--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:41:48 GMT 2020
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=500000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=1250
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=1250
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/8res/ML1982/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -424.32 -429.28
2 -424.38 -427.62
--------------------------------------
TOTAL -424.35 -428.76
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898199 0.089585 0.351766 1.488975 0.863126 673.98 712.49 1.000
r(A<->C){all} 0.173933 0.020398 0.000285 0.461230 0.140122 81.59 105.71 1.004
r(A<->G){all} 0.181600 0.022725 0.000124 0.484576 0.141396 63.97 72.56 1.009
r(A<->T){all} 0.147197 0.015890 0.000009 0.390259 0.114140 135.36 180.11 1.003
r(C<->G){all} 0.168368 0.021966 0.000062 0.487042 0.126095 95.66 95.81 0.999
r(C<->T){all} 0.179213 0.019974 0.000096 0.461030 0.146894 80.11 103.00 1.008
r(G<->T){all} 0.149689 0.014091 0.000028 0.371584 0.121961 98.53 137.42 0.999
pi(A){all} 0.215302 0.000562 0.169111 0.260541 0.215291 637.20 653.31 1.000
pi(C){all} 0.287956 0.000678 0.238704 0.339951 0.287796 615.48 683.24 1.000
pi(G){all} 0.254664 0.000630 0.210670 0.307493 0.253785 624.75 652.86 1.000
pi(T){all} 0.242078 0.000570 0.199446 0.292984 0.241857 638.41 672.22 0.999
alpha{1,2} 0.411463 0.239646 0.000890 1.434141 0.244014 379.15 466.78 1.000
alpha{3} 0.446455 0.223670 0.001055 1.462034 0.299336 541.15 561.42 0.999
pinvar{all} 0.994557 0.000039 0.982302 0.999998 0.996584 422.19 540.62 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -411.331006
Model 2: PositiveSelection -411.331128
Model 0: one-ratio -411.331187
Model 3: discrete -411.33098
Model 7: beta -411.33098
Model 8: beta&w>1 -411.33098
Model 0 vs 1 3.6199999999553256E-4
Model 2 vs 1 2.439999999523934E-4
Model 8 vs 7 0.0
>C1
MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
AL
>C2
MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
AL
>C3
MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
AL
>C4
MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
AL
>C5
MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
AL
>C6
MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
AL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=102
C1 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
C2 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
C3 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
C4 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
C5 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
C6 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
**************************************************
C1 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
C2 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
C3 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
C4 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
C5 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
C6 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
**************************************************
C1 AL
C2 AL
C3 AL
C4 AL
C5 AL
C6 AL
**
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3060]--->[3060]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.454 Mb, Max= 30.627 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
C2 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
C3 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
C4 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
C5 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
C6 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
**************************************************
C1 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
C2 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
C3 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
C4 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
C5 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
C6 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
**************************************************
C1 AL
C2 AL
C3 AL
C4 AL
C5 AL
C6 AL
**
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC
C2 ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC
C3 ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC
C4 ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC
C5 ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC
C6 ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC
**************************************************
C1 AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA
C2 AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA
C3 AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA
C4 AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA
C5 AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA
C6 AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA
**************************************************
C1 CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG
C2 CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG
C3 CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG
C4 CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG
C5 CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG
C6 CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG
**************************************************
C1 TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA
C2 TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA
C3 TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA
C4 TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA
C5 TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA
C6 TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA
**************************************************
C1 TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC
C2 TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC
C3 TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC
C4 TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC
C5 TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC
C6 TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC
**************************************************
C1 TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG
C2 TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG
C3 TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG
C4 TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG
C5 TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG
C6 TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG
**************************************************
C1 GCACTC
C2 GCACTC
C3 GCACTC
C4 GCACTC
C5 GCACTC
C6 GCACTC
******
>C1
ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC
AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA
CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG
TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA
TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC
TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG
GCACTC
>C2
ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC
AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA
CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG
TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA
TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC
TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG
GCACTC
>C3
ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC
AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA
CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG
TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA
TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC
TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG
GCACTC
>C4
ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC
AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA
CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG
TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA
TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC
TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG
GCACTC
>C5
ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC
AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA
CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG
TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA
TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC
TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG
GCACTC
>C6
ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC
AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA
CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG
TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA
TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC
TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG
GCACTC
>C1
MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
AL
>C2
MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
AL
>C3
MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
AL
>C4
MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
AL
>C5
MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
AL
>C6
MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
AL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 306 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855258
Setting output file names to "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 925220270
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 500000
Running Markov chain
MCMC stamp = 5225382452
Seed = 1956344523
Swapseed = 1579855258
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -684.842670 -- -24.965149
Chain 2 -- -684.842566 -- -24.965149
Chain 3 -- -684.842566 -- -24.965149
Chain 4 -- -684.842670 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -684.842631 -- -24.965149
Chain 2 -- -684.842670 -- -24.965149
Chain 3 -- -684.842631 -- -24.965149
Chain 4 -- -684.842670 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (500000 generations requested):
0 -- [-684.843] (-684.843) (-684.843) (-684.843) * [-684.843] (-684.843) (-684.843) (-684.843)
500 -- [-433.302] (-432.899) (-439.984) (-427.665) * (-429.927) (-430.884) (-430.825) [-433.610] -- 0:00:00
1000 -- [-435.075] (-435.798) (-434.542) (-434.504) * (-431.322) (-434.588) [-432.758] (-431.263) -- 0:00:00
1500 -- [-430.639] (-432.174) (-438.283) (-437.015) * [-431.763] (-437.189) (-432.353) (-434.176) -- 0:00:00
2000 -- (-432.416) [-441.953] (-440.919) (-432.817) * (-434.145) (-433.504) (-438.112) [-427.852] -- 0:00:00
2500 -- (-432.329) (-440.711) (-440.219) [-427.974] * (-437.444) [-429.778] (-434.797) (-434.584) -- 0:00:00
3000 -- (-436.969) (-428.106) (-431.268) [-437.670] * (-434.569) (-444.345) (-440.867) [-429.921] -- 0:00:00
3500 -- [-431.838] (-431.724) (-440.255) (-431.823) * (-442.845) [-436.030] (-434.060) (-436.945) -- 0:00:00
4000 -- (-448.584) (-434.156) (-437.008) [-435.051] * (-434.598) (-438.999) [-433.220] (-439.074) -- 0:00:00
4500 -- (-434.031) (-441.534) (-432.766) [-428.459] * (-436.529) (-434.548) [-429.370] (-434.287) -- 0:00:00
5000 -- [-433.205] (-435.721) (-437.112) (-433.147) * (-438.226) (-435.280) (-436.679) [-432.038] -- 0:00:00
Average standard deviation of split frequencies: 0.107137
5500 -- (-434.441) (-433.065) [-435.983] (-431.008) * (-441.888) (-438.030) (-438.756) [-435.776] -- 0:00:00
6000 -- (-438.082) [-428.132] (-442.752) (-441.766) * (-431.780) (-434.344) (-432.319) [-434.413] -- 0:01:22
6500 -- [-428.736] (-430.000) (-434.902) (-437.033) * (-436.454) (-433.951) (-436.323) [-435.206] -- 0:01:15
7000 -- (-429.916) (-430.313) (-435.020) [-430.165] * (-436.603) [-429.508] (-437.694) (-442.506) -- 0:01:10
7500 -- (-442.179) [-442.205] (-436.045) (-434.657) * (-440.427) (-443.179) [-428.887] (-431.677) -- 0:01:05
8000 -- (-428.860) [-434.899] (-436.690) (-441.287) * (-434.288) (-435.612) (-429.918) [-434.721] -- 0:01:01
8500 -- (-434.381) (-435.239) (-435.052) [-433.301] * [-434.251] (-429.320) (-429.197) (-437.396) -- 0:00:57
9000 -- (-435.744) (-435.906) [-432.149] (-437.421) * [-432.352] (-435.000) (-433.563) (-439.771) -- 0:00:54
9500 -- (-430.886) (-442.418) (-430.581) [-432.359] * [-430.275] (-437.243) (-434.182) (-432.321) -- 0:00:51
10000 -- (-430.094) [-433.774] (-436.641) (-433.111) * [-432.930] (-438.696) (-435.899) (-431.562) -- 0:00:49
Average standard deviation of split frequencies: 0.075761
10500 -- (-437.268) (-437.914) [-435.049] (-434.592) * (-434.426) (-439.376) [-429.439] (-436.952) -- 0:00:46
11000 -- (-439.391) [-430.755] (-432.069) (-435.943) * [-435.428] (-439.065) (-439.524) (-439.623) -- 0:00:44
11500 -- (-425.981) (-431.916) [-434.583] (-434.417) * (-431.207) (-435.076) (-440.234) [-429.979] -- 0:00:42
12000 -- (-429.990) (-438.243) (-438.728) [-431.193] * (-431.225) [-439.276] (-432.834) (-438.660) -- 0:00:40
12500 -- (-424.405) [-431.406] (-437.896) (-436.927) * [-435.795] (-433.593) (-430.645) (-434.054) -- 0:00:39
13000 -- [-424.393] (-431.735) (-435.509) (-432.756) * (-435.592) (-427.013) (-443.897) [-438.577] -- 0:00:37
13500 -- (-424.395) [-433.052] (-442.714) (-436.995) * (-432.310) [-435.028] (-431.492) (-451.250) -- 0:00:36
14000 -- (-425.493) (-433.295) [-439.483] (-439.883) * (-433.555) [-434.766] (-433.498) (-450.132) -- 0:00:34
14500 -- (-427.498) (-436.006) [-425.087] (-435.524) * [-429.341] (-437.378) (-438.117) (-433.668) -- 0:00:33
15000 -- (-425.128) (-434.859) [-422.711] (-435.901) * (-440.193) [-435.584] (-434.745) (-424.729) -- 0:00:32
Average standard deviation of split frequencies: 0.039861
15500 -- (-426.689) (-433.479) (-423.821) [-429.685] * (-434.762) (-434.576) [-436.164] (-430.828) -- 0:00:31
16000 -- (-427.010) [-434.331] (-423.811) (-428.623) * (-439.460) (-433.634) [-438.250] (-425.951) -- 0:00:30
16500 -- (-423.930) [-434.818] (-424.168) (-426.834) * (-434.955) [-430.323] (-431.176) (-427.249) -- 0:00:29
17000 -- (-423.385) [-431.185] (-425.431) (-433.848) * (-431.329) (-436.738) (-434.026) [-424.830] -- 0:00:28
17500 -- (-427.945) (-433.586) [-424.290] (-428.183) * [-435.087] (-437.382) (-436.492) (-425.891) -- 0:00:27
18000 -- (-424.067) [-434.334] (-423.476) (-440.526) * (-428.774) (-434.398) [-440.130] (-426.406) -- 0:00:26
18500 -- [-424.854] (-439.968) (-424.509) (-429.259) * (-431.904) [-428.937] (-431.730) (-429.121) -- 0:00:26
19000 -- (-424.128) (-435.835) (-423.381) [-436.231] * (-437.183) (-437.058) [-434.957] (-422.983) -- 0:00:25
19500 -- (-424.625) (-431.339) (-427.741) [-435.316] * (-432.068) [-430.652] (-438.814) (-423.452) -- 0:00:49
20000 -- (-426.706) (-431.200) (-425.498) [-436.499] * (-439.878) (-432.752) [-437.592] (-423.697) -- 0:00:48
Average standard deviation of split frequencies: 0.040551
20500 -- (-429.620) [-431.080] (-425.283) (-443.098) * [-432.241] (-432.856) (-430.437) (-426.073) -- 0:00:46
