 2 2 2 2 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 3 3 3 3 3 3 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 3 3 3 3 3 3 | CCG 1 1 1 1 1 1 | CAG 0 0 0 0 0 0 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 2 2 2 2 2 2 | ACC 3 3 3 3 3 3 | AAC 2 2 2 2 2 2 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 1 1 1 1 1 1 | AAG 0 0 0 0 0 0 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 1 1 1 1 1 1 | Asp GAT 3 3 3 3 3 3 | Gly GGT 1 1 1 1 1 1
GTC 2 2 2 2 2 2 | GCC 2 2 2 2 2 2 | GAC 4 4 4 4 4 4 | GGC 4 4 4 4 4 4
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 3 3 3 3 3 3 | GGA 0 0 0 0 0 0
GTG 5 5 5 5 5 5 | GCG 1 1 1 1 1 1 | GAG 2 2 2 2 2 2 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908651_1_2103_MLBR_RS09990
position 1: T:0.17105 C:0.18421 A:0.23684 G:0.40789
position 2: T:0.35526 C:0.21053 A:0.26316 G:0.17105
position 3: T:0.15789 C:0.40789 A:0.15789 G:0.27632
Average T:0.22807 C:0.26754 A:0.21930 G:0.28509
#2: NC_002677_1_NP_302331_1_1203_ML1972
position 1: T:0.17105 C:0.18421 A:0.23684 G:0.40789
position 2: T:0.35526 C:0.21053 A:0.26316 G:0.17105
position 3: T:0.15789 C:0.40789 A:0.15789 G:0.27632
Average T:0.22807 C:0.26754 A:0.21930 G:0.28509
#3: NZ_LVXE01000003_1_WP_010908651_1_1312_A3216_RS02255
position 1: T:0.17105 C:0.18421 A:0.23684 G:0.40789
position 2: T:0.35526 C:0.21053 A:0.26316 G:0.17105
position 3: T:0.15789 C:0.40789 A:0.15789 G:0.27632
Average T:0.22807 C:0.26754 A:0.21930 G:0.28509
#4: NZ_LYPH01000033_1_WP_010908651_1_1391_A8144_RS06645
position 1: T:0.17105 C:0.18421 A:0.23684 G:0.40789
position 2: T:0.35526 C:0.21053 A:0.26316 G:0.17105
position 3: T:0.15789 C:0.40789 A:0.15789 G:0.27632
Average T:0.22807 C:0.26754 A:0.21930 G:0.28509
#5: NZ_CP029543_1_WP_010908651_1_2123_DIJ64_RS10810
position 1: T:0.17105 C:0.18421 A:0.23684 G:0.40789
position 2: T:0.35526 C:0.21053 A:0.26316 G:0.17105
position 3: T:0.15789 C:0.40789 A:0.15789 G:0.27632
Average T:0.22807 C:0.26754 A:0.21930 G:0.28509
#6: NZ_AP014567_1_WP_010908651_1_2184_JK2ML_RS11115
position 1: T:0.17105 C:0.18421 A:0.23684 G:0.40789
position 2: T:0.35526 C:0.21053 A:0.26316 G:0.17105
position 3: T:0.15789 C:0.40789 A:0.15789 G:0.27632
Average T:0.22807 C:0.26754 A:0.21930 G:0.28509
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0
TTC 12 | TCC 12 | TAC 6 | TGC 0
Leu L TTA 12 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 6 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 6
CTC 18 | CCC 0 | CAC 6 | CGC 12
CTA 0 | CCA 6 | Gln Q CAA 0 | CGA 6
CTG 18 | CCG 6 | CAG 0 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 0
ATC 12 | ACC 18 | AAC 12 | AGC 6
ATA 0 | ACA 6 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 12 | ACG 6 | AAG 0 | AGG 6
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 6 | Asp D GAT 18 | Gly G GGT 6
GTC 12 | GCC 12 | GAC 24 | GGC 24
GTA 0 | GCA 6 | Glu E GAA 18 | GGA 0
GTG 30 | GCG 6 | GAG 12 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17105 C:0.18421 A:0.23684 G:0.40789
position 2: T:0.35526 C:0.21053 A:0.26316 G:0.17105
position 3: T:0.15789 C:0.40789 A:0.15789 G:0.27632
Average T:0.22807 C:0.26754 A:0.21930 G:0.28509
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -300.143926 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908651_1_2103_MLBR_RS09990: 0.000004, NC_002677_1_NP_302331_1_1203_ML1972: 0.000004, NZ_LVXE01000003_1_WP_010908651_1_1312_A3216_RS02255: 0.000004, NZ_LYPH01000033_1_WP_010908651_1_1391_A8144_RS06645: 0.000004, NZ_CP029543_1_WP_010908651_1_2123_DIJ64_RS10810: 0.000004, NZ_AP014567_1_WP_010908651_1_2184_JK2ML_RS11115: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 180.7 47.3 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 180.7 47.3 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 180.7 47.3 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 180.7 47.3 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 180.7 47.3 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 180.7 47.3 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -300.144045 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.754841 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908651_1_2103_MLBR_RS09990: 0.000004, NC_002677_1_NP_302331_1_1203_ML1972: 0.000004, NZ_LVXE01000003_1_WP_010908651_1_1312_A3216_RS02255: 0.000004, NZ_LYPH01000033_1_WP_010908651_1_1391_A8144_RS06645: 0.000004, NZ_CP029543_1_WP_010908651_1_2123_DIJ64_RS10810: 0.000004, NZ_AP014567_1_WP_010908651_1_2184_JK2ML_RS11115: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.75484 0.24516