21000 -- (-428.520) (-438.225) [-425.711] (-434.948) * [-431.067] (-434.709) (-440.567) (-425.765) -- 0:00:45
21500 -- (-424.853) (-433.753) (-425.149) [-430.427] * (-429.209) (-430.635) [-434.504] (-424.491) -- 0:00:44
22000 -- (-426.398) [-431.836] (-423.947) (-439.951) * (-429.547) (-431.195) (-432.699) [-425.119] -- 0:00:43
22500 -- (-424.550) [-433.021] (-428.408) (-440.712) * (-434.040) (-438.819) (-435.878) [-425.971] -- 0:00:42
23000 -- (-424.433) (-440.047) (-425.834) [-425.579] * (-432.761) (-437.692) [-428.287] (-426.470) -- 0:00:41
23500 -- (-430.686) (-431.121) [-423.550] (-429.108) * (-437.170) [-432.912] (-440.407) (-424.246) -- 0:00:40
24000 -- (-426.132) (-432.770) [-423.782] (-426.514) * (-438.048) [-430.242] (-434.145) (-423.759) -- 0:00:39
24500 -- (-425.891) (-434.911) (-426.119) [-427.659] * (-434.078) (-434.596) (-432.288) [-423.094] -- 0:00:38
25000 -- [-424.381] (-430.791) (-423.865) (-426.284) * (-432.031) (-437.676) [-434.452] (-424.593) -- 0:00:38
Average standard deviation of split frequencies: 0.037125
25500 -- (-424.958) (-430.694) [-423.670] (-425.549) * (-431.006) [-431.118] (-445.513) (-423.241) -- 0:00:37
26000 -- (-423.178) [-429.888] (-426.106) (-425.319) * [-433.865] (-444.399) (-433.683) (-422.668) -- 0:00:36
26500 -- (-426.273) [-429.086] (-424.808) (-428.208) * [-427.246] (-440.896) (-430.949) (-424.462) -- 0:00:35
27000 -- [-422.690] (-435.442) (-425.694) (-427.364) * (-432.599) [-436.541] (-432.314) (-424.952) -- 0:00:35
27500 -- (-424.274) [-437.881] (-424.542) (-424.404) * (-434.478) [-436.051] (-433.271) (-425.116) -- 0:00:34
28000 -- (-424.217) (-431.315) [-424.708] (-423.958) * (-432.206) (-443.826) [-428.490] (-425.791) -- 0:00:33
28500 -- (-425.498) (-431.772) [-426.238] (-429.062) * (-431.138) [-440.393] (-428.258) (-424.765) -- 0:00:33
29000 -- (-424.506) (-438.340) (-425.544) [-425.037] * (-436.247) (-433.862) (-427.451) [-423.716] -- 0:00:32
29500 -- (-423.985) [-430.209] (-424.263) (-425.121) * (-443.565) (-441.624) (-438.310) [-424.482] -- 0:00:31
30000 -- (-423.424) [-429.385] (-427.817) (-423.886) * [-440.271] (-432.239) (-432.582) (-425.515) -- 0:00:31
Average standard deviation of split frequencies: 0.032452
30500 -- [-423.684] (-430.168) (-434.392) (-428.140) * (-433.720) [-435.159] (-431.532) (-431.448) -- 0:00:30
31000 -- (-423.332) [-433.948] (-433.352) (-424.487) * [-427.125] (-439.636) (-432.407) (-426.953) -- 0:00:30
31500 -- [-425.749] (-439.817) (-424.614) (-423.212) * (-427.831) (-440.640) [-429.285] (-426.574) -- 0:00:29
32000 -- (-426.354) (-433.265) [-424.188] (-423.773) * (-425.340) [-429.308] (-441.459) (-424.138) -- 0:00:29
32500 -- (-429.183) (-434.705) [-423.365] (-425.377) * (-424.667) [-434.734] (-441.386) (-423.940) -- 0:00:28
33000 -- (-427.608) [-435.617] (-424.613) (-426.405) * (-427.749) (-436.649) (-438.686) [-424.687] -- 0:00:28
33500 -- (-426.914) (-431.414) (-424.239) [-424.795] * [-428.058] (-433.093) (-441.151) (-425.500) -- 0:00:27
34000 -- (-424.694) (-434.848) (-423.367) [-425.093] * [-425.736] (-437.223) (-431.829) (-423.482) -- 0:00:41
34500 -- (-424.391) [-434.640] (-424.572) (-424.968) * (-423.273) (-436.846) [-432.534] (-426.340) -- 0:00:40
35000 -- (-428.944) (-441.219) (-426.577) [-422.908] * [-424.065] (-428.372) (-436.014) (-428.414) -- 0:00:39
Average standard deviation of split frequencies: 0.039973
35500 -- [-428.617] (-448.155) (-425.217) (-422.892) * (-424.647) (-439.427) (-446.388) [-424.896] -- 0:00:39
36000 -- (-426.678) (-436.699) [-425.659] (-423.242) * [-428.167] (-432.754) (-444.542) (-425.290) -- 0:00:38
36500 -- (-426.762) [-431.722] (-426.164) (-423.577) * (-423.979) (-446.002) (-427.739) [-424.845] -- 0:00:38
37000 -- [-426.000] (-434.524) (-425.953) (-424.323) * [-423.665] (-435.356) (-423.699) (-426.863) -- 0:00:37
37500 -- (-427.319) [-434.552] (-426.607) (-424.333) * (-425.280) (-438.281) (-423.943) [-425.375] -- 0:00:37
38000 -- (-428.331) (-448.332) [-424.355] (-422.717) * [-425.516] (-461.282) (-425.230) (-425.593) -- 0:00:36
38500 -- [-423.483] (-444.219) (-423.767) (-423.056) * [-426.558] (-439.951) (-424.735) (-423.754) -- 0:00:35
39000 -- [-423.621] (-442.359) (-427.187) (-423.751) * (-426.926) (-435.047) (-425.290) [-424.833] -- 0:00:35
39500 -- (-426.601) (-438.422) [-423.410] (-424.256) * (-424.908) (-438.965) [-427.241] (-424.452) -- 0:00:34
40000 -- [-425.756] (-432.981) (-423.994) (-426.615) * (-425.298) [-434.933] (-425.571) (-425.325) -- 0:00:34
Average standard deviation of split frequencies: 0.034196
40500 -- [-425.073] (-425.002) (-426.159) (-423.293) * (-424.007) [-432.834] (-426.006) (-424.179) -- 0:00:34
41000 -- (-428.842) (-424.993) [-426.252] (-424.355) * (-422.719) (-431.648) [-423.312] (-424.231) -- 0:00:33
41500 -- (-424.835) (-425.421) (-427.653) [-424.075] * [-423.772] (-442.514) (-423.248) (-426.263) -- 0:00:33
42000 -- [-424.899] (-429.038) (-423.503) (-424.063) * (-425.119) [-437.939] (-426.491) (-425.586) -- 0:00:32
42500 -- (-423.858) [-428.406] (-424.192) (-423.762) * (-428.409) (-444.634) (-423.772) [-423.147] -- 0:00:32
43000 -- (-427.642) [-424.116] (-423.620) (-425.627) * [-424.773] (-439.439) (-424.820) (-427.508) -- 0:00:31
43500 -- (-423.314) (-426.396) (-426.483) [-423.951] * [-425.760] (-442.581) (-424.950) (-423.821) -- 0:00:31
44000 -- (-426.502) [-425.770] (-424.278) (-428.278) * (-422.864) (-439.316) [-423.773] (-424.382) -- 0:00:31
44500 -- [-422.858] (-424.742) (-424.214) (-429.716) * (-426.278) (-441.497) [-424.535] (-423.796) -- 0:00:30
45000 -- [-423.771] (-423.994) (-424.911) (-424.834) * (-423.248) (-439.084) (-426.013) [-425.782] -- 0:00:30
Average standard deviation of split frequencies: 0.034648
45500 -- (-423.346) [-424.867] (-423.877) (-423.473) * (-424.725) [-427.460] (-426.483) (-428.618) -- 0:00:29
46000 -- (-424.953) (-425.150) [-426.584] (-427.206) * [-424.046] (-429.408) (-425.740) (-423.134) -- 0:00:29
46500 -- (-427.592) (-424.470) [-426.550] (-427.577) * (-427.286) (-425.100) (-424.829) [-424.381] -- 0:00:29
47000 -- (-425.479) (-425.188) [-423.697] (-427.437) * (-425.776) [-424.628] (-423.187) (-425.697) -- 0:00:28
47500 -- (-426.716) [-425.640] (-423.344) (-427.539) * (-423.947) (-423.951) [-423.699] (-425.024) -- 0:00:28
48000 -- [-424.872] (-423.999) (-422.899) (-425.053) * (-425.892) (-423.736) (-423.587) [-424.815] -- 0:00:28
48500 -- (-425.553) (-425.939) [-425.757] (-427.446) * (-422.770) (-425.618) (-424.279) [-425.280] -- 0:00:27
49000 -- (-424.763) (-423.814) (-424.116) [-423.884] * (-426.627) (-425.872) (-423.361) [-424.927] -- 0:00:27
49500 -- (-424.530) (-426.912) [-422.973] (-429.934) * [-426.289] (-423.390) (-423.598) (-423.596) -- 0:00:27
50000 -- [-424.498] (-423.477) (-427.958) (-429.185) * (-428.075) (-424.711) (-426.046) [-427.134] -- 0:00:36
Average standard deviation of split frequencies: 0.036793
50500 -- (-424.325) (-423.770) (-427.681) [-423.521] * (-424.777) [-422.816] (-426.187) (-422.700) -- 0:00:35
51000 -- (-425.474) (-423.642) (-428.296) [-423.854] * [-423.634] (-423.456) (-424.788) (-425.277) -- 0:00:35
51500 -- (-425.259) (-424.073) (-429.069) [-423.432] * (-425.924) (-424.568) [-423.534] (-425.726) -- 0:00:34
52000 -- [-423.286] (-426.870) (-424.299) (-423.412) * (-426.193) (-424.694) (-424.844) [-424.563] -- 0:00:34
52500 -- (-424.922) (-424.460) (-429.941) [-424.020] * (-424.922) (-423.491) (-423.898) [-423.848] -- 0:00:34
53000 -- (-429.608) (-425.170) (-427.619) [-423.554] * (-425.941) [-427.315] (-424.408) (-428.426) -- 0:00:33
53500 -- [-426.899] (-423.978) (-426.077) (-430.553) * (-425.313) (-425.178) (-426.543) [-427.219] -- 0:00:33
54000 -- (-423.098) (-426.814) (-430.143) [-423.648] * [-428.303] (-425.116) (-424.509) (-424.813) -- 0:00:33
54500 -- (-423.897) [-424.225] (-424.991) (-424.486) * (-425.741) [-422.880] (-429.828) (-425.023) -- 0:00:32
55000 -- (-426.107) [-425.676] (-428.568) (-423.632) * [-423.815] (-426.420) (-428.340) (-424.273) -- 0:00:32
Average standard deviation of split frequencies: 0.034874
55500 -- (-426.486) (-424.169) [-424.934] (-427.278) * (-425.585) (-426.612) [-427.126] (-428.588) -- 0:00:32
56000 -- (-425.482) (-424.581) (-425.092) [-424.619] * [-424.796] (-427.735) (-423.699) (-424.053) -- 0:00:31
56500 -- (-425.709) (-426.808) (-425.258) [-424.272] * [-424.156] (-424.600) (-425.146) (-427.041) -- 0:00:31
57000 -- (-423.662) [-424.897] (-432.230) (-427.532) * (-428.782) [-426.911] (-424.595) (-427.997) -- 0:00:31
57500 -- (-424.937) (-423.285) [-426.658] (-434.458) * (-426.824) (-427.618) (-424.680) [-424.467] -- 0:00:30
58000 -- (-423.312) (-424.835) (-430.248) [-425.003] * (-424.083) [-424.591] (-425.445) (-423.077) -- 0:00:30
58500 -- (-423.303) [-424.575] (-425.962) (-425.109) * (-424.250) (-427.753) (-425.232) [-427.259] -- 0:00:30
59000 -- [-424.699] (-423.133) (-424.258) (-425.783) * (-424.944) [-424.124] (-426.021) (-425.750) -- 0:00:29
59500 -- (-426.927) (-424.613) (-426.251) [-426.493] * (-424.520) (-426.577) (-431.264) [-426.013] -- 0:00:29
60000 -- [-423.196] (-423.626) (-426.435) (-427.909) * [-425.486] (-424.716) (-427.183) (-423.724) -- 0:00:29
Average standard deviation of split frequencies: 0.036262
60500 -- (-426.325) (-424.443) (-426.667) [-424.034] * [-426.618] (-425.877) (-424.186) (-424.164) -- 0:00:29
61000 -- (-425.617) (-423.622) (-426.158) [-425.874] * (-423.380) (-432.130) (-426.476) [-424.348] -- 0:00:28
61500 -- [-422.700] (-424.724) (-428.221) (-424.113) * (-424.132) (-427.714) [-425.631] (-424.709) -- 0:00:28
62000 -- (-426.406) (-424.139) [-423.300] (-426.308) * (-424.696) (-426.309) (-424.387) [-425.478] -- 0:00:28
62500 -- (-423.976) (-425.651) (-426.645) [-424.934] * (-424.389) [-426.321] (-424.292) (-425.023) -- 0:00:28
63000 -- (-425.150) [-423.330] (-424.659) (-426.497) * (-423.058) (-423.389) [-424.467] (-427.764) -- 0:00:27
63500 -- (-425.745) [-428.672] (-425.876) (-423.707) * [-423.693] (-424.392) (-424.128) (-426.197) -- 0:00:27
64000 -- (-425.729) [-425.810] (-426.102) (-425.902) * (-425.780) [-430.914] (-424.802) (-435.522) -- 0:00:27
64500 -- (-423.809) (-427.167) [-424.558] (-431.728) * (-425.978) (-426.150) (-425.015) [-425.654] -- 0:00:27
65000 -- [-423.814] (-428.323) (-423.665) (-423.616) * (-423.055) (-428.185) [-425.411] (-424.135) -- 0:00:33
Average standard deviation of split frequencies: 0.028230
65500 -- (-423.234) (-426.722) [-424.873] (-423.906) * (-423.261) (-424.831) (-423.389) [-424.551] -- 0:00:33
66000 -- [-425.597] (-424.322) (-424.787) (-424.355) * (-423.594) [-425.591] (-425.426) (-426.382) -- 0:00:32
66500 -- (-426.880) (-425.631) (-425.339) [-424.461] * [-426.285] (-424.245) (-425.691) (-422.996) -- 0:00:32
67000 -- (-426.202) (-428.226) [-424.768] (-424.005) * (-423.534) (-423.043) (-425.171) [-424.241] -- 0:00:32
67500 -- (-426.878) (-425.205) [-426.945] (-423.976) * (-423.320) [-423.281] (-424.789) (-424.045) -- 0:00:32
68000 -- (-425.224) (-427.402) [-426.567] (-428.955) * (-423.868) [-423.849] (-428.902) (-424.222) -- 0:00:31
68500 -- (-425.127) [-425.581] (-425.310) (-426.604) * (-426.138) (-423.378) (-425.962) [-423.469] -- 0:00:31
69000 -- (-425.128) (-424.647) [-424.747] (-424.188) * (-424.928) (-424.597) (-426.981) [-423.316] -- 0:00:31
69500 -- (-424.831) [-428.808] (-425.322) (-424.796) * (-427.509) (-423.815) (-426.113) [-424.860] -- 0:00:30
70000 -- (-427.723) (-423.769) (-424.590) [-425.263] * (-423.614) (-428.208) [-423.135] (-425.758) -- 0:00:30
Average standard deviation of split frequencies: 0.026016
70500 -- (-428.122) [-422.817] (-426.383) (-423.934) * (-424.859) [-425.083] (-424.254) (-424.509) -- 0:00:30
71000 -- (-425.519) (-425.154) (-424.365) [-424.012] * (-428.882) (-423.942) (-424.972) [-425.269] -- 0:00:30
71500 -- (-425.300) (-424.594) (-427.275) [-427.246] * [-426.395] (-424.824) (-426.755) (-425.821) -- 0:00:29
72000 -- [-423.378] (-426.861) (-427.783) (-425.010) * (-423.293) (-424.235) (-424.744) [-424.027] -- 0:00:29
72500 -- (-425.897) (-426.135) [-422.764] (-429.562) * [-423.597] (-424.901) (-424.497) (-423.681) -- 0:00:29
73000 -- [-426.461] (-424.739) (-423.148) (-425.673) * (-427.929) (-425.181) [-425.863] (-428.051) -- 0:00:29
73500 -- (-427.909) (-423.592) [-423.501] (-432.291) * (-423.976) [-426.594] (-424.727) (-427.750) -- 0:00:29
74000 -- (-424.033) [-426.069] (-424.269) (-427.055) * (-426.868) (-425.778) [-425.127] (-425.211) -- 0:00:28
74500 -- [-423.913] (-425.504) (-423.945) (-426.918) * (-430.989) (-426.077) [-424.712] (-422.894) -- 0:00:28
75000 -- [-424.372] (-423.900) (-426.047) (-426.997) * (-425.783) (-427.463) [-424.143] (-426.583) -- 0:00:28
Average standard deviation of split frequencies: 0.028075
75500 -- (-430.202) [-425.101] (-428.511) (-425.082) * (-427.595) (-425.337) (-424.823) [-424.693] -- 0:00:28
76000 -- (-425.022) [-426.997] (-428.880) (-427.740) * (-424.695) (-425.636) (-425.217) [-425.533] -- 0:00:27
76500 -- (-425.986) [-424.700] (-430.348) (-425.015) * (-425.177) (-425.858) [-423.655] (-423.924) -- 0:00:27
77000 -- (-423.309) (-425.726) (-426.696) [-423.909] * (-429.336) [-425.538] (-425.015) (-426.003) -- 0:00:27
77500 -- (-424.203) (-424.386) (-424.217) [-424.493] * (-425.975) [-426.447] (-424.722) (-426.671) -- 0:00:27
78000 -- (-424.758) [-424.880] (-426.717) (-426.198) * [-425.109] (-429.926) (-424.795) (-423.318) -- 0:00:27
78500 -- (-429.495) (-424.983) (-435.440) [-423.012] * (-424.587) (-425.280) (-425.547) [-425.957] -- 0:00:26
79000 -- [-431.649] (-424.980) (-427.628) (-424.624) * (-426.705) [-424.147] (-426.690) (-423.797) -- 0:00:26
79500 -- (-428.068) (-423.642) [-424.824] (-425.200) * (-426.777) (-424.110) [-426.037] (-425.585) -- 0:00:26
80000 -- (-425.046) [-426.079] (-426.928) (-424.001) * (-427.712) (-424.849) [-426.332] (-423.517) -- 0:00:26
Average standard deviation of split frequencies: 0.023375
80500 -- (-424.603) (-424.670) (-425.618) [-424.709] * (-429.618) (-424.640) (-425.811) [-423.874] -- 0:00:31
81000 -- [-425.821] (-424.001) (-424.939) (-427.499) * (-427.988) (-425.600) (-424.796) [-427.766] -- 0:00:31
81500 -- [-424.682] (-425.660) (-424.685) (-427.030) * (-424.801) (-424.593) (-423.816) [-423.039] -- 0:00:30
82000 -- (-426.107) [-423.544] (-426.444) (-424.209) * (-425.643) (-424.007) (-425.079) [-425.584] -- 0:00:30
82500 -- (-426.677) [-425.566] (-424.982) (-424.730) * (-425.971) (-425.548) (-427.347) [-424.052] -- 0:00:30
83000 -- [-428.367] (-429.392) (-423.170) (-422.778) * (-424.200) [-425.755] (-429.316) (-424.768) -- 0:00:30
83500 -- (-424.518) (-425.402) [-424.626] (-424.509) * [-423.619] (-425.076) (-424.928) (-427.445) -- 0:00:29
84000 -- (-427.546) (-423.327) [-425.421] (-427.986) * (-424.390) [-427.031] (-424.305) (-428.867) -- 0:00:29
84500 -- (-426.166) [-425.180] (-425.770) (-424.416) * (-424.802) (-425.245) [-425.014] (-425.551) -- 0:00:29
85000 -- [-425.432] (-424.826) (-427.484) (-424.454) * [-423.433] (-426.992) (-429.742) (-422.795) -- 0:00:29
Average standard deviation of split frequencies: 0.022970
85500 -- (-428.198) (-424.729) [-424.858] (-428.143) * [-426.534] (-424.736) (-425.940) (-424.697) -- 0:00:29
86000 -- [-426.962] (-424.835) (-424.902) (-427.475) * [-426.827] (-426.754) (-429.853) (-424.625) -- 0:00:28
86500 -- (-425.116) [-426.162] (-424.540) (-424.666) * (-423.577) (-425.116) (-423.723) [-426.561] -- 0:00:28
87000 -- [-423.653] (-423.529) (-423.004) (-423.324) * (-424.207) [-424.578] (-424.786) (-426.158) -- 0:00:28
87500 -- (-429.002) (-423.066) (-426.726) [-425.349] * (-423.578) (-424.316) [-423.577] (-425.013) -- 0:00:28
88000 -- (-423.898) (-425.695) [-424.100] (-423.683) * (-424.028) (-423.564) (-423.205) [-424.065] -- 0:00:28
88500 -- (-425.556) (-425.731) (-424.223) [-425.045] * (-425.100) (-425.388) (-426.111) [-423.632] -- 0:00:27
89000 -- [-423.845] (-425.420) (-423.861) (-424.920) * (-424.159) (-426.449) [-425.601] (-424.592) -- 0:00:27
89500 -- [-424.549] (-426.873) (-424.503) (-425.316) * (-423.537) [-428.571] (-424.448) (-424.570) -- 0:00:27
90000 -- (-429.276) (-423.363) (-424.383) [-426.488] * (-425.319) (-426.157) [-426.892] (-425.221) -- 0:00:27
Average standard deviation of split frequencies: 0.020250
90500 -- (-430.176) (-427.577) [-422.904] (-425.617) * (-425.474) (-424.887) [-424.724] (-424.431) -- 0:00:27
91000 -- (-424.846) (-426.805) (-427.196) [-423.842] * (-425.343) [-426.588] (-427.102) (-424.936) -- 0:00:26
91500 -- (-426.456) (-424.593) [-424.846] (-424.968) * [-424.842] (-424.505) (-427.148) (-425.004) -- 0:00:26
92000 -- [-426.983] (-424.329) (-430.972) (-423.966) * (-424.887) (-424.058) (-425.823) [-426.632] -- 0:00:26
92500 -- (-424.807) (-426.213) (-425.249) [-424.134] * (-424.598) (-423.865) [-429.891] (-426.169) -- 0:00:26
93000 -- (-428.319) (-424.372) [-423.483] (-425.562) * (-426.414) (-423.643) (-426.427) [-425.381] -- 0:00:26
93500 -- (-434.744) [-427.890] (-423.186) (-425.636) * (-427.128) (-426.147) (-424.583) [-427.134] -- 0:00:26
94000 -- [-427.182] (-425.511) (-427.331) (-425.402) * (-430.158) (-426.672) [-423.792] (-424.572) -- 0:00:25
94500 -- [-425.617] (-423.662) (-428.175) (-423.349) * (-427.688) (-427.260) [-425.453] (-423.746) -- 0:00:25
95000 -- [-423.143] (-424.388) (-427.751) (-427.307) * (-423.514) (-424.522) (-429.926) [-424.274] -- 0:00:25
Average standard deviation of split frequencies: 0.017732
95500 -- (-427.046) (-424.238) (-424.551) [-425.136] * (-425.427) [-424.034] (-424.790) (-423.531) -- 0:00:25
96000 -- (-424.444) (-423.272) [-423.268] (-427.792) * (-424.838) (-426.154) [-424.046] (-423.536) -- 0:00:29
96500 -- (-425.717) (-424.076) (-427.181) [-425.046] * (-423.848) (-425.333) [-423.101] (-424.284) -- 0:00:29
97000 -- (-428.186) (-425.209) [-423.461] (-424.408) * (-424.301) (-424.418) [-425.085] (-423.663) -- 0:00:29
97500 -- (-423.532) (-425.957) [-424.646] (-423.608) * [-426.983] (-427.641) (-424.685) (-423.971) -- 0:00:28
98000 -- (-424.516) (-429.690) [-425.364] (-426.532) * (-425.324) (-427.480) (-424.081) [-429.389] -- 0:00:28
98500 -- (-422.580) (-426.634) [-424.439] (-428.368) * (-425.853) [-426.221] (-428.418) (-425.431) -- 0:00:28
99000 -- (-430.135) [-424.551] (-424.290) (-423.769) * [-424.642] (-423.830) (-424.003) (-426.249) -- 0:00:28
99500 -- (-428.993) [-425.419] (-426.914) (-425.891) * (-425.630) [-425.095] (-424.775) (-426.045) -- 0:00:28
100000 -- [-422.949] (-428.699) (-424.015) (-424.757) * [-424.514] (-427.584) (-424.208) (-423.497) -- 0:00:27
Average standard deviation of split frequencies: 0.018471
100500 -- (-427.477) (-423.945) [-424.949] (-425.480) * (-424.613) [-428.706] (-424.369) (-426.742) -- 0:00:27
101000 -- (-424.447) [-425.217] (-423.935) (-424.093) * [-428.364] (-426.561) (-426.131) (-425.939) -- 0:00:27
101500 -- (-425.251) (-427.016) (-426.924) [-424.137] * (-424.212) [-423.305] (-426.439) (-424.229) -- 0:00:27
102000 -- (-426.130) [-429.403] (-427.896) (-425.499) * (-424.351) (-424.334) [-424.300] (-424.746) -- 0:00:27
102500 -- (-424.385) [-424.682] (-424.372) (-425.320) * (-424.980) (-425.037) (-425.708) [-423.682] -- 0:00:27
103000 -- (-424.103) (-423.393) [-424.100] (-426.363) * (-424.071) (-428.389) (-424.061) [-423.202] -- 0:00:26
103500 -- [-425.148] (-427.549) (-424.141) (-424.266) * (-426.642) (-429.059) [-424.507] (-423.455) -- 0:00:26
104000 -- (-425.778) (-424.511) (-427.289) [-424.280] * (-426.728) (-425.609) [-422.976] (-424.748) -- 0:00:26
104500 -- (-429.516) [-426.698] (-424.504) (-423.359) * (-423.831) (-424.675) [-425.208] (-425.142) -- 0:00:26
105000 -- (-429.987) [-428.912] (-423.540) (-424.261) * [-425.558] (-424.221) (-424.200) (-425.320) -- 0:00:26
Average standard deviation of split frequencies: 0.018023
105500 -- (-428.160) [-429.612] (-425.125) (-428.011) * [-425.279] (-423.895) (-425.683) (-424.434) -- 0:00:26
106000 -- (-424.563) (-424.514) [-424.278] (-426.631) * (-423.563) (-426.470) (-424.762) [-428.127] -- 0:00:26
106500 -- (-423.818) (-425.691) (-424.183) [-424.423] * (-423.904) [-425.026] (-423.567) (-425.684) -- 0:00:25
107000 -- (-424.187) (-425.905) (-425.996) [-424.270] * (-429.261) (-424.308) (-424.510) [-426.764] -- 0:00:25
107500 -- (-424.958) (-428.853) [-424.461] (-423.279) * (-426.267) (-423.302) [-423.532] (-427.885) -- 0:00:25
108000 -- (-424.077) [-426.496] (-425.207) (-424.297) * (-425.253) (-425.614) [-424.579] (-429.204) -- 0:00:25
108500 -- (-424.446) (-427.786) [-426.209] (-428.752) * (-424.690) [-426.565] (-423.861) (-425.303) -- 0:00:25
109000 -- (-424.242) [-425.047] (-425.829) (-424.004) * (-425.318) [-423.739] (-423.216) (-431.012) -- 0:00:25
109500 -- (-423.944) (-425.533) (-423.694) [-425.242] * (-425.721) [-426.912] (-426.688) (-430.974) -- 0:00:24
110000 -- (-422.967) [-424.549] (-425.933) (-425.983) * [-424.322] (-423.903) (-424.083) (-424.735) -- 0:00:24
Average standard deviation of split frequencies: 0.019729
110500 -- (-424.578) (-425.452) (-425.060) [-423.064] * (-425.573) [-424.714] (-426.282) (-425.956) -- 0:00:24
111000 -- [-425.798] (-424.850) (-425.960) (-424.601) * (-426.561) (-433.601) [-424.038] (-424.469) -- 0:00:24
111500 -- (-424.859) (-424.922) (-423.658) [-425.103] * [-426.821] (-430.213) (-424.304) (-424.072) -- 0:00:27
112000 -- (-424.329) [-424.269] (-430.765) (-425.482) * (-424.155) (-424.676) (-425.894) [-424.633] -- 0:00:27
112500 -- (-423.836) (-426.931) (-428.494) [-426.737] * [-425.157] (-425.492) (-426.339) (-426.944) -- 0:00:27
113000 -- (-423.779) [-423.831] (-426.435) (-425.250) * [-424.547] (-426.032) (-424.214) (-423.992) -- 0:00:27
113500 -- (-429.835) (-427.300) (-427.055) [-424.146] * [-425.964] (-423.862) (-424.328) (-426.158) -- 0:00:27
114000 -- (-427.100) [-425.889] (-425.454) (-424.131) * (-427.586) [-424.682] (-423.556) (-423.847) -- 0:00:27
114500 -- (-428.117) (-425.369) (-424.096) [-425.258] * [-426.989] (-425.790) (-423.583) (-427.389) -- 0:00:26
115000 -- [-426.689] (-423.839) (-422.754) (-429.742) * (-423.413) [-424.830] (-426.059) (-426.315) -- 0:00:26
Average standard deviation of split frequencies: 0.020319
115500 -- (-424.390) (-424.815) (-424.829) [-424.802] * [-422.782] (-429.747) (-426.234) (-424.984) -- 0:00:26
116000 -- (-423.259) [-424.602] (-424.823) (-425.121) * (-425.856) (-424.345) (-426.979) [-423.696] -- 0:00:26
116500 -- (-427.255) [-423.532] (-424.019) (-424.891) * [-425.764] (-426.222) (-426.471) (-425.906) -- 0:00:26
117000 -- (-423.843) [-423.984] (-425.930) (-424.251) * [-425.829] (-424.758) (-426.922) (-426.830) -- 0:00:26
117500 -- [-423.704] (-424.250) (-423.177) (-428.873) * (-424.196) [-423.337] (-425.750) (-432.540) -- 0:00:26
118000 -- (-424.920) (-424.967) [-424.850] (-429.201) * [-424.442] (-425.953) (-425.039) (-424.616) -- 0:00:25
118500 -- (-424.926) [-424.905] (-428.612) (-423.332) * (-428.251) (-426.455) [-425.252] (-423.805) -- 0:00:25
119000 -- [-426.544] (-427.606) (-424.052) (-427.633) * (-424.154) (-423.146) (-426.557) [-424.267] -- 0:00:25
119500 -- [-425.654] (-426.524) (-423.486) (-424.190) * (-423.865) (-425.079) (-430.127) [-425.179] -- 0:00:25
120000 -- (-423.763) (-426.525) (-424.117) [-426.141] * (-426.876) (-427.096) (-425.350) [-424.701] -- 0:00:25
Average standard deviation of split frequencies: 0.022138
120500 -- [-423.407] (-424.112) (-423.627) (-424.021) * (-424.907) [-425.395] (-425.914) (-424.794) -- 0:00:25
121000 -- (-424.041) [-426.910] (-423.751) (-425.192) * (-426.334) (-423.387) [-424.115] (-423.251) -- 0:00:25
121500 -- [-423.371] (-426.695) (-423.689) (-429.530) * (-427.766) [-426.400] (-423.509) (-424.030) -- 0:00:24
122000 -- [-423.670] (-427.867) (-423.529) (-424.142) * [-427.368] (-424.318) (-427.412) (-426.191) -- 0:00:24
122500 -- (-425.267) (-426.944) [-423.856] (-423.723) * (-427.070) (-426.877) [-424.019] (-425.400) -- 0:00:24
123000 -- (-423.548) [-423.824] (-424.701) (-429.476) * (-423.378) (-428.963) (-424.606) [-423.418] -- 0:00:24
123500 -- (-424.600) (-425.553) (-431.428) [-423.262] * (-425.505) [-424.269] (-428.117) (-425.176) -- 0:00:24
124000 -- [-424.552] (-425.989) (-423.205) (-423.005) * (-425.603) (-424.520) (-425.341) [-423.027] -- 0:00:24
124500 -- [-425.720] (-424.050) (-426.693) (-423.717) * (-425.727) [-426.136] (-423.557) (-424.410) -- 0:00:24
125000 -- (-426.468) (-425.687) (-425.809) [-423.205] * [-423.298] (-427.234) (-424.872) (-423.898) -- 0:00:24
Average standard deviation of split frequencies: 0.022645
125500 -- (-424.851) (-426.604) [-424.122] (-425.142) * (-423.396) [-427.222] (-426.616) (-425.872) -- 0:00:23
126000 -- [-426.006] (-424.254) (-431.049) (-425.378) * (-428.807) [-426.475] (-426.999) (-425.365) -- 0:00:23
126500 -- [-424.155] (-423.576) (-426.200) (-424.852) * (-431.633) (-426.748) (-426.013) [-422.731] -- 0:00:26
127000 -- (-425.723) (-423.820) (-424.346) [-425.231] * (-427.052) [-424.284] (-426.098) (-424.675) -- 0:00:26
127500 -- (-428.083) (-425.164) [-425.196] (-425.164) * (-430.726) (-423.891) [-425.997] (-424.895) -- 0:00:26
128000 -- (-426.280) (-426.190) (-424.843) [-426.474] * [-425.982] (-423.326) (-431.396) (-425.912) -- 0:00:26
128500 -- (-426.397) (-425.183) (-430.681) [-423.746] * (-424.409) [-424.573] (-425.578) (-428.154) -- 0:00:26
129000 -- (-426.523) (-424.033) (-425.098) [-425.137] * (-427.571) [-424.601] (-424.928) (-425.615) -- 0:00:25
129500 -- (-425.937) [-425.543] (-424.452) (-426.936) * (-427.003) (-424.538) [-423.837] (-425.486) -- 0:00:25
130000 -- (-424.997) (-424.352) (-425.924) [-424.781] * (-426.400) (-425.079) [-424.824] (-425.278) -- 0:00:25
Average standard deviation of split frequencies: 0.025254
130500 -- (-423.275) [-423.712] (-423.374) (-426.546) * (-423.214) (-424.703) (-429.211) [-427.250] -- 0:00:25
131000 -- [-425.131] (-425.175) (-424.587) (-423.642) * (-426.606) (-425.023) [-425.900] (-424.519) -- 0:00:25
131500 -- (-424.024) (-427.496) (-424.007) [-423.591] * (-424.020) (-426.015) (-423.830) [-425.332] -- 0:00:25
132000 -- (-426.870) (-426.993) [-424.370] (-424.694) * [-422.709] (-426.218) (-423.007) (-424.428) -- 0:00:25
132500 -- (-424.465) [-423.701] (-428.468) (-424.018) * [-426.519] (-428.765) (-424.443) (-424.753) -- 0:00:24
133000 -- [-423.565] (-424.514) (-424.942) (-425.215) * (-426.227) (-428.272) (-424.668) [-424.725] -- 0:00:24
133500 -- [-424.476] (-425.428) (-424.526) (-424.960) * [-428.218] (-425.485) (-427.653) (-424.847) -- 0:00:24
134000 -- (-425.506) [-423.548] (-424.604) (-424.951) * [-424.178] (-424.383) (-427.327) (-428.689) -- 0:00:24
134500 -- (-427.427) (-423.674) [-426.142] (-426.376) * [-423.910] (-423.990) (-425.342) (-425.992) -- 0:00:24
135000 -- (-426.163) (-426.612) (-424.632) [-431.205] * [-424.459] (-425.841) (-425.244) (-422.631) -- 0:00:24
Average standard deviation of split frequencies: 0.026270
135500 -- (-425.480) (-425.255) [-426.579] (-426.500) * (-425.169) (-425.161) (-425.656) [-423.932] -- 0:00:24
136000 -- (-424.319) [-423.878] (-424.980) (-423.409) * [-425.820] (-428.811) (-424.398) (-423.929) -- 0:00:24
136500 -- [-424.380] (-424.253) (-424.794) (-429.058) * (-425.021) (-424.887) (-423.928) [-423.659] -- 0:00:23
137000 -- (-426.282) (-423.835) (-426.909) [-423.890] * (-439.829) (-424.669) (-425.066) [-423.706] -- 0:00:23
137500 -- (-428.759) [-425.096] (-424.611) (-423.332) * (-428.121) (-425.287) (-428.568) [-423.544] -- 0:00:23
138000 -- (-425.243) [-424.550] (-425.902) (-424.253) * (-423.678) (-426.746) (-427.688) [-424.609] -- 0:00:23
138500 -- [-426.729] (-429.897) (-424.949) (-426.994) * (-424.945) (-426.870) (-428.509) [-423.612] -- 0:00:23
139000 -- [-424.684] (-425.666) (-427.464) (-424.411) * [-424.025] (-425.710) (-424.450) (-427.084) -- 0:00:23
139500 -- (-425.594) (-427.552) (-425.887) [-423.986] * (-423.428) (-425.199) (-427.500) [-432.170] -- 0:00:23
140000 -- (-426.753) (-426.349) (-425.210) [-424.465] * (-428.739) [-424.697] (-426.460) (-427.418) -- 0:00:23
Average standard deviation of split frequencies: 0.024870
140500 -- (-423.987) [-423.681] (-425.032) (-424.845) * (-424.070) [-423.930] (-426.230) (-425.149) -- 0:00:23
141000 -- (-426.603) (-429.281) [-425.477] (-427.401) * (-425.359) [-427.142] (-426.758) (-425.738) -- 0:00:22
141500 -- (-425.052) (-423.107) [-426.564] (-423.584) * (-426.873) (-427.803) (-425.793) [-423.293] -- 0:00:22
142000 -- (-424.645) (-423.025) [-423.401] (-424.236) * (-424.339) (-423.930) [-428.377] (-425.590) -- 0:00:22
142500 -- (-427.002) (-425.337) [-423.129] (-424.587) * (-423.266) (-425.086) [-428.063] (-426.257) -- 0:00:25
143000 -- [-426.847] (-423.142) (-423.002) (-424.165) * [-426.415] (-426.818) (-432.217) (-427.577) -- 0:00:24
143500 -- (-424.328) [-427.135] (-424.274) (-427.947) * (-431.625) (-425.277) (-426.969) [-422.839] -- 0:00:24
144000 -- (-423.991) [-423.865] (-423.157) (-424.085) * (-429.534) (-425.488) (-426.871) [-425.093] -- 0:00:24
144500 -- (-424.372) (-424.452) (-425.832) [-423.953] * (-425.855) (-426.919) (-428.695) [-423.667] -- 0:00:24
145000 -- (-423.916) (-424.626) [-424.321] (-426.571) * (-423.810) (-426.930) (-429.801) [-424.112] -- 0:00:24
Average standard deviation of split frequencies: 0.022440
145500 -- (-427.207) (-427.325) (-426.785) [-424.253] * (-423.793) [-424.404] (-423.903) (-428.928) -- 0:00:24
146000 -- (-427.022) (-424.344) [-426.816] (-427.354) * [-424.254] (-424.748) (-423.653) (-424.029) -- 0:00:24
146500 -- (-423.558) (-424.534) [-427.780] (-423.714) * (-425.365) [-424.160] (-423.963) (-425.415) -- 0:00:24