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 180.7 47.3 0.2452 0.0000 0.0000 0.0 0.0
7..2 0.000 180.7 47.3 0.2452 0.0000 0.0000 0.0 0.0
7..3 0.000 180.7 47.3 0.2452 0.0000 0.0000 0.0 0.0
7..4 0.000 180.7 47.3 0.2452 0.0000 0.0000 0.0 0.0
7..5 0.000 180.7 47.3 0.2452 0.0000 0.0000 0.0 0.0
7..6 0.000 180.7 47.3 0.2452 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -300.143925 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999999 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908651_1_2103_MLBR_RS09990: 0.000004, NC_002677_1_NP_302331_1_1203_ML1972: 0.000004, NZ_LVXE01000003_1_WP_010908651_1_1312_A3216_RS02255: 0.000004, NZ_LYPH01000033_1_WP_010908651_1_1391_A8144_RS06645: 0.000004, NZ_CP029543_1_WP_010908651_1_2123_DIJ64_RS10810: 0.000004, NZ_AP014567_1_WP_010908651_1_2184_JK2ML_RS11115: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908651_1_2103_MLBR_RS09990)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 12): -300.143925 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.252967 0.207650 0.000001 0.000001 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908651_1_2103_MLBR_RS09990: 0.000004, NC_002677_1_NP_302331_1_1203_ML1972: 0.000004, NZ_LVXE01000003_1_WP_010908651_1_1312_A3216_RS02255: 0.000004, NZ_LYPH01000033_1_WP_010908651_1_1391_A8144_RS06645: 0.000004, NZ_CP029543_1_WP_010908651_1_2123_DIJ64_RS10810: 0.000004, NZ_AP014567_1_WP_010908651_1_2184_JK2ML_RS11115: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.25297 0.20765 0.53938
w: 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -300.143925 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.912772
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908651_1_2103_MLBR_RS09990: 0.000004, NC_002677_1_NP_302331_1_1203_ML1972: 0.000004, NZ_LVXE01000003_1_WP_010908651_1_1312_A3216_RS02255: 0.000004, NZ_LYPH01000033_1_WP_010908651_1_1391_A8144_RS06645: 0.000004, NZ_CP029543_1_WP_010908651_1_2123_DIJ64_RS10810: 0.000004, NZ_AP014567_1_WP_010908651_1_2184_JK2ML_RS11115: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 0.91277
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00004
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -300.143926 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.573675 2.883301
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908651_1_2103_MLBR_RS09990: 0.000004, NC_002677_1_NP_302331_1_1203_ML1972: 0.000004, NZ_LVXE01000003_1_WP_010908651_1_1312_A3216_RS02255: 0.000004, NZ_LYPH01000033_1_WP_010908651_1_1391_A8144_RS06645: 0.000004, NZ_CP029543_1_WP_010908651_1_2123_DIJ64_RS10810: 0.000004, NZ_AP014567_1_WP_010908651_1_2184_JK2ML_RS11115: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.57367
(p1 = 0.00001) w = 2.88330
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.88330
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 180.7 47.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908651_1_2103_MLBR_RS09990)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.099 0.099 0.099 0.100 0.100 0.101 0.101 0.101 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Time used: 0:25
Model 1: NearlyNeutral -300.144045 Model 2: PositiveSelection -300.143925 Model 0: one-ratio -300.143926 Model 3: discrete -300.143925 Model 7: beta -300.143925 Model 8: beta&w>1 -300.143926 Model 0 vs 1 2.3799999996754195E-4 Model 2 vs 1 2.3999999996249244E-4 Model 8 vs 7 1.9999999949504854E-6
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