147000 -- (-423.532) [-423.817] (-426.437) (-425.604) * (-427.524) (-425.348) (-423.346) [-424.414] -- 0:00:24
147500 -- (-424.428) (-426.430) [-426.514] (-424.791) * (-423.610) [-426.018] (-425.210) (-431.097) -- 0:00:23
148000 -- (-422.803) (-425.476) (-424.070) [-425.511] * (-424.606) [-424.865] (-425.845) (-428.761) -- 0:00:23
148500 -- [-424.380] (-424.220) (-423.553) (-425.904) * (-424.603) [-423.994] (-424.100) (-426.727) -- 0:00:23
149000 -- (-424.254) (-424.196) (-426.111) [-425.957] * (-426.791) (-423.708) (-426.217) [-425.098] -- 0:00:23
149500 -- (-430.330) (-424.608) [-425.353] (-424.608) * [-425.370] (-424.037) (-434.137) (-427.994) -- 0:00:23
150000 -- (-424.185) [-426.168] (-425.333) (-426.791) * (-423.378) (-423.647) (-424.718) [-424.281] -- 0:00:23
Average standard deviation of split frequencies: 0.020963
150500 -- (-424.642) (-425.184) [-427.042] (-425.116) * (-425.121) [-424.757] (-424.189) (-423.559) -- 0:00:23
151000 -- (-424.429) (-425.359) [-426.511] (-425.021) * [-424.935] (-424.141) (-423.422) (-423.904) -- 0:00:23
151500 -- [-423.744] (-424.466) (-428.586) (-426.434) * [-426.807] (-423.659) (-423.366) (-430.830) -- 0:00:23
152000 -- (-426.698) [-424.713] (-424.874) (-423.967) * (-427.056) (-424.155) (-424.319) [-425.797] -- 0:00:22
152500 -- [-425.489] (-426.582) (-424.166) (-423.676) * (-424.736) (-425.292) [-424.854] (-425.168) -- 0:00:22
153000 -- (-424.710) [-426.591] (-424.307) (-424.867) * (-425.292) [-425.646] (-427.127) (-424.546) -- 0:00:22
153500 -- [-424.115] (-429.613) (-426.429) (-423.353) * (-428.047) (-426.039) [-424.860] (-424.823) -- 0:00:22
154000 -- (-424.502) [-425.559] (-423.554) (-425.358) * (-427.518) [-425.894] (-423.936) (-423.916) -- 0:00:22
154500 -- (-426.044) [-423.359] (-423.585) (-424.938) * (-424.366) (-425.878) [-430.797] (-427.922) -- 0:00:22
155000 -- (-427.195) (-425.167) [-426.617] (-425.302) * (-427.516) (-424.723) [-424.428] (-424.168) -- 0:00:22
Average standard deviation of split frequencies: 0.023697
155500 -- (-427.435) (-425.356) (-427.434) [-428.212] * [-424.708] (-424.560) (-423.671) (-424.384) -- 0:00:22
156000 -- (-427.242) (-426.629) [-428.163] (-425.446) * [-424.813] (-426.968) (-425.187) (-423.557) -- 0:00:22
156500 -- [-424.099] (-424.041) (-429.482) (-425.376) * (-423.155) [-428.109] (-423.324) (-426.749) -- 0:00:21
157000 -- (-423.490) [-430.548] (-427.156) (-425.241) * (-424.873) [-425.609] (-423.186) (-424.703) -- 0:00:21
157500 -- [-425.339] (-430.957) (-426.014) (-427.285) * (-423.054) (-424.218) [-425.422] (-423.911) -- 0:00:21
158000 -- (-424.397) [-424.591] (-424.230) (-424.257) * [-424.231] (-424.372) (-427.117) (-424.637) -- 0:00:21
158500 -- (-425.841) (-426.068) (-427.035) [-423.875] * (-424.461) (-427.904) (-430.064) [-423.709] -- 0:00:23
159000 -- (-422.871) [-423.641] (-428.353) (-424.500) * (-428.813) (-430.561) (-432.047) [-426.882] -- 0:00:23
159500 -- (-426.014) (-424.402) [-426.225] (-424.447) * [-425.340] (-425.929) (-426.038) (-427.032) -- 0:00:23
160000 -- (-425.779) (-422.811) [-425.124] (-426.606) * (-428.544) (-423.679) [-424.182] (-428.862) -- 0:00:23
Average standard deviation of split frequencies: 0.022592
160500 -- (-424.450) (-428.186) (-429.754) [-426.162] * (-428.958) (-424.159) [-426.542] (-427.429) -- 0:00:23
161000 -- (-424.003) [-423.561] (-425.383) (-423.583) * [-424.278] (-424.761) (-424.225) (-425.593) -- 0:00:23
161500 -- (-423.968) [-426.411] (-426.417) (-425.405) * (-423.682) (-423.328) (-427.478) [-425.139] -- 0:00:23
162000 -- (-423.397) [-423.354] (-425.307) (-425.977) * (-424.153) [-424.884] (-425.512) (-425.901) -- 0:00:22
162500 -- (-423.719) (-424.348) [-424.035] (-425.453) * (-425.066) (-425.663) [-425.930] (-424.361) -- 0:00:22
163000 -- [-425.018] (-426.981) (-424.221) (-426.148) * (-424.343) (-424.629) (-425.970) [-425.293] -- 0:00:22
163500 -- (-423.870) (-424.340) (-423.965) [-425.225] * (-425.961) (-423.282) [-424.700] (-424.587) -- 0:00:22
164000 -- [-427.246] (-423.825) (-426.863) (-428.441) * (-424.139) [-423.590] (-425.621) (-428.083) -- 0:00:22
164500 -- (-427.596) [-425.144] (-426.153) (-426.105) * (-431.077) (-427.528) [-425.061] (-424.428) -- 0:00:22
165000 -- (-427.772) (-426.939) [-424.828] (-426.014) * (-425.108) [-426.146] (-427.391) (-427.894) -- 0:00:22
Average standard deviation of split frequencies: 0.021366
165500 -- [-426.336] (-428.611) (-424.263) (-425.554) * [-423.030] (-428.487) (-426.104) (-427.698) -- 0:00:22
166000 -- (-428.036) [-424.237] (-424.137) (-427.874) * [-425.276] (-424.747) (-424.813) (-426.155) -- 0:00:22
166500 -- (-422.829) (-428.458) (-426.400) [-423.099] * (-426.483) [-423.756] (-424.929) (-425.665) -- 0:00:22
167000 -- (-427.416) [-426.019] (-426.442) (-423.399) * [-428.204] (-426.224) (-424.177) (-425.787) -- 0:00:21
167500 -- (-424.449) [-425.712] (-427.724) (-427.523) * (-425.625) (-425.844) (-427.151) [-428.441] -- 0:00:21
168000 -- (-425.222) (-423.385) [-424.075] (-423.333) * (-423.467) [-423.261] (-425.957) (-425.629) -- 0:00:21
168500 -- (-429.960) (-426.881) (-426.752) [-423.577] * (-423.324) [-426.228] (-424.225) (-423.390) -- 0:00:21
169000 -- [-425.178] (-423.460) (-425.523) (-422.828) * (-423.046) (-422.932) (-425.624) [-424.521] -- 0:00:21
169500 -- (-425.254) (-425.694) (-428.630) [-428.525] * (-428.293) (-425.055) [-425.912] (-425.213) -- 0:00:21
170000 -- (-425.057) (-424.380) (-425.014) [-424.734] * (-426.802) (-425.785) [-423.838] (-423.689) -- 0:00:21
Average standard deviation of split frequencies: 0.021439
170500 -- [-428.001] (-425.257) (-424.743) (-423.426) * [-425.789] (-425.259) (-424.170) (-424.260) -- 0:00:21
171000 -- (-425.504) (-423.824) (-426.257) [-423.396] * (-426.080) (-423.272) (-423.918) [-423.674] -- 0:00:21
171500 -- (-425.068) (-427.005) (-425.410) [-423.604] * (-425.199) (-423.779) [-423.953] (-425.924) -- 0:00:21
172000 -- (-424.775) [-426.103] (-424.202) (-427.258) * (-427.770) (-423.996) [-423.927] (-424.899) -- 0:00:20
172500 -- (-423.114) (-425.778) [-425.742] (-424.747) * (-426.883) (-424.071) (-425.905) [-424.221] -- 0:00:20
173000 -- (-426.576) (-425.452) (-428.055) [-422.919] * (-425.442) [-426.799] (-424.561) (-426.695) -- 0:00:20
173500 -- (-428.916) (-424.226) (-424.781) [-424.803] * [-425.863] (-428.036) (-424.101) (-425.719) -- 0:00:20
174000 -- (-424.502) (-422.913) [-424.353] (-423.927) * (-425.413) (-426.282) (-423.350) [-423.779] -- 0:00:22
174500 -- (-423.839) (-427.763) [-424.845] (-422.959) * [-423.514] (-427.134) (-428.048) (-424.767) -- 0:00:22
175000 -- (-424.287) (-424.799) [-425.643] (-424.949) * (-427.282) [-424.319] (-425.292) (-427.759) -- 0:00:22
Average standard deviation of split frequencies: 0.020535
175500 -- (-425.625) [-425.138] (-425.731) (-424.896) * (-424.225) [-424.941] (-425.779) (-424.629) -- 0:00:22
176000 -- (-425.047) (-425.250) (-425.261) [-424.278] * [-423.585] (-426.154) (-423.604) (-427.477) -- 0:00:22
176500 -- [-425.594] (-424.617) (-424.652) (-426.253) * (-427.716) (-423.470) [-424.527] (-426.030) -- 0:00:21
177000 -- (-426.549) (-424.575) (-426.663) [-424.345] * (-428.549) [-425.268] (-425.201) (-427.270) -- 0:00:21
177500 -- [-424.303] (-426.307) (-427.363) (-423.108) * (-425.065) (-426.128) [-423.380] (-426.276) -- 0:00:21
178000 -- (-424.024) (-425.742) [-423.865] (-424.659) * (-425.281) (-423.223) (-428.092) [-424.456] -- 0:00:21
178500 -- (-428.030) (-424.861) (-425.901) [-425.476] * (-425.784) [-424.903] (-426.118) (-426.020) -- 0:00:21
179000 -- [-425.424] (-423.778) (-425.531) (-424.905) * (-425.179) (-424.455) [-425.478] (-431.560) -- 0:00:21
179500 -- (-424.727) [-425.641] (-424.644) (-426.561) * (-423.869) (-426.784) (-426.815) [-426.717] -- 0:00:21
180000 -- (-426.240) (-425.623) [-425.217] (-424.624) * (-423.709) (-424.197) [-428.092] (-425.007) -- 0:00:21
Average standard deviation of split frequencies: 0.021599
180500 -- (-424.890) (-423.753) [-423.761] (-426.123) * (-424.731) (-423.774) [-430.164] (-424.137) -- 0:00:21
181000 -- (-423.634) (-425.404) [-423.663] (-425.022) * [-424.835] (-427.288) (-431.389) (-427.056) -- 0:00:21
181500 -- (-425.829) (-426.528) [-424.765] (-423.755) * (-425.173) [-425.258] (-424.834) (-427.551) -- 0:00:21
182000 -- (-426.489) (-426.197) [-428.038] (-423.172) * (-424.128) (-423.561) [-428.188] (-426.356) -- 0:00:20
182500 -- (-425.287) (-425.130) (-429.650) [-426.181] * [-426.629] (-425.889) (-426.321) (-425.547) -- 0:00:20
183000 -- (-423.962) (-423.814) [-424.197] (-425.332) * (-424.356) (-427.233) [-428.512] (-425.168) -- 0:00:20
183500 -- (-428.888) [-426.306] (-423.520) (-424.774) * (-425.281) (-425.295) (-426.265) [-428.190] -- 0:00:20
184000 -- (-424.496) (-424.183) (-425.234) [-425.647] * (-425.534) (-431.406) [-425.960] (-428.079) -- 0:00:20
184500 -- (-426.717) (-425.432) [-427.600] (-423.699) * [-424.335] (-429.141) (-426.863) (-427.245) -- 0:00:20
185000 -- (-424.334) (-425.047) [-426.078] (-425.465) * (-425.654) (-426.261) (-424.228) [-424.138] -- 0:00:20
Average standard deviation of split frequencies: 0.020839
185500 -- [-426.163] (-424.272) (-426.608) (-423.532) * [-424.646] (-426.833) (-424.016) (-424.950) -- 0:00:20
186000 -- (-424.257) (-425.322) (-424.884) [-425.007] * (-423.296) (-423.616) [-424.897] (-423.843) -- 0:00:20
186500 -- (-426.234) [-426.490] (-423.558) (-425.211) * [-423.282] (-424.132) (-429.311) (-427.525) -- 0:00:20
187000 -- (-425.836) (-425.712) [-428.083] (-424.377) * (-425.928) [-426.622] (-426.803) (-424.931) -- 0:00:20
187500 -- (-424.617) (-426.434) [-428.506] (-424.569) * (-427.902) [-425.530] (-429.176) (-423.071) -- 0:00:20
188000 -- [-423.941] (-425.096) (-424.219) (-427.210) * (-424.537) [-427.224] (-429.487) (-424.951) -- 0:00:19
188500 -- (-423.781) [-424.709] (-424.079) (-425.419) * (-423.798) [-424.216] (-424.109) (-429.292) -- 0:00:19
189000 -- (-424.139) (-424.532) (-423.182) [-423.161] * [-424.246] (-423.846) (-424.020) (-427.081) -- 0:00:21
189500 -- [-423.761] (-423.771) (-424.578) (-423.809) * (-426.751) (-423.073) (-426.108) [-425.246] -- 0:00:21
190000 -- [-426.669] (-424.985) (-426.598) (-424.461) * (-426.410) [-424.361] (-430.255) (-427.266) -- 0:00:21
Average standard deviation of split frequencies: 0.018761
190500 -- (-424.652) (-426.747) [-428.246] (-427.532) * (-426.111) (-426.673) (-425.615) [-426.799] -- 0:00:21
191000 -- (-427.507) [-424.929] (-426.047) (-427.501) * (-425.668) (-423.533) (-425.066) [-428.648] -- 0:00:21
191500 -- (-426.227) [-422.982] (-425.598) (-426.726) * (-423.993) (-427.105) [-423.713] (-424.989) -- 0:00:20
192000 -- (-423.333) (-424.381) [-426.717] (-426.406) * (-429.930) (-425.345) [-429.392] (-425.441) -- 0:00:20
192500 -- (-424.450) [-425.958] (-426.067) (-425.222) * [-424.315] (-425.411) (-426.612) (-425.137) -- 0:00:20
193000 -- (-424.548) (-423.937) [-426.236] (-425.654) * (-426.426) (-424.864) (-427.178) [-424.648] -- 0:00:20
193500 -- [-422.852] (-423.376) (-426.626) (-424.720) * (-427.532) (-426.470) [-427.111] (-426.561) -- 0:00:20
194000 -- (-424.742) [-424.531] (-424.893) (-427.208) * [-425.876] (-424.725) (-425.180) (-425.493) -- 0:00:20
194500 -- (-426.070) (-426.162) [-426.427] (-424.342) * [-425.206] (-423.464) (-430.830) (-423.864) -- 0:00:20
195000 -- (-423.457) [-424.666] (-425.240) (-424.041) * (-424.775) [-423.417] (-430.091) (-423.220) -- 0:00:20
Average standard deviation of split frequencies: 0.018534
195500 -- (-424.937) (-423.430) [-423.995] (-423.865) * (-425.614) [-423.417] (-426.676) (-424.428) -- 0:00:20
196000 -- (-424.078) (-425.825) (-425.126) [-424.983] * (-424.976) [-423.045] (-427.568) (-424.819) -- 0:00:20
196500 -- (-424.700) [-424.828] (-423.523) (-426.929) * (-427.441) (-428.616) (-423.031) [-424.406] -- 0:00:20
197000 -- [-425.331] (-424.143) (-424.743) (-427.958) * [-426.803] (-423.690) (-428.385) (-424.905) -- 0:00:19
197500 -- (-424.111) (-425.305) [-424.188] (-423.833) * (-429.235) (-423.012) [-426.473] (-432.172) -- 0:00:19
198000 -- [-428.093] (-425.134) (-426.830) (-427.973) * (-428.608) (-425.145) [-425.259] (-425.566) -- 0:00:19
198500 -- (-424.739) (-426.693) (-423.162) [-424.363] * (-425.793) (-424.208) [-423.146] (-429.194) -- 0:00:19
199000 -- [-425.940] (-425.498) (-424.958) (-434.203) * (-425.526) [-425.275] (-425.287) (-424.059) -- 0:00:19
199500 -- (-423.768) [-423.678] (-424.168) (-424.981) * (-424.982) (-425.979) (-423.991) [-423.049] -- 0:00:19
200000 -- (-425.064) (-423.518) [-426.424] (-429.292) * [-423.746] (-424.585) (-424.299) (-427.807) -- 0:00:19
Average standard deviation of split frequencies: 0.018794
200500 -- (-424.312) (-424.867) [-427.543] (-428.018) * (-425.258) (-427.868) [-424.375] (-424.907) -- 0:00:19
201000 -- (-424.145) (-425.915) [-428.452] (-424.837) * (-425.357) (-428.879) (-423.690) [-423.530] -- 0:00:19
201500 -- (-424.196) (-422.817) [-425.476] (-424.863) * (-427.521) (-426.255) (-425.121) [-423.416] -- 0:00:19
202000 -- (-424.206) (-423.316) [-424.271] (-424.616) * (-423.874) [-423.971] (-424.340) (-425.681) -- 0:00:19
202500 -- [-423.797] (-427.754) (-426.614) (-423.415) * (-424.693) (-424.192) [-424.417] (-423.324) -- 0:00:19
203000 -- [-424.038] (-426.536) (-423.649) (-423.366) * (-424.137) [-424.595] (-426.041) (-425.153) -- 0:00:19
203500 -- (-425.226) (-424.093) [-423.564] (-423.636) * (-423.301) (-429.805) [-424.161] (-428.165) -- 0:00:18
204000 -- (-429.127) (-423.883) [-423.173] (-423.510) * (-425.879) (-427.049) [-426.831] (-424.284) -- 0:00:20
204500 -- [-426.700] (-425.552) (-427.102) (-423.558) * (-426.907) [-423.667] (-423.829) (-433.206) -- 0:00:20
205000 -- [-424.879] (-424.344) (-426.165) (-424.006) * (-428.795) (-426.937) [-425.196] (-427.121) -- 0:00:20
Average standard deviation of split frequencies: 0.018307
205500 -- (-424.785) [-425.305] (-426.156) (-423.800) * (-422.918) (-425.412) [-424.123] (-427.383) -- 0:00:20
206000 -- [-425.961] (-425.387) (-424.950) (-423.838) * (-423.096) (-424.684) [-424.610] (-427.106) -- 0:00:19
206500 -- (-426.128) (-424.269) (-424.121) [-425.513] * (-424.604) (-423.988) (-427.293) [-424.230] -- 0:00:19
207000 -- (-426.424) (-424.611) (-423.871) [-423.327] * (-424.823) (-427.861) [-425.507] (-425.063) -- 0:00:19
207500 -- [-424.428] (-423.738) (-425.843) (-425.181) * (-425.075) (-424.346) [-424.359] (-427.272) -- 0:00:19
208000 -- (-423.524) (-423.933) (-423.476) [-424.334] * (-425.799) [-425.804] (-427.550) (-424.461) -- 0:00:19
208500 -- (-427.712) [-423.136] (-426.014) (-424.442) * [-428.322] (-423.380) (-427.067) (-423.223) -- 0:00:19
209000 -- (-425.884) (-428.564) [-423.849] (-423.697) * (-426.565) (-427.874) [-425.252] (-425.493) -- 0:00:19
209500 -- (-423.106) [-422.978] (-425.020) (-423.764) * (-427.286) (-424.491) (-425.691) [-424.285] -- 0:00:19
210000 -- (-427.662) (-430.555) [-426.115] (-423.698) * [-424.922] (-425.111) (-425.480) (-427.511) -- 0:00:19
Average standard deviation of split frequencies: 0.019580
210500 -- (-423.734) (-424.549) (-426.623) [-424.174] * (-424.389) (-427.147) [-423.448] (-424.573) -- 0:00:19
211000 -- [-425.526] (-423.539) (-426.287) (-425.260) * [-425.840] (-424.833) (-427.249) (-429.069) -- 0:00:19
211500 -- (-425.346) (-425.230) [-426.660] (-424.681) * [-424.431] (-428.815) (-425.552) (-425.331) -- 0:00:19
212000 -- (-424.310) (-422.892) [-424.886] (-427.120) * (-424.299) [-430.406] (-426.218) (-427.073) -- 0:00:19
212500 -- (-424.441) (-424.290) (-427.863) [-425.930] * (-425.889) (-428.178) (-426.790) [-424.000] -- 0:00:18
213000 -- (-425.884) (-424.060) [-423.342] (-425.143) * (-425.586) (-426.306) [-425.702] (-430.968) -- 0:00:18
213500 -- [-424.996] (-425.336) (-425.628) (-424.935) * (-425.122) (-427.715) (-427.726) [-426.566] -- 0:00:18
214000 -- [-424.453] (-424.408) (-423.706) (-423.870) * [-424.985] (-426.149) (-427.628) (-423.646) -- 0:00:18
214500 -- [-426.429] (-423.287) (-423.347) (-427.319) * [-424.331] (-423.022) (-425.218) (-423.092) -- 0:00:18
215000 -- (-426.840) [-424.487] (-424.299) (-430.810) * [-423.823] (-425.288) (-426.009) (-426.200) -- 0:00:18
Average standard deviation of split frequencies: 0.018101
215500 -- (-425.453) (-423.489) (-424.058) [-423.735] * (-424.838) (-423.747) [-425.310] (-427.911) -- 0:00:18
216000 -- (-424.582) (-423.425) [-423.136] (-424.902) * (-423.170) (-424.781) (-427.260) [-424.558] -- 0:00:18
216500 -- (-426.050) (-429.355) [-424.906] (-426.697) * (-425.352) (-424.247) (-426.629) [-423.983] -- 0:00:18
217000 -- [-423.856] (-424.665) (-424.888) (-427.591) * (-424.614) [-424.739] (-425.239) (-425.247) -- 0:00:18
217500 -- (-424.476) [-426.618] (-424.572) (-432.778) * (-424.976) (-429.134) [-423.036] (-425.624) -- 0:00:18
218000 -- (-426.369) [-425.232] (-424.293) (-424.369) * (-424.647) (-428.733) [-423.095] (-424.192) -- 0:00:18
218500 -- (-423.241) [-423.788] (-424.630) (-427.040) * (-425.435) (-425.364) (-426.801) [-424.491] -- 0:00:18
219000 -- (-426.010) (-426.844) [-424.015] (-427.512) * (-424.911) [-426.839] (-426.040) (-424.113) -- 0:00:17
219500 -- [-424.629] (-425.784) (-425.322) (-428.915) * (-425.365) (-425.525) (-423.241) [-424.538] -- 0:00:19
220000 -- (-422.626) (-425.985) (-423.809) [-425.008] * (-423.814) (-427.264) [-426.604] (-426.683) -- 0:00:19
Average standard deviation of split frequencies: 0.016022
220500 -- (-423.592) (-424.912) (-424.732) [-424.087] * (-423.610) [-426.686] (-426.733) (-430.654) -- 0:00:19
221000 -- (-425.463) (-427.550) [-423.590] (-425.343) * (-424.358) (-426.144) (-423.413) [-423.104] -- 0:00:18
221500 -- (-423.685) (-423.999) [-422.840] (-426.561) * (-424.128) (-426.211) (-425.592) [-424.414] -- 0:00:18
222000 -- (-423.733) (-423.326) (-422.698) [-424.016] * (-426.451) (-423.627) [-423.257] (-423.645) -- 0:00:18
222500 -- (-428.835) (-424.824) [-423.433] (-425.202) * (-424.365) (-423.687) (-424.151) [-426.929] -- 0:00:18
223000 -- (-426.036) (-425.557) [-423.687] (-422.681) * (-423.695) (-425.002) [-426.153] (-428.811) -- 0:00:18
223500 -- (-425.170) (-425.043) [-425.005] (-424.500) * (-424.430) (-427.963) (-425.721) [-426.299] -- 0:00:18
224000 -- (-424.785) [-423.890] (-425.395) (-425.059) * (-426.351) [-426.946] (-427.336) (-424.512) -- 0:00:18
224500 -- (-425.024) (-426.220) [-424.656] (-425.488) * (-432.380) (-425.650) [-426.939] (-425.417) -- 0:00:18
225000 -- (-427.289) (-424.466) (-424.597) [-423.232] * (-424.611) (-423.284) (-427.153) [-424.810] -- 0:00:18
Average standard deviation of split frequencies: 0.015412
225500 -- [-424.547] (-425.196) (-424.486) (-423.163) * (-427.845) [-423.521] (-424.576) (-424.955) -- 0:00:18
226000 -- (-425.566) (-424.192) (-425.276) [-425.783] * (-426.041) (-428.493) [-424.140] (-426.859) -- 0:00:18
226500 -- (-427.303) (-426.054) [-424.392] (-423.210) * (-427.808) (-426.472) (-424.281) [-426.799] -- 0:00:18
227000 -- (-426.087) (-424.817) (-423.056) [-423.369] * (-427.499) (-424.570) (-427.581) [-428.638] -- 0:00:18
227500 -- [-424.646] (-426.804) (-429.153) (-424.255) * (-425.607) [-423.033] (-429.029) (-427.827) -- 0:00:17
228000 -- (-423.924) [-425.877] (-433.280) (-428.289) * [-430.566] (-429.324) (-425.185) (-425.219) -- 0:00:17
228500 -- [-425.504] (-424.665) (-426.016) (-425.431) * (-430.850) (-427.442) (-426.351) [-424.243] -- 0:00:17
229000 -- (-428.947) (-423.084) (-427.585) [-425.827] * [-426.645] (-423.981) (-424.163) (-425.623) -- 0:00:17
229500 -- (-423.644) (-423.559) (-426.597) [-423.764] * (-426.106) (-425.448) (-425.732) [-426.024] -- 0:00:17
230000 -- (-426.064) (-423.032) [-423.713] (-423.361) * [-425.398] (-423.720) (-424.338) (-425.973) -- 0:00:17
Average standard deviation of split frequencies: 0.014306
230500 -- (-425.078) (-425.973) [-423.827] (-429.100) * [-426.541] (-423.785) (-424.740) (-427.250) -- 0:00:17
231000 -- [-424.231] (-426.780) (-424.904) (-426.192) * (-429.488) (-427.473) (-423.766) [-426.150] -- 0:00:17
231500 -- (-424.797) (-426.458) [-423.829] (-427.126) * (-429.471) [-422.942] (-426.851) (-424.797) -- 0:00:17
232000 -- (-430.176) (-429.837) (-428.459) [-424.306] * (-425.631) [-425.553] (-425.921) (-424.927) -- 0:00:17
232500 -- (-427.233) (-430.243) (-424.858) [-425.637] * (-428.116) (-426.856) [-423.812] (-424.660) -- 0:00:17
233000 -- (-423.418) (-430.107) [-424.210] (-423.655) * (-425.452) [-423.260] (-424.414) (-427.421) -- 0:00:17
233500 -- (-424.358) [-428.937] (-424.419) (-425.694) * [-425.206] (-427.867) (-424.426) (-427.464) -- 0:00:17
234000 -- (-424.256) (-424.097) [-423.965] (-429.234) * [-430.370] (-427.252) (-424.146) (-424.958) -- 0:00:17
234500 -- (-425.251) [-424.817] (-424.543) (-425.072) * (-423.576) (-427.548) (-424.693) [-426.441] -- 0:00:16
235000 -- (-427.437) (-424.797) [-426.879] (-425.723) * (-426.136) (-427.408) [-424.109] (-426.576) -- 0:00:16
Average standard deviation of split frequencies: 0.015275
235500 -- (-426.659) (-424.322) [-426.119] (-428.316) * (-426.768) (-425.752) (-424.538) [-428.217] -- 0:00:17
236000 -- [-428.175] (-425.072) (-426.925) (-426.315) * (-425.214) (-428.711) [-423.735] (-427.857) -- 0:00:17
236500 -- [-426.515] (-425.315) (-425.099) (-424.513) * (-426.779) (-425.491) [-423.606] (-423.312) -- 0:00:17
237000 -- (-424.231) [-424.182] (-425.567) (-423.058) * (-428.143) (-423.905) (-425.106) [-426.530] -- 0:00:17
237500 -- (-426.021) [-423.730] (-424.289) (-427.518) * (-424.856) [-426.561] (-423.467) (-424.029) -- 0:00:17
238000 -- (-424.169) (-427.578) (-423.351) [-425.375] * (-424.003) (-428.309) (-422.968) [-425.232] -- 0:00:17
238500 -- [-424.095] (-423.257) (-425.518) (-423.168) * [-424.986] (-424.145) (-423.287) (-423.978) -- 0:00:17
239000 -- (-424.011) [-423.139] (-427.676) (-425.734) * (-423.057) (-424.062) (-426.607) [-424.819] -- 0:00:17
239500 -- (-426.286) [-425.011] (-426.305) (-423.251) * (-424.966) (-425.515) [-424.950] (-424.264) -- 0:00:17
240000 -- (-425.228) (-423.967) [-424.130] (-424.686) * [-429.458] (-426.604) (-423.644) (-426.160) -- 0:00:17
Average standard deviation of split frequencies: 0.015440
240500 -- (-425.652) [-426.193] (-428.217) (-424.313) * (-425.534) [-426.678] (-424.931) (-423.705) -- 0:00:17
241000 -- (-424.591) (-423.989) (-426.374) [-424.121] * (-426.136) (-427.420) (-426.376) [-422.862] -- 0:00:17
241500 -- (-424.450) [-423.700] (-425.701) (-424.578) * (-426.884) (-424.127) (-425.690) [-426.846] -- 0:00:17
242000 -- (-425.918) [-424.788] (-427.825) (-424.305) * (-428.737) [-424.051] (-428.481) (-424.371) -- 0:00:17
242500 -- (-424.251) [-423.455] (-425.342) (-424.789) * [-424.914] (-427.524) (-426.324) (-425.529) -- 0:00:16
243000 -- [-423.921] (-426.596) (-427.271) (-424.621) * [-424.347] (-423.450) (-423.665) (-425.691) -- 0:00:16
243500 -- (-425.380) (-428.303) (-426.832) [-423.426] * (-424.541) (-426.963) (-423.291) [-425.161] -- 0:00:16
244000 -- [-425.301] (-425.542) (-425.917) (-423.931) * (-424.026) (-428.003) (-424.843) [-424.510] -- 0:00:16
244500 -- (-425.044) (-433.719) (-428.043) [-429.239] * (-424.446) [-424.091] (-423.870) (-422.769) -- 0:00:16
245000 -- (-424.112) [-428.516] (-424.566) (-424.455) * [-423.781] (-426.524) (-431.220) (-425.306) -- 0:00:16
Average standard deviation of split frequencies: 0.016457
245500 -- [-424.509] (-429.036) (-425.065) (-423.845) * (-428.324) [-426.331] (-425.763) (-423.480) -- 0:00:16
246000 -- [-424.926] (-424.935) (-424.361) (-426.748) * (-424.057) [-426.374] (-426.647) (-424.924) -- 0:00:16
246500 -- (-425.277) [-427.925] (-424.242) (-427.971) * (-427.436) (-426.748) (-425.715) [-423.341] -- 0:00:16
247000 -- (-424.834) (-425.393) [-427.126] (-425.229) * [-424.743] (-425.726) (-427.741) (-424.935) -- 0:00:16
247500 -- (-424.663) [-427.725] (-424.230) (-424.409) * [-424.679] (-428.010) (-427.895) (-424.498) -- 0:00:16
248000 -- (-424.911) (-426.964) (-428.590) [-425.005] * (-424.246) (-425.189) (-424.005) [-425.830] -- 0:00:16
248500 -- (-423.401) (-423.967) (-427.417) [-429.034] * (-424.289) (-424.114) [-425.213] (-424.294) -- 0:00:16
249000 -- (-427.438) (-423.158) [-428.323] (-427.229) * (-424.625) (-423.718) [-426.897] (-423.718) -- 0:00:16
249500 -- (-427.265) [-424.133] (-425.288) (-423.716) * (-423.429) (-425.493) (-424.432) [-425.347] -- 0:00:16
250000 -- [-423.983] (-423.325) (-427.424) (-423.507) * (-426.261) [-424.052] (-425.765) (-423.732) -- 0:00:16
Average standard deviation of split frequencies: 0.016262
250500 -- (-423.502) (-423.796) [-424.417] (-423.266) * [-425.432] (-424.638) (-426.725) (-424.604) -- 0:00:15
251000 -- [-424.477] (-424.296) (-424.862) (-425.835) * (-428.069) [-425.216] (-428.828) (-424.361) -- 0:00:16
251500 -- [-425.093] (-425.630) (-424.438) (-426.829) * (-426.182) [-423.690] (-429.886) (-424.287) -- 0:00:16
252000 -- (-426.956) (-428.271) (-425.340) [-423.902] * (-425.848) [-423.374] (-425.144) (-424.527) -- 0:00:16
252500 -- [-423.282] (-424.814) (-424.603) (-425.039) * (-424.354) (-423.468) [-424.376] (-423.721) -- 0:00:16
253000 -- (-423.147) (-424.312) (-424.213) [-425.692] * (-431.655) (-425.848) [-424.710] (-426.828) -- 0:00:16
253500 -- [-425.657] (-424.708) (-424.267) (-426.293) * [-426.551] (-425.159) (-422.811) (-425.267) -- 0:00:16
254000 -- (-425.976) [-425.353] (-426.701) (-425.118) * (-427.343) [-424.335] (-424.127) (-431.958) -- 0:00:16
254500 -- (-424.168) (-423.633) [-426.044] (-424.385) * [-422.878] (-427.828) (-425.254) (-424.246) -- 0:00:16
255000 -- (-428.380) (-423.813) [-422.953] (-426.767) * (-423.831) (-425.879) [-423.857] (-424.980) -- 0:00:16
Average standard deviation of split frequencies: 0.015815
255500 -- (-424.776) (-423.289) [-425.525] (-425.032) * (-425.990) (-426.009) [-425.555] (-424.748) -- 0:00:16
256000 -- (-432.866) [-423.827] (-428.081) (-423.580) * (-427.821) [-423.655] (-423.577) (-425.337) -- 0:00:16
256500 -- (-429.714) [-424.096] (-425.370) (-424.517) * (-422.958) (-425.965) [-424.178] (-428.622) -- 0:00:16
257000 -- (-425.142) (-426.693) [-423.927] (-428.156) * (-428.436) (-423.068) [-425.092] (-425.805) -- 0:00:16
257500 -- (-423.499) (-426.064) (-425.149) [-424.121] * [-425.800] (-423.444) (-425.969) (-425.885) -- 0:00:16
258000 -- [-423.691] (-424.311) (-424.564) (-422.889) * (-423.298) (-426.385) (-424.547) [-423.807] -- 0:00:15
258500 -- (-424.082) (-427.940) (-425.182) [-424.987] * (-426.670) (-423.931) [-427.093] (-425.115) -- 0:00:15
259000 -- (-423.117) (-425.240) (-427.480) [-424.883] * (-428.232) (-422.887) (-425.933) [-430.100] -- 0:00:15
259500 -- (-423.241) (-424.856) (-428.743) [-423.513] * [-422.964] (-423.440) (-424.554) (-427.412) -- 0:00:15
260000 -- (-425.464) (-424.467) (-426.609) [-428.493] * (-424.494) [-428.942] (-426.686) (-424.338) -- 0:00:15
Average standard deviation of split frequencies: 0.015800
260500 -- (-425.759) (-426.776) (-423.436) [-424.395] * (-427.103) [-424.735] (-425.008) (-424.325) -- 0:00:15
261000 -- (-425.789) [-424.294] (-424.540) (-426.238) * [-424.296] (-426.860) (-424.530) (-426.322) -- 0:00:15
261500 -- (-426.426) [-426.130] (-427.196) (-423.739) * (-423.888) [-427.207] (-426.023) (-429.152) -- 0:00:15
262000 -- [-425.116] (-429.557) (-424.795) (-429.150) * [-424.404] (-423.516) (-423.780) (-424.711) -- 0:00:15
262500 -- (-426.819) (-429.652) [-425.799] (-427.847) * (-423.952) (-424.676) [-423.785] (-426.423) -- 0:00:15
263000 -- (-427.011) (-428.330) (-427.289) [-423.149] * (-425.837) (-425.145) [-425.925] (-424.039) -- 0:00:15
263500 -- (-426.951) (-426.442) [-428.839] (-432.015) * (-430.309) (-426.424) (-424.306) [-423.595] -- 0:00:15
264000 -- (-423.540) (-428.718) [-427.778] (-425.378) * (-423.999) (-424.788) (-426.153) [-423.045] -- 0:00:15
264500 -- (-424.080) (-427.421) (-424.412) [-427.259] * (-425.557) (-429.125) (-429.708) [-426.530] -- 0:00:15
265000 -- (-425.741) (-428.169) (-424.085) [-423.179] * [-425.768] (-424.082) (-423.672) (-429.230) -- 0:00:15
Average standard deviation of split frequencies: 0.015577
265500 -- (-425.515) (-430.491) (-430.151) [-424.849] * (-425.331) (-424.989) (-423.884) [-427.229] -- 0:00:15
266000 -- (-423.250) (-426.980) (-426.326) [-425.504] * (-423.427) (-425.882) [-423.792] (-429.609) -- 0:00:14
266500 -- [-429.092] (-427.443) (-424.121) (-423.741) * (-424.106) (-426.249) (-425.387) [-427.370] -- 0:00:15
267000 -- (-427.912) (-424.587) (-424.441) [-424.035] * [-425.344] (-424.419) (-424.001) (-425.127) -- 0:00:15
267500 -- (-425.210) [-424.941] (-428.034) (-429.224) * [-425.921] (-424.308) (-428.314) (-429.094) -- 0:00:15
268000 -- [-427.107] (-424.982) (-423.009) (-424.757) * (-425.607) [-424.141] (-426.404) (-425.231) -- 0:00:15
268500 -- (-427.627) (-425.714) [-425.357] (-424.317) * (-423.904) [-425.563] (-424.493) (-425.467) -- 0:00:15
269000 -- (-423.384) (-425.264) (-425.412) [-424.684] * [-423.534] (-423.547) (-429.942) (-423.946) -- 0:00:15
269500 -- (-427.748) [-424.094] (-424.057) (-425.755) * (-424.108) (-426.438) [-425.244] (-424.983) -- 0:00:15
270000 -- (-425.664) (-425.275) (-424.210) [-423.959] * (-427.077) (-427.145) [-426.504] (-426.970) -- 0:00:15
Average standard deviation of split frequencies: 0.015094
270500 -- (-424.601) [-425.587] (-425.079) (-425.762) * (-427.504) (-426.100) [-423.991] (-429.321) -- 0:00:15
271000 -- [-424.178] (-429.346) (-426.333) (-424.235) * (-423.879) (-424.697) [-423.052] (-425.896) -- 0:00:15
271500 -- (-425.446) (-424.683) (-423.450) [-424.211] * (-423.665) (-426.708) [-423.989] (-425.065) -- 0:00:15
272000 -- [-426.524] (-423.890) (-423.385) (-427.279) * (-424.573) (-430.975) (-425.008) [-424.453] -- 0:00:15
272500 -- (-426.112) [-426.544] (-428.425) (-429.421) * (-424.483) (-425.514) (-423.411) [-423.466] -- 0:00:15
273000 -- [-424.656] (-429.509) (-424.998) (-423.019) * [-423.060] (-426.561) (-425.752) (-423.798) -- 0:00:14
273500 -- (-423.811) (-425.777) (-428.447) [-422.753] * (-425.065) (-426.431) (-426.467) [-429.028] -- 0:00:14
274000 -- (-424.907) [-426.112] (-424.992) (-424.271) * (-426.172) [-426.595] (-424.012) (-423.007) -- 0:00:14
274500 -- [-424.744] (-426.124) (-424.136) (-429.227) * (-424.057) (-429.439) [-424.064] (-423.351) -- 0:00:14
275000 -- (-423.991) (-423.683) [-424.899] (-423.240) * (-425.888) (-423.095) (-426.284) [-425.030] -- 0:00:14
Average standard deviation of split frequencies: 0.015102
275500 -- (-425.839) (-424.887) (-425.193) [-424.611] * [-426.520] (-423.693) (-426.958) (-425.170) -- 0:00:14
276000 -- (-423.995) (-422.649) (-424.423) [-425.054] * (-425.558) (-425.647) [-425.389] (-423.883) -- 0:00:14
276500 -- (-427.770) (-423.055) [-423.630] (-428.356) * (-425.791) (-427.420) [-425.595] (-428.366) -- 0:00:14
277000 -- (-425.250) (-423.788) (-423.383) [-423.413] * [-427.151] (-423.851) (-426.473) (-424.655) -- 0:00:14
277500 -- (-430.422) [-424.555] (-423.568) (-425.004) * [-425.161] (-425.359) (-424.895) (-423.769) -- 0:00:14
278000 -- (-428.397) (-428.075) [-426.306] (-424.037) * (-432.766) (-425.278) [-425.257] (-426.692) -- 0:00:14
278500 -- [-428.552] (-427.450) (-424.455) (-423.883) * (-425.438) (-424.375) (-424.279) [-425.224] -- 0:00:14
279000 -- (-424.774) (-428.386) [-427.109] (-428.407) * (-423.630) [-426.366] (-426.058) (-426.880) -- 0:00:14
279500 -- [-424.051] (-423.905) (-426.097) (-426.157) * (-423.461) [-426.340] (-425.836) (-424.575) -- 0:00:14
280000 -- [-430.933] (-429.742) (-429.667) (-424.417) * (-424.495) (-425.279) [-427.571] (-428.583) -- 0:00:14
Average standard deviation of split frequencies: 0.014409
280500 -- [-424.613] (-425.453) (-426.684) (-426.457) * (-427.487) (-426.307) [-425.980] (-423.178) -- 0:00:14
281000 -- [-425.648] (-423.180) (-425.213) (-427.108) * (-426.381) [-426.488] (-424.901) (-424.321) -- 0:00:14
281500 -- (-427.216) [-427.313] (-423.368) (-425.290) * (-424.833) (-433.440) [-428.197] (-425.459) -- 0:00:13
282000 -- (-428.171) [-425.833] (-422.933) (-427.359) * (-427.473) (-423.685) [-425.407] (-427.755) -- 0:00:13
282500 -- (-424.517) [-427.279] (-423.480) (-426.799) * [-430.252] (-425.613) (-428.745) (-426.575) -- 0:00:14
283000 -- (-426.149) (-425.171) (-425.618) [-423.127] * (-426.045) (-426.550) (-425.788) [-426.638] -- 0:00:14
283500 -- (-424.623) [-426.795] (-424.786) (-423.098) * (-425.566) [-423.625] (-426.036) (-426.926) -- 0:00:14
284000 -- (-423.837) [-425.012] (-422.773) (-427.078) * (-424.829) (-425.996) (-427.773) [-425.575] -- 0:00:14
284500 -- (-429.901) (-423.707) [-423.558] (-424.397) * (-427.180) (-425.540) (-427.213) [-425.469] -- 0:00:14
285000 -- (-423.557) [-423.642] (-424.386) (-424.670) * (-424.525) (-426.956) (-426.148) [-423.506] -- 0:00:14
Average standard deviation of split frequencies: 0.014227
285500 -- (-423.377) (-426.694) [-424.955] (-425.672) * (-428.383) (-425.921) [-424.675] (-423.077) -- 0:00:14
286000 -- (-424.373) [-423.826] (-425.684) (-425.599) * [-425.487] (-426.446) (-424.528) (-424.741) -- 0:00:14
286500 -- (-423.915) (-425.841) (-424.409) [-428.251] * (-424.422) (-426.354) [-428.552] (-424.514) -- 0:00:14
287000 -- (-424.111) [-428.689] (-423.971) (-424.223) * [-424.827] (-427.617) (-423.664) (-425.625) -- 0:00:14
287500 -- (-427.327) [-422.731] (-424.029) (-427.326) * [-426.614] (-424.706) (-424.712) (-424.291) -- 0:00:14
288000 -- (-426.442) (-429.179) [-423.190] (-429.812) * (-423.761) [-425.119] (-424.585) (-423.251) -- 0:00:13
288500 -- (-426.794) (-424.923) [-424.852] (-424.069) * (-424.064) [-423.365] (-424.043) (-425.387) -- 0:00:13
289000 -- [-425.108] (-426.961) (-424.928) (-427.745) * (-426.917) [-425.138] (-425.931) (-423.879) -- 0:00:13
289500 -- (-426.171) (-426.000) (-424.682) [-423.543] * (-428.194) (-428.063) [-423.144] (-425.841) -- 0:00:13
290000 -- (-424.465) [-424.415] (-431.173) (-426.787) * (-426.620) (-431.080) (-424.114) [-425.416] -- 0:00:13
Average standard deviation of split frequencies: 0.013335
290500 -- (-424.804) [-424.349] (-424.465) (-424.560) * (-425.257) (-428.035) [-423.514] (-426.095) -- 0:00:13
291000 -- (-427.704) (-426.640) (-424.716) [-424.354] * (-424.212) (-426.441) [-424.289] (-424.237) -- 0:00:13
291500 -- (-426.152) (-425.124) [-425.369] (-423.520) * (-425.177) (-424.613) (-428.655) [-427.024] -- 0:00:13
292000 -- (-424.396) [-424.372] (-427.632) (-423.216) * (-424.644) (-425.142) [-424.166] (-425.191) -- 0:00:13
292500 -- (-425.611) [-425.859] (-423.459) (-425.033) * (-429.225) (-423.511) (-423.792) [-425.162] -- 0:00:13
293000 -- [-423.826] (-426.279) (-428.349) (-424.303) * (-428.872) [-423.968] (-424.651) (-427.520) -- 0:00:13
293500 -- (-427.527) [-425.548] (-424.302) (-428.455) * [-427.844] (-424.024) (-427.006) (-427.723) -- 0:00:13
294000 -- (-426.401) [-425.346] (-424.397) (-425.790) * [-425.165] (-424.208) (-429.518) (-424.547) -- 0:00:13
294500 -- (-427.268) (-427.323) [-425.504] (-426.757) * (-423.809) (-425.722) [-428.051] (-426.569) -- 0:00:13
295000 -- [-423.124] (-423.757) (-426.445) (-423.335) * (-423.880) (-426.971) [-425.602] (-425.684) -- 0:00:13
Average standard deviation of split frequencies: 0.014035
295500 -- (-424.137) (-424.665) (-427.221) [-424.790] * [-423.305] (-427.447) (-427.524) (-424.020) -- 0:00:13
296000 -- (-426.255) [-423.132] (-425.936) (-423.713) * (-425.028) (-428.587) [-425.694] (-423.896) -- 0:00:13
296500 -- [-425.904] (-422.937) (-424.431) (-429.540) * (-425.492) (-426.561) [-424.828] (-425.371) -- 0:00:13
297000 -- (-425.744) [-423.607] (-425.821) (-426.407) * (-423.727) (-425.538) (-426.250) [-424.263] -- 0:00:12
297500 -- (-423.990) [-427.958] (-424.465) (-425.183) * (-425.153) (-427.861) (-424.701) [-426.359] -- 0:00:12
298000 -- (-422.860) (-423.129) (-424.155) [-425.844] * [-425.409] (-425.111) (-426.005) (-426.456) -- 0:00:13
298500 -- (-424.004) (-426.064) (-423.243) [-424.292] * (-425.233) (-424.024) [-427.738] (-427.117) -- 0:00:13
299000 -- (-424.208) (-425.859) [-425.223] (-423.518) * (-422.937) (-423.769) [-425.404] (-427.535) -- 0:00:13
299500 -- (-427.588) (-425.241) (-426.937) [-424.333] * [-423.852] (-424.314) (-423.884) (-426.749) -- 0:00:13
300000 -- [-423.965] (-428.486) (-428.757) (-429.481) * (-423.838) (-430.171) [-424.637] (-426.655) -- 0:00:13
Average standard deviation of split frequencies: 0.014013
300500 -- (-423.274) [-425.590] (-428.134) (-425.076) * (-423.630) (-428.647) [-423.703] (-427.358) -- 0:00:13
301000 -- [-424.016] (-424.145) (-426.125) (-425.367) * (-426.624) (-427.903) [-426.542] (-428.654) -- 0:00:13
301500 -- [-423.669] (-425.604) (-426.299) (-427.622) * (-427.563) [-423.871] (-425.242) (-423.784) -- 0:00:13
302000 -- (-427.120) [-425.853] (-424.842) (-428.916) * (-424.428) [-424.881] (-422.958) (-428.538) -- 0:00:13
302500 -- (-424.596) (-424.214) (-423.698) [-429.644] * (-424.671) (-425.452) [-424.718] (-425.265) -- 0:00:13
303000 -- (-428.001) (-428.721) [-426.572] (-424.877) * (-424.122) (-424.075) [-428.073] (-424.391) -- 0:00:13
303500 -- [-424.947] (-425.829) (-423.380) (-423.630) * (-423.888) (-428.519) [-427.543] (-425.233) -- 0:00:12
304000 -- (-425.957) (-424.487) (-423.234) [-424.465] * (-423.300) [-425.282] (-430.456) (-425.861) -- 0:00:12
304500 -- (-426.101) (-423.639) [-423.556] (-424.676) * (-424.908) (-425.029) [-426.170] (-425.338) -- 0:00:12
305000 -- (-423.991) (-426.675) (-425.048) [-424.455] * (-424.350) (-426.831) [-424.823] (-426.034) -- 0:00:12
Average standard deviation of split frequencies: 0.013049
305500 -- (-424.825) [-425.363] (-425.084) (-427.677) * (-425.745) (-424.536) (-425.294) [-427.471] -- 0:00:12
306000 -- (-424.854) (-423.802) [-427.130] (-425.249) * (-423.488) (-427.270) [-424.769] (-424.122) -- 0:00:12
306500 -- [-424.066] (-423.002) (-424.958) (-425.908) * (-426.807) (-426.690) [-424.946] (-423.822) -- 0:00:12
307000 -- (-423.866) [-424.412] (-423.725) (-424.640) * (-428.369) (-428.332) (-422.845) [-424.480] -- 0:00:12
307500 -- (-423.469) [-426.039] (-425.340) (-430.190) * (-427.502) (-427.069) (-425.420) [-424.397] -- 0:00:12
308000 -- (-424.436) (-425.838) [-422.902] (-423.719) * [-424.854] (-427.552) (-428.920) (-424.638) -- 0:00:12
308500 -- [-424.718] (-426.875) (-426.806) (-424.515) * (-425.221) [-424.048] (-425.696) (-423.860) -- 0:00:12
309000 -- [-423.734] (-423.495) (-426.387) (-425.763) * (-424.188) (-424.756) (-425.964) [-423.389] -- 0:00:12
309500 -- [-423.199] (-426.703) (-427.150) (-424.097) * (-425.290) (-427.623) (-424.608) [-423.821] -- 0:00:12
310000 -- (-422.885) (-423.918) [-426.079] (-424.407) * (-423.047) (-425.764) (-424.381) [-424.687] -- 0:00:12
Average standard deviation of split frequencies: 0.011157
310500 -- (-423.557) [-427.048] (-425.833) (-425.656) * (-427.519) (-425.983) [-425.331] (-426.351) -- 0:00:12
311000 -- (-424.989) (-424.419) [-425.625] (-424.704) * (-425.592) [-427.140] (-423.773) (-425.083) -- 0:00:12
311500 -- (-426.782) (-425.666) (-425.285) [-423.476] * (-423.025) [-425.391] (-426.793) (-428.170) -- 0:00:12
312000 -- (-427.422) (-424.006) (-423.914) [-426.095] * (-425.889) [-427.919] (-426.813) (-424.702) -- 0:00:12
312500 -- (-423.325) (-423.431) [-425.839] (-426.812) * (-425.871) (-428.175) (-425.556) [-426.807] -- 0:00:12
313000 -- [-423.694] (-424.524) (-429.027) (-424.726) * [-425.152] (-428.917) (-422.818) (-427.286) -- 0:00:12
313500 -- (-425.681) (-423.304) [-428.551] (-426.462) * (-424.146) [-423.580] (-426.187) (-424.217) -- 0:00:12
314000 -- (-425.416) (-424.305) (-423.852) [-429.760] * [-423.106] (-423.734) (-432.822) (-424.467) -- 0:00:12
314500 -- (-425.020) (-426.564) (-423.660) [-426.298] * (-425.503) (-425.081) (-430.971) [-424.209] -- 0:00:12
315000 -- (-426.528) (-430.473) [-423.415] (-424.230) * [-422.966] (-426.722) (-423.733) (-427.619) -- 0:00:12
Average standard deviation of split frequencies: 0.011057
315500 -- (-430.121) [-423.072] (-423.107) (-425.420) * [-423.161] (-425.418) (-423.892) (-424.346) -- 0:00:12
316000 -- (-431.930) [-422.829] (-424.902) (-425.951) * (-423.530) (-424.868) (-425.998) [-423.137] -- 0:00:12
316500 -- (-429.942) (-423.983) [-424.642] (-425.663) * (-424.465) (-424.020) (-425.272) [-424.244] -- 0:00:12
317000 -- [-422.772] (-423.614) (-424.824) (-424.958) * (-424.840) (-428.661) [-423.626] (-424.341) -- 0:00:12
317500 -- [-423.599] (-428.712) (-426.027) (-424.227) * (-431.418) [-427.950] (-423.788) (-424.434) -- 0:00:12
318000 -- (-422.903) (-429.473) (-424.973) [-424.981] * [-432.943] (-424.560) (-424.062) (-428.500) -- 0:00:12
318500 -- (-425.266) (-424.064) (-423.704) [-426.443] * (-425.135) (-423.137) [-425.037] (-428.755) -- 0:00:11
319000 -- (-424.455) (-425.515) [-423.938] (-427.476) * (-426.370) (-426.753) [-425.465] (-425.045) -- 0:00:11
319500 -- (-426.618) [-424.323] (-427.277) (-423.813) * [-423.874] (-424.447) (-424.359) (-423.673) -- 0:00:11
320000 -- [-426.104] (-424.418) (-426.566) (-423.348) * (-428.410) [-428.049] (-424.863) (-423.685) -- 0:00:11
Average standard deviation of split frequencies: 0.010896
320500 -- (-425.192) [-424.861] (-426.535) (-424.921) * (-424.011) (-427.930) (-424.823) [-424.506] -- 0:00:11
321000 -- [-424.363] (-426.077) (-425.249) (-424.394) * (-423.609) [-426.665] (-425.844) (-430.515) -- 0:00:11
321500 -- [-424.575] (-426.558) (-429.754) (-423.669) * (-426.119) [-423.806] (-428.181) (-425.696) -- 0:00:11
322000 -- (-423.450) (-426.766) [-423.595] (-424.986) * [-423.990] (-423.775) (-425.508) (-427.440) -- 0:00:11
322500 -- (-422.944) (-426.263) (-428.709) [-427.592] * (-423.152) [-422.656] (-423.792) (-425.701) -- 0:00:11
323000 -- (-423.776) [-424.391] (-428.991) (-425.973) * (-423.762) [-422.824] (-423.557) (-423.991) -- 0:00:11
323500 -- (-424.230) [-423.938] (-425.335) (-426.995) * (-424.487) (-423.783) [-425.213] (-422.965) -- 0:00:11
324000 -- (-423.795) (-424.673) [-423.007] (-429.753) * (-425.055) (-425.225) (-425.595) [-425.301] -- 0:00:11
324500 -- (-424.175) (-424.412) [-423.952] (-425.694) * (-425.053) [-428.481] (-426.138) (-425.157) -- 0:00:11
325000 -- (-424.589) [-424.275] (-426.733) (-427.278) * (-426.124) [-423.164] (-425.665) (-429.117) -- 0:00:11
Average standard deviation of split frequencies: 0.011058
325500 -- [-424.301] (-422.963) (-430.273) (-423.322) * [-423.584] (-423.582) (-425.766) (-424.663) -- 0:00:11
326000 -- (-424.355) (-422.838) (-424.002) [-423.209] * [-425.022] (-425.868) (-425.955) (-423.625) -- 0:00:11
326500 -- (-424.874) (-424.407) (-423.564) [-425.839] * (-426.729) (-426.234) (-424.731) [-424.923] -- 0:00:11
327000 -- [-424.114] (-426.584) (-423.766) (-423.289) * (-425.810) (-431.552) (-425.364) [-424.961] -- 0:00:11
327500 -- (-424.186) (-426.098) [-424.662] (-426.199) * (-427.015) (-425.300) [-427.462] (-429.077) -- 0:00:11
328000 -- (-425.107) (-424.037) [-423.938] (-423.277) * [-427.834] (-426.926) (-424.004) (-424.732) -- 0:00:11
328500 -- [-428.038] (-426.417) (-423.811) (-425.129) * [-426.722] (-423.141) (-423.688) (-424.952) -- 0:00:11
329000 -- [-423.949] (-423.804) (-424.254) (-422.827) * (-424.600) [-423.387] (-422.840) (-427.472) -- 0:00:11
329500 -- (-425.705) (-424.593) [-435.804] (-425.018) * [-430.991] (-424.850) (-425.305) (-426.073) -- 0:00:11
330000 -- (-425.054) [-422.853] (-426.936) (-426.531) * (-425.738) (-424.005) [-424.373] (-426.058) -- 0:00:11
Average standard deviation of split frequencies: 0.011326
330500 -- (-424.576) [-422.812] (-424.607) (-425.261) * [-423.704] (-424.504) (-423.789) (-430.535) -- 0:00:11
331000 -- (-427.260) (-423.675) [-425.051] (-423.381) * (-425.830) [-431.230] (-424.663) (-424.991) -- 0:00:11
331500 -- (-427.315) (-425.530) [-426.804] (-424.589) * [-424.888] (-426.455) (-427.637) (-424.125) -- 0:00:11
332000 -- (-429.660) (-428.634) [-424.150] (-425.251) * [-426.864] (-423.787) (-425.273) (-425.681) -- 0:00:11
332500 -- [-428.009] (-425.078) (-425.996) (-428.270) * (-427.197) [-423.824] (-423.843) (-428.137) -- 0:00:11
333000 -- (-424.731) [-425.087] (-428.701) (-425.630) * (-426.121) (-425.282) [-423.467] (-426.428) -- 0:00:11
333500 -- (-424.202) [-425.701] (-423.961) (-423.544) * (-423.492) (-425.332) (-425.236) [-425.929] -- 0:00:10
334000 -- (-426.532) (-423.402) [-425.631] (-423.855) * (-425.558) (-425.570) [-424.426] (-425.682) -- 0:00:10
334500 -- [-423.607] (-423.799) (-429.378) (-426.448) * (-424.481) (-424.601) [-422.800] (-427.001) -- 0:00:10
335000 -- [-422.979] (-422.857) (-424.782) (-423.928) * (-426.096) (-425.406) (-424.838) [-426.646] -- 0:00:10
Average standard deviation of split frequencies: 0.011224
335500 -- (-424.907) (-428.006) [-425.163] (-425.601) * (-424.627) (-424.999) [-425.947] (-424.133) -- 0:00:10
336000 -- [-424.463] (-425.962) (-426.455) (-425.814) * (-428.182) (-423.708) [-426.356] (-426.180) -- 0:00:10
336500 -- (-424.824) [-427.362] (-423.672) (-426.215) * (-425.977) [-429.586] (-424.575) (-428.878) -- 0:00:10
337000 -- (-425.731) [-425.148] (-424.420) (-424.075) * [-423.685] (-426.446) (-424.282) (-424.569) -- 0:00:10
337500 -- (-423.308) [-425.510] (-423.640) (-425.259) * (-424.207) (-423.179) [-427.121] (-427.499) -- 0:00:10
338000 -- (-423.028) [-424.365] (-423.296) (-427.728) * (-424.160) (-425.119) (-423.596) [-425.932] -- 0:00:10
338500 -- (-425.727) (-427.465) [-426.095] (-425.390) * (-424.728) (-423.583) (-427.115) [-427.828] -- 0:00:10
339000 -- (-424.974) (-424.557) [-423.656] (-423.114) * [-426.145] (-425.957) (-424.999) (-427.944) -- 0:00:10
339500 -- [-423.826] (-423.236) (-425.266) (-425.055) * [-424.387] (-423.092) (-423.733) (-424.091) -- 0:00:10
340000 -- (-423.739) (-423.498) (-426.254) [-425.602] * (-424.378) [-425.462] (-425.571) (-424.190) -- 0:00:10
Average standard deviation of split frequencies: 0.011416
340500 -- [-426.294] (-424.509) (-423.348) (-424.156) * (-423.487) (-427.177) [-423.566] (-423.730) -- 0:00:10
341000 -- (-430.751) (-428.954) (-424.669) [-424.084] * (-429.832) (-424.504) [-426.146] (-425.476) -- 0:00:10
341500 -- (-425.203) (-424.514) [-423.207] (-426.767) * (-426.400) [-425.451] (-425.835) (-422.811) -- 0:00:10
342000 -- [-424.009] (-429.490) (-423.916) (-425.809) * (-424.070) (-430.290) (-424.413) [-424.699] -- 0:00:10
342500 -- (-425.581) (-426.332) (-425.214) [-424.554] * [-425.705] (-423.320) (-424.141) (-424.618) -- 0:00:10
343000 -- (-426.510) (-426.093) [-426.436] (-423.246) * [-426.483] (-427.258) (-424.530) (-423.450) -- 0:00:10
343500 -- (-425.743) [-423.388] (-428.289) (-423.173) * (-424.677) (-427.532) [-426.757] (-430.422) -- 0:00:10
344000 -- [-427.574] (-425.849) (-423.370) (-425.317) * (-422.812) (-425.714) [-426.025] (-427.224) -- 0:00:10
344500 -- (-429.749) (-427.707) [-424.409] (-424.960) * (-423.236) (-423.236) (-425.046) [-427.741] -- 0:00:10
345000 -- (-425.065) (-431.281) [-424.015] (-423.889) * [-423.513] (-424.913) (-427.410) (-429.074) -- 0:00:10
Average standard deviation of split frequencies: 0.011666
345500 -- (-426.694) (-424.534) [-423.236] (-425.627) * (-425.842) (-426.305) [-423.582] (-431.613) -- 0:00:10
346000 -- (-425.108) (-424.515) (-424.913) [-425.588] * (-426.934) (-426.563) (-425.340) [-422.910] -- 0:00:10
346500 -- [-427.203] (-426.194) (-423.805) (-424.547) * (-424.411) [-426.164] (-424.800) (-427.271) -- 0:00:10
347000 -- [-425.015] (-425.466) (-426.606) (-426.401) * (-423.735) [-424.552] (-425.070) (-424.691) -- 0:00:10
347500 -- [-425.638] (-425.049) (-423.662) (-424.031) * (-424.062) (-423.316) (-426.259) [-424.772] -- 0:00:10
348000 -- [-423.721] (-428.222) (-424.098) (-424.264) * [-425.207] (-424.462) (-427.757) (-423.329) -- 0:00:10
348500 -- (-423.527) (-430.483) [-423.349] (-423.839) * (-427.639) [-424.176] (-427.240) (-423.891) -- 0:00:09
349000 -- (-423.041) [-428.163] (-424.346) (-426.536) * (-423.017) (-426.159) (-422.774) [-423.323] -- 0:00:09
349500 -- (-423.333) (-423.313) (-423.658) [-424.963] * (-423.593) (-427.853) (-426.853) [-425.521] -- 0:00:09
350000 -- (-425.184) [-424.306] (-424.592) (-424.112) * (-428.375) (-425.480) (-425.149) [-424.247] -- 0:00:09
Average standard deviation of split frequencies: 0.011679
350500 -- (-425.348) (-427.295) (-425.717) [-423.815] * (-423.406) [-423.970] (-424.252) (-425.872) -- 0:00:09
351000 -- (-424.913) (-424.925) (-425.618) [-424.034] * (-425.043) (-423.639) [-423.255] (-424.944) -- 0:00:09
351500 -- (-423.305) [-423.226] (-426.276) (-425.517) * (-423.097) (-423.831) [-427.180] (-423.071) -- 0:00:09
352000 -- (-426.576) [-423.786] (-425.228) (-425.517) * [-423.806] (-425.006) (-424.985) (-423.106) -- 0:00:09
352500 -- (-426.934) (-425.665) [-424.476] (-426.780) * (-423.611) (-424.124) (-427.588) [-426.156] -- 0:00:09
353000 -- (-423.680) [-426.434] (-428.379) (-432.636) * [-423.099] (-425.196) (-426.599) (-425.523) -- 0:00:09
353500 -- (-424.833) [-423.067] (-424.624) (-442.139) * (-424.596) [-423.739] (-424.441) (-424.939) -- 0:00:09
354000 -- (-423.945) (-424.389) (-426.206) [-425.241] * (-423.702) (-423.873) (-429.083) [-424.459] -- 0:00:09
354500 -- [-423.236] (-425.163) (-426.712) (-424.761) * (-425.914) (-424.708) [-423.453] (-428.764) -- 0:00:09
355000 -- (-424.777) [-423.920] (-427.099) (-423.182) * (-428.479) [-423.908] (-423.109) (-428.848) -- 0:00:09
Average standard deviation of split frequencies: 0.011504
355500 -- [-424.596] (-428.836) (-426.995) (-425.476) * (-424.223) [-424.996] (-425.131) (-424.199) -- 0:00:09
356000 -- (-424.790) (-425.870) [-424.491] (-426.571) * [-427.543] (-424.961) (-425.219) (-426.066) -- 0:00:09
356500 -- (-427.823) (-424.641) (-425.410) [-424.332] * (-425.438) (-424.071) (-428.653) [-427.864] -- 0:00:09
357000 -- (-425.880) (-426.001) (-426.532) [-425.209] * (-425.020) [-425.515] (-425.785) (-424.981) -- 0:00:09
357500 -- [-427.089] (-425.204) (-428.047) (-425.113) * (-425.567) (-424.885) [-425.767] (-429.526) -- 0:00:09
358000 -- [-424.846] (-423.680) (-423.553) (-424.582) * (-424.933) (-424.829) [-426.973] (-428.178) -- 0:00:09
358500 -- (-424.328) [-425.182] (-423.924) (-424.972) * (-427.231) [-426.562] (-429.225) (-426.333) -- 0:00:09
359000 -- (-424.445) (-423.507) [-426.579] (-426.588) * (-423.967) (-423.965) [-426.557] (-425.478) -- 0:00:09
359500 -- (-426.034) (-425.468) [-425.916] (-427.747) * (-427.867) [-425.321] (-427.133) (-429.038) -- 0:00:09
360000 -- (-425.739) (-427.570) (-424.264) [-423.084] * (-425.585) (-428.501) [-424.427] (-423.127) -- 0:00:09
Average standard deviation of split frequencies: 0.011028
360500 -- (-424.035) (-429.549) (-425.663) [-424.263] * [-424.335] (-427.744) (-425.323) (-425.810) -- 0:00:09
361000 -- (-424.629) (-426.224) (-424.550) [-425.259] * [-425.560] (-429.163) (-426.028) (-426.689) -- 0:00:09
361500 -- (-423.495) (-424.705) [-424.569] (-427.506) * (-424.481) [-425.867] (-424.378) (-423.782) -- 0:00:09
362000 -- [-423.989] (-425.025) (-425.929) (-425.097) * [-424.084] (-426.438) (-425.386) (-424.916) -- 0:00:09
362500 -- (-423.496) (-424.221) [-424.037] (-424.533) * (-428.442) (-424.963) (-426.354) [-423.744] -- 0:00:09
363000 -- [-424.192] (-426.603) (-425.072) (-423.334) * (-427.483) (-424.999) (-425.180) [-424.851] -- 0:00:09
363500 -- [-424.426] (-423.701) (-423.225) (-424.462) * (-426.990) (-426.070) (-423.936) [-424.928] -- 0:00:09
364000 -- (-427.314) [-425.961] (-424.740) (-426.923) * (-429.988) (-424.881) [-423.061] (-424.154) -- 0:00:08
364500 -- (-424.710) (-425.863) [-428.361] (-429.615) * (-426.123) (-427.200) (-424.785) [-423.193] -- 0:00:08
365000 -- (-422.957) (-424.397) [-426.502] (-425.393) * (-427.781) (-424.251) [-425.502] (-424.698) -- 0:00:08
Average standard deviation of split frequencies: 0.010304
365500 -- (-426.230) [-422.882] (-425.503) (-427.998) * (-427.171) (-424.210) [-425.274] (-425.867) -- 0:00:08
366000 -- [-423.789] (-426.909) (-423.675) (-423.209) * [-425.885] (-428.546) (-425.299) (-424.599) -- 0:00:08
366500 -- (-425.946) (-426.708) [-423.007] (-424.585) * (-424.263) [-426.695] (-428.475) (-424.128) -- 0:00:08
367000 -- (-426.798) (-425.357) [-429.802] (-425.436) * [-425.799] (-424.264) (-423.044) (-424.091) -- 0:00:08
367500 -- [-424.019] (-426.986) (-424.503) (-426.868) * [-423.449] (-424.948) (-426.053) (-424.664) -- 0:00:08
368000 -- (-426.564) [-427.138] (-423.428) (-424.694) * (-425.245) [-424.892] (-424.373) (-423.803) -- 0:00:08
368500 -- (-423.855) [-424.246] (-424.555) (-427.561) * (-427.130) (-426.246) (-425.910) [-424.809] -- 0:00:08
369000 -- (-423.978) (-426.803) (-425.618) [-424.693] * [-425.712] (-423.101) (-423.803) (-427.200) -- 0:00:08
369500 -- (-424.702) (-423.119) [-424.090] (-425.925) * (-423.926) (-424.727) [-424.479] (-430.462) -- 0:00:08
370000 -- [-423.100] (-425.008) (-426.137) (-431.027) * (-423.848) (-423.458) (-427.025) [-423.590] -- 0:00:08
Average standard deviation of split frequencies: 0.009936
370500 -- [-425.465] (-425.387) (-425.310) (-427.256) * (-424.130) (-424.711) (-428.770) [-426.059] -- 0:00:08
371000 -- (-425.435) [-424.353] (-426.277) (-423.925) * [-423.218] (-424.617) (-425.608) (-422.872) -- 0:00:08
371500 -- [-426.171] (-424.129) (-424.052) (-425.884) * [-423.079] (-424.546) (-428.628) (-424.919) -- 0:00:08
372000 -- (-423.518) (-424.955) (-425.045) [-424.537] * (-428.195) (-424.613) [-425.678] (-424.847) -- 0:00:08
372500 -- (-424.204) [-423.794] (-424.371) (-428.736) * (-427.688) [-425.255] (-427.473) (-424.964) -- 0:00:08
373000 -- (-423.973) (-428.101) (-426.912) [-423.931] * (-424.983) (-426.660) (-423.807) [-423.665] -- 0:00:08
373500 -- (-423.830) (-424.509) [-424.496] (-424.970) * (-425.514) [-423.177] (-423.891) (-424.259) -- 0:00:08
374000 -- [-424.236] (-424.188) (-425.462) (-433.862) * (-423.508) [-426.121] (-423.599) (-424.893) -- 0:00:08
374500 -- [-424.609] (-423.093) (-425.213) (-425.797) * (-424.205) [-428.261] (-423.293) (-423.840) -- 0:00:08
375000 -- (-423.373) [-425.205] (-423.841) (-423.803) * (-426.064) [-424.087] (-424.799) (-422.848) -- 0:00:08
Average standard deviation of split frequencies: 0.009716
375500 -- (-423.671) [-424.312] (-422.863) (-423.238) * [-425.455] (-426.056) (-423.889) (-425.951) -- 0:00:08
376000 -- (-427.719) [-424.305] (-423.431) (-425.097) * (-425.431) [-425.856] (-427.486) (-423.718) -- 0:00:08
376500 -- (-425.223) (-424.449) [-423.528] (-426.026) * (-431.323) (-424.803) (-431.164) [-426.687] -- 0:00:08
377000 -- [-424.222] (-424.401) (-424.521) (-424.582) * (-426.963) (-428.763) [-424.119] (-425.417) -- 0:00:08
377500 -- (-426.079) [-423.710] (-426.511) (-425.610) * [-423.342] (-424.104) (-424.038) (-425.367) -- 0:00:08
378000 -- (-427.359) (-425.267) (-426.561) [-425.332] * (-425.741) (-425.150) (-425.078) [-424.617] -- 0:00:08
378500 -- (-426.970) (-429.923) [-423.411] (-425.379) * [-425.640] (-424.073) (-429.839) (-427.421) -- 0:00:08
379000 -- (-425.321) (-433.921) [-423.413] (-422.908) * (-426.209) (-423.378) (-423.448) [-423.255] -- 0:00:07
379500 -- (-427.371) [-426.610] (-426.330) (-423.658) * [-423.727] (-427.301) (-423.686) (-422.673) -- 0:00:07
380000 -- (-423.669) [-424.629] (-425.077) (-424.693) * [-423.228] (-426.793) (-427.314) (-422.871) -- 0:00:07
Average standard deviation of split frequencies: 0.008834
380500 -- (-424.371) (-424.852) [-424.401] (-423.229) * [-423.906] (-426.811) (-428.472) (-425.804) -- 0:00:07
381000 -- (-425.734) (-425.198) (-425.755) [-425.158] * (-423.887) (-424.502) [-427.891] (-426.186) -- 0:00:07
381500 -- (-428.490) [-425.480] (-424.318) (-424.355) * (-424.320) (-428.064) (-425.369) [-425.429] -- 0:00:07
382000 -- (-424.257) (-429.814) (-424.942) [-426.664] * [-424.059] (-429.167) (-425.901) (-424.890) -- 0:00:07
382500 -- (-426.541) (-428.622) [-423.412] (-423.385) * (-424.860) [-423.849] (-425.141) (-426.616) -- 0:00:07
383000 -- [-423.738] (-423.964) (-422.892) (-425.404) * (-426.211) (-424.217) [-425.875] (-423.518) -- 0:00:07
383500 -- (-423.071) (-425.927) [-423.133] (-424.801) * (-426.631) [-426.076] (-423.842) (-425.618) -- 0:00:07
384000 -- (-425.690) (-426.131) [-422.879] (-428.189) * (-427.327) [-425.975] (-426.803) (-426.144) -- 0:00:07
384500 -- [-425.204] (-425.500) (-425.312) (-425.677) * (-427.023) [-424.987] (-425.098) (-424.440) -- 0:00:07
385000 -- (-424.005) (-423.407) [-424.855] (-423.595) * [-427.321] (-426.266) (-424.445) (-424.255) -- 0:00:07
Average standard deviation of split frequencies: 0.009770
385500 -- [-423.164] (-424.932) (-423.998) (-428.248) * [-424.709] (-425.267) (-426.091) (-423.685) -- 0:00:07
386000 -- (-425.521) [-424.824] (-423.860) (-428.354) * [-423.566] (-427.102) (-425.761) (-422.921) -- 0:00:07
386500 -- (-425.401) (-424.346) [-423.318] (-426.318) * (-425.088) [-426.935] (-425.878) (-426.061) -- 0:00:07
387000 -- (-426.257) [-425.613] (-424.592) (-426.522) * (-424.043) (-427.722) (-426.166) [-423.157] -- 0:00:07
387500 -- (-423.944) (-424.800) [-424.565] (-429.370) * (-428.195) (-425.419) [-423.358] (-424.229) -- 0:00:07
388000 -- (-423.934) [-426.066] (-423.561) (-422.982) * (-432.944) (-425.251) [-425.917] (-428.062) -- 0:00:07
388500 -- (-431.427) (-427.843) [-423.318] (-425.717) * [-425.985] (-425.624) (-426.484) (-426.050) -- 0:00:07
389000 -- (-428.568) (-424.533) (-423.182) [-425.021] * (-426.801) (-425.722) [-424.538] (-424.972) -- 0:00:07
389500 -- (-425.201) (-426.274) (-423.252) [-423.898] * (-427.445) [-424.132] (-424.268) (-424.942) -- 0:00:07
390000 -- (-424.044) (-427.977) [-423.362] (-424.310) * [-425.243] (-425.960) (-424.264) (-427.283) -- 0:00:07
Average standard deviation of split frequencies: 0.010647
390500 -- (-429.176) (-423.009) [-427.461] (-423.914) * (-425.406) (-423.148) [-426.714] (-424.737) -- 0:00:07
391000 -- [-423.315] (-425.963) (-424.739) (-423.378) * (-426.346) [-426.111] (-428.316) (-427.131) -- 0:00:07
391500 -- (-425.443) (-425.216) (-425.450) [-425.999] * [-423.962] (-423.984) (-426.554) (-424.662) -- 0:00:07
392000 -- (-423.127) [-425.286] (-425.026) (-429.360) * [-423.692] (-423.961) (-425.560) (-424.100) -- 0:00:07
392500 -- [-424.236] (-425.257) (-423.630) (-429.732) * (-428.622) (-425.016) [-424.658] (-426.307) -- 0:00:07
393000 -- [-425.242] (-424.762) (-426.557) (-427.065) * (-423.293) [-426.355] (-425.044) (-424.737) -- 0:00:07
393500 -- (-425.211) (-428.806) [-425.261] (-428.388) * (-423.293) (-423.278) (-425.993) [-424.840] -- 0:00:07
394000 -- [-425.295] (-423.352) (-427.188) (-424.263) * [-423.227] (-425.209) (-426.130) (-428.479) -- 0:00:06
394500 -- [-425.873] (-425.142) (-424.538) (-424.642) * (-426.667) [-427.103] (-425.039) (-427.328) -- 0:00:06
395000 -- (-426.620) (-425.466) [-424.788] (-427.826) * [-426.212] (-423.549) (-428.705) (-426.344) -- 0:00:06
Average standard deviation of split frequencies: 0.010863
395500 -- (-425.452) (-423.779) (-424.823) [-426.664] * (-425.483) [-426.331] (-428.054) (-425.167) -- 0:00:06
396000 -- [-425.580] (-424.035) (-422.776) (-424.941) * (-425.412) (-424.456) [-423.833] (-424.838) -- 0:00:06
396500 -- (-423.372) (-423.506) [-423.963] (-423.578) * (-423.879) (-426.196) (-424.010) [-426.978] -- 0:00:06
397000 -- (-425.129) [-428.683] (-424.061) (-428.117) * [-422.857] (-427.686) (-425.035) (-424.719) -- 0:00:06
397500 -- [-425.650] (-424.372) (-426.897) (-428.389) * [-425.825] (-425.637) (-426.887) (-425.242) -- 0:00:06
398000 -- (-424.516) (-424.740) [-427.098] (-427.829) * (-425.230) (-426.268) [-423.146] (-426.733) -- 0:00:06
398500 -- (-424.310) [-426.051] (-424.650) (-426.095) * (-425.139) [-423.969] (-423.552) (-427.453) -- 0:00:06
399000 -- [-425.504] (-423.711) (-425.259) (-428.451) * (-423.647) (-426.319) [-423.777] (-428.400) -- 0:00:06
399500 -- (-425.372) (-427.570) [-426.367] (-427.791) * (-425.520) (-423.028) (-425.853) [-427.413] -- 0:00:06
400000 -- (-424.444) (-428.647) (-424.007) [-424.517] * [-426.138] (-423.169) (-427.188) (-424.188) -- 0:00:06
Average standard deviation of split frequencies: 0.011618
400500 -- (-427.324) (-430.040) (-427.783) [-426.146] * (-426.153) (-425.126) (-424.622) [-423.295] -- 0:00:06
401000 -- [-426.191] (-424.508) (-423.149) (-424.297) * (-424.649) [-427.761] (-424.071) (-423.262) -- 0:00:06
401500 -- [-427.596] (-425.725) (-424.389) (-424.158) * (-423.308) (-428.995) [-425.815] (-425.587) -- 0:00:06
402000 -- (-432.754) [-426.331] (-425.024) (-423.619) * (-423.093) (-423.470) (-426.186) [-424.269] -- 0:00:06
402500 -- (-429.221) (-424.639) (-427.119) [-426.427] * [-423.525] (-425.645) (-423.522) (-426.801) -- 0:00:06
403000 -- (-425.222) (-424.972) (-424.116) [-423.629] * [-426.909] (-425.941) (-427.542) (-425.040) -- 0:00:06
403500 -- (-427.554) (-424.072) (-424.534) [-427.628] * [-423.422] (-425.108) (-425.834) (-429.763) -- 0:00:06
404000 -- (-424.706) (-425.834) (-423.697) [-423.340] * [-425.867] (-423.715) (-426.005) (-425.430) -- 0:00:06
404500 -- (-425.348) [-427.787] (-424.735) (-425.252) * (-430.705) (-423.176) (-423.770) [-427.014] -- 0:00:06
405000 -- (-428.033) [-425.222] (-427.286) (-424.329) * (-426.982) [-423.898] (-423.340) (-424.095) -- 0:00:06
Average standard deviation of split frequencies: 0.011543
405500 -- (-426.429) [-423.876] (-428.267) (-424.942) * [-424.772] (-427.069) (-424.205) (-423.830) -- 0:00:06
406000 -- (-424.943) (-424.276) (-428.543) [-426.444] * [-424.532] (-426.670) (-425.007) (-427.651) -- 0:00:06
406500 -- (-425.050) [-423.802] (-425.794) (-423.453) * (-423.231) (-430.502) [-423.931] (-431.091) -- 0:00:06
407000 -- (-426.851) (-424.095) (-428.400) [-424.749] * [-423.504] (-426.703) (-424.540) (-425.233) -- 0:00:06
407500 -- [-424.482] (-423.201) (-423.335) (-424.139) * (-424.646) (-423.757) [-430.328] (-424.874) -- 0:00:06
408000 -- (-427.154) (-426.648) [-425.409] (-425.210) * (-431.061) [-424.704] (-427.858) (-426.105) -- 0:00:06
408500 -- (-424.546) (-428.314) [-425.455] (-425.881) * (-426.689) [-425.773] (-425.029) (-431.412) -- 0:00:06
409000 -- (-424.480) (-423.362) (-424.521) [-425.371] * (-423.571) (-426.554) [-423.998] (-427.017) -- 0:00:06
409500 -- [-426.366] (-423.308) (-423.759) (-424.332) * (-423.977) (-424.584) [-423.636] (-426.008) -- 0:00:05
410000 -- (-431.494) [-423.429] (-425.570) (-424.975) * (-426.242) [-426.821] (-423.893) (-428.276) -- 0:00:05
Average standard deviation of split frequencies: 0.012053
410500 -- (-425.970) (-426.764) (-423.605) [-424.720] * (-422.849) [-423.506] (-429.570) (-431.278) -- 0:00:05
411000 -- (-427.160) (-425.881) (-425.442) [-424.873] * (-423.628) (-425.045) [-429.330] (-425.590) -- 0:00:05
411500 -- [-427.087] (-427.169) (-426.591) (-428.270) * [-424.561] (-424.372) (-427.029) (-424.163) -- 0:00:05
412000 -- (-425.376) (-424.457) (-424.809) [-423.861] * [-423.453] (-422.936) (-426.174) (-427.450) -- 0:00:05
412500 -- [-424.749] (-427.180) (-424.812) (-423.474) * (-425.045) (-422.704) (-424.113) [-426.867] -- 0:00:05
413000 -- (-425.139) (-424.952) (-424.342) [-423.659] * (-423.240) [-423.280] (-424.006) (-426.184) -- 0:00:05
413500 -- (-429.856) [-424.270] (-423.743) (-426.366) * [-424.125] (-426.485) (-427.251) (-427.841) -- 0:00:05
414000 -- [-423.696] (-428.433) (-424.080) (-423.947) * (-425.149) (-423.331) [-424.518] (-424.836) -- 0:00:05
414500 -- (-423.244) (-426.357) (-424.586) [-424.021] * (-428.463) (-425.340) (-424.841) [-423.596] -- 0:00:05
415000 -- [-424.325] (-425.694) (-424.724) (-430.808) * [-426.685] (-425.510) (-426.467) (-426.095) -- 0:00:05
Average standard deviation of split frequencies: 0.011828
415500 -- [-425.790] (-426.386) (-426.147) (-424.610) * [-423.123] (-425.872) (-425.459) (-424.420) -- 0:00:05
416000 -- (-425.153) (-423.056) (-423.102) [-423.584] * (-427.290) (-426.896) (-424.139) [-423.867] -- 0:00:05
416500 -- (-425.234) [-425.001] (-424.802) (-428.485) * (-427.627) [-425.035] (-423.113) (-425.800) -- 0:00:05
417000 -- (-425.990) (-426.009) [-425.760] (-422.980) * (-426.608) [-423.121] (-425.489) (-426.045) -- 0:00:05
417500 -- (-424.491) (-427.472) [-425.399] (-427.723) * (-427.426) (-426.310) (-425.402) [-423.790] -- 0:00:05
418000 -- [-424.808] (-425.650) (-425.616) (-426.503) * (-426.271) [-425.017] (-425.289) (-424.492) -- 0:00:05
418500 -- (-423.797) [-424.238] (-426.220) (-428.296) * [-425.184] (-425.578) (-422.863) (-425.826) -- 0:00:05
419000 -- (-424.065) [-425.775] (-424.719) (-423.448) * (-424.273) (-428.706) (-425.341) [-425.681] -- 0:00:05
419500 -- (-424.488) [-425.014] (-423.247) (-425.397) * (-425.948) [-425.646] (-424.194) (-425.616) -- 0:00:05
420000 -- (-424.595) (-427.726) [-426.585] (-426.272) * (-424.866) [-426.164] (-425.179) (-424.447) -- 0:00:05
Average standard deviation of split frequencies: 0.012187
420500 -- (-425.138) (-425.818) (-424.418) [-426.604] * (-426.355) [-425.377] (-424.821) (-426.135) -- 0:00:05
421000 -- (-425.742) (-426.810) [-423.206] (-423.090) * [-424.707] (-424.699) (-427.776) (-424.117) -- 0:00:05
421500 -- (-424.750) (-427.893) (-423.651) [-423.612] * (-426.800) (-426.424) [-426.307] (-428.542) -- 0:00:05
422000 -- (-427.050) (-429.900) [-423.299] (-425.399) * (-427.993) [-424.087] (-425.323) (-424.625) -- 0:00:05
422500 -- (-426.333) (-425.177) [-423.770] (-424.498) * (-423.530) (-426.409) [-428.670] (-424.857) -- 0:00:05
423000 -- (-423.460) (-428.533) [-427.285] (-428.339) * (-427.272) (-427.661) (-424.034) [-425.490] -- 0:00:05
423500 -- (-426.200) (-424.369) [-424.589] (-424.889) * [-429.592] (-426.981) (-428.655) (-424.235) -- 0:00:05
424000 -- (-423.878) (-428.028) (-423.644) [-424.523] * (-424.849) (-428.183) [-425.305] (-426.189) -- 0:00:05
424500 -- (-424.274) (-424.230) [-425.671] (-425.240) * (-423.181) [-426.526] (-425.586) (-424.674) -- 0:00:04
425000 -- (-423.311) (-424.249) (-425.793) [-424.898] * [-423.696] (-424.535) (-432.339) (-423.988) -- 0:00:04
Average standard deviation of split frequencies: 0.012380
425500 -- [-423.131] (-426.961) (-424.080) (-426.702) * (-426.186) (-426.609) (-429.210) [-422.892] -- 0:00:04
426000 -- (-423.313) (-428.547) [-427.227] (-426.891) * (-430.981) (-427.225) (-423.679) [-423.419] -- 0:00:04
426500 -- [-423.584] (-429.740) (-425.085) (-428.402) * (-423.646) (-424.740) [-425.988] (-423.564) -- 0:00:04
427000 -- (-423.935) [-426.560] (-424.212) (-429.486) * (-426.833) (-424.232) (-427.479) [-422.852] -- 0:00:04
427500 -- (-425.708) (-423.586) (-431.016) [-427.421] * [-423.960] (-423.967) (-426.587) (-424.672) -- 0:00:04
428000 -- (-427.162) [-424.541] (-424.964) (-424.151) * (-426.849) [-424.335] (-423.809) (-423.214) -- 0:00:04
428500 -- (-424.869) (-424.970) (-426.986) [-424.519] * (-426.775) (-426.690) (-425.549) [-423.311] -- 0:00:04
429000 -- (-424.425) (-427.795) (-425.663) [-425.721] * (-425.618) (-424.135) (-424.225) [-423.388] -- 0:00:04
429500 -- [-424.650] (-428.362) (-425.730) (-426.629) * (-425.741) [-426.388] (-427.533) (-426.158) -- 0:00:04
430000 -- (-424.885) [-425.392] (-424.899) (-424.926) * (-424.971) [-424.548] (-423.351) (-424.951) -- 0:00:04
Average standard deviation of split frequencies: 0.012519
430500 -- (-423.481) (-425.576) [-425.530] (-424.234) * (-426.450) (-430.802) [-425.262] (-426.663) -- 0:00:04
431000 -- [-428.640] (-423.641) (-425.244) (-424.863) * (-429.624) [-424.435] (-423.794) (-426.450) -- 0:00:04
431500 -- (-425.770) (-424.911) (-425.615) [-426.214] * (-425.678) (-425.583) (-423.827) [-424.070] -- 0:00:04
432000 -- (-425.953) (-423.378) (-426.219) [-424.933] * (-425.919) (-429.444) (-425.157) [-424.723] -- 0:00:04
432500 -- (-424.061) [-423.014] (-423.899) (-423.806) * (-424.128) (-426.629) (-423.777) [-423.843] -- 0:00:04
433000 -- [-424.482] (-424.819) (-425.528) (-423.233) * [-425.867] (-424.731) (-425.870) (-423.706) -- 0:00:04
433500 -- (-423.842) (-424.422) [-427.172] (-425.195) * (-427.564) [-424.959] (-427.795) (-424.148) -- 0:00:04
434000 -- [-424.185] (-426.016) (-425.849) (-427.883) * (-424.221) [-425.755] (-430.214) (-423.139) -- 0:00:04
434500 -- (-423.090) (-423.416) (-425.879) [-425.608] * (-424.692) (-425.768) (-423.492) [-423.737] -- 0:00:04
435000 -- (-427.768) [-424.754] (-423.626) (-425.136) * [-428.154] (-424.600) (-424.641) (-425.502) -- 0:00:04
Average standard deviation of split frequencies: 0.012529
435500 -- (-424.847) (-428.959) (-427.850) [-428.450] * [-424.468] (-423.968) (-425.940) (-424.644) -- 0:00:04
436000 -- [-424.097] (-425.335) (-426.825) (-429.989) * (-427.304) (-426.035) (-424.792) [-423.457] -- 0:00:04
436500 -- (-424.316) (-426.209) (-425.316) [-427.366] * (-431.125) (-425.272) [-423.341] (-425.673) -- 0:00:04
437000 -- (-427.095) (-425.189) [-423.850] (-426.831) * (-425.333) (-424.834) (-425.866) [-425.607] -- 0:00:04
437500 -- (-424.088) (-425.018) [-423.713] (-426.936) * (-424.811) (-426.554) [-423.869] (-423.933) -- 0:00:04
438000 -- (-428.741) (-423.359) (-423.715) [-424.738] * (-425.204) [-425.829] (-428.690) (-423.930) -- 0:00:04
438500 -- (-425.400) (-424.544) [-425.458] (-423.124) * (-433.518) [-424.454] (-427.241) (-424.195) -- 0:00:04
439000 -- [-429.155] (-430.841) (-424.841) (-425.488) * (-427.486) (-423.652) (-426.119) [-427.251] -- 0:00:04
439500 -- (-426.055) (-424.821) (-424.434) [-425.772] * (-425.301) (-423.536) (-424.451) [-425.292] -- 0:00:03
440000 -- [-425.441] (-428.738) (-425.749) (-425.120) * [-427.059] (-424.158) (-424.412) (-425.112) -- 0:00:03
Average standard deviation of split frequencies: 0.012963
440500 -- (-425.480) (-426.670) (-423.637) [-423.592] * [-426.640] (-425.408) (-426.136) (-422.761) -- 0:00:03
441000 -- (-428.239) [-424.926] (-424.838) (-425.793) * (-423.217) (-427.292) [-424.621] (-425.157) -- 0:00:03
441500 -- (-426.979) [-424.191] (-427.574) (-429.456) * (-427.167) [-424.113] (-427.667) (-424.304) -- 0:00:03
442000 -- (-427.668) [-425.176] (-424.080) (-426.198) * [-426.613] (-423.536) (-426.579) (-424.221) -- 0:00:03
442500 -- (-430.949) [-423.892] (-423.072) (-424.547) * (-425.391) (-424.486) [-425.919] (-429.639) -- 0:00:03
443000 -- (-431.292) [-424.253] (-423.743) (-425.852) * [-424.198] (-429.683) (-427.034) (-426.672) -- 0:00:03
443500 -- (-431.209) (-423.997) (-426.720) [-425.096] * [-428.957] (-423.600) (-424.018) (-426.628) -- 0:00:03
444000 -- (-427.423) (-423.951) [-424.900] (-423.259) * [-424.579] (-425.459) (-427.738) (-426.314) -- 0:00:03
444500 -- (-424.874) (-424.683) (-425.720) [-423.514] * (-426.427) (-426.124) [-425.284] (-423.551) -- 0:00:03
445000 -- (-423.153) (-425.016) (-425.524) [-424.240] * (-424.457) [-424.592] (-426.559) (-426.259) -- 0:00:03
Average standard deviation of split frequencies: 0.013243
445500 -- (-425.395) (-425.922) (-422.846) [-423.973] * [-428.559] (-427.867) (-425.849) (-427.368) -- 0:00:03
446000 -- [-430.061] (-423.154) (-428.254) (-427.744) * (-424.824) (-423.624) (-425.370) [-423.136] -- 0:00:03
446500 -- [-424.964] (-422.808) (-425.192) (-425.859) * (-427.321) [-425.273] (-424.405) (-423.487) -- 0:00:03
447000 -- (-423.720) (-423.206) (-425.225) [-426.104] * [-427.247] (-426.642) (-423.592) (-423.927) -- 0:00:03
447500 -- [-424.950] (-423.089) (-426.821) (-431.146) * (-425.141) [-427.731] (-423.334) (-429.491) -- 0:00:03
448000 -- (-425.827) (-423.620) [-422.781] (-426.296) * (-426.798) (-430.402) [-423.409] (-425.064) -- 0:00:03
448500 -- [-423.084] (-423.041) (-425.092) (-425.760) * [-425.089] (-429.197) (-424.213) (-422.937) -- 0:00:03
449000 -- (-423.527) (-430.225) (-429.192) [-424.074] * [-426.934] (-425.434) (-424.301) (-424.169) -- 0:00:03
449500 -- (-425.211) (-426.223) (-430.884) [-424.379] * (-425.267) (-426.174) [-424.565] (-426.638) -- 0:00:03
450000 -- (-424.482) (-423.771) (-424.766) [-424.866] * (-423.513) (-425.065) [-424.408] (-424.620) -- 0:00:03
Average standard deviation of split frequencies: 0.012368
450500 -- (-423.306) (-423.969) (-424.696) [-424.204] * (-425.010) (-426.199) [-429.393] (-427.622) -- 0:00:03
451000 -- (-426.496) [-422.856] (-427.401) (-423.649) * (-427.181) (-423.144) (-424.114) [-426.306] -- 0:00:03
451500 -- (-426.206) (-422.956) (-425.969) [-423.780] * (-427.064) (-425.889) [-429.924] (-423.575) -- 0:00:03
452000 -- (-425.061) (-422.935) (-424.581) [-424.780] * [-423.244] (-424.949) (-424.169) (-423.098) -- 0:00:03
452500 -- (-425.784) (-423.274) (-425.216) [-425.235] * (-425.078) [-423.342] (-426.467) (-423.435) -- 0:00:03
453000 -- [-423.781] (-423.901) (-427.096) (-426.390) * [-424.797] (-423.177) (-426.276) (-425.200) -- 0:00:03
453500 -- (-425.756) (-423.576) (-425.765) [-425.838] * (-427.542) [-426.452] (-423.884) (-428.759) -- 0:00:03
454000 -- [-424.875] (-424.846) (-423.376) (-423.816) * [-423.978] (-426.561) (-425.290) (-426.731) -- 0:00:03
454500 -- (-423.370) [-426.265] (-423.328) (-422.850) * (-425.098) [-425.063] (-427.353) (-424.389) -- 0:00:03
455000 -- [-426.178] (-425.540) (-425.746) (-428.049) * (-423.908) [-424.766] (-424.718) (-423.454) -- 0:00:02
Average standard deviation of split frequencies: 0.012770
455500 -- (-423.300) (-423.803) [-427.254] (-424.462) * (-424.135) (-426.464) (-424.115) [-424.173] -- 0:00:02
456000 -- (-426.391) (-423.937) [-424.534] (-424.382) * (-426.616) (-427.318) [-425.800] (-427.244) -- 0:00:02
456500 -- (-423.083) (-425.149) (-425.521) [-425.075] * (-430.074) (-425.345) (-425.353) [-425.604] -- 0:00:02
457000 -- [-424.824] (-424.580) (-424.229) (-426.071) * (-425.674) (-430.421) (-425.891) [-424.716] -- 0:00:02
457500 -- (-426.626) (-423.576) [-425.067] (-425.858) * (-426.049) (-423.389) [-423.471] (-425.378) -- 0:00:02
458000 -- (-425.454) [-425.295] (-424.872) (-424.910) * [-427.516] (-427.040) (-426.777) (-423.912) -- 0:00:02
458500 -- (-424.611) [-424.572] (-426.251) (-425.890) * (-424.229) (-424.438) (-424.078) [-425.476] -- 0:00:02
459000 -- (-425.913) (-426.641) (-423.239) [-430.238] * [-424.879] (-425.041) (-426.647) (-424.438) -- 0:00:02
459500 -- (-427.324) (-428.270) [-425.315] (-425.070) * [-423.377] (-423.693) (-428.261) (-424.015) -- 0:00:02
460000 -- (-427.016) [-425.100] (-426.489) (-424.144) * [-423.196] (-428.809) (-426.821) (-426.861) -- 0:00:02
Average standard deviation of split frequencies: 0.012340
460500 -- [-423.950] (-425.333) (-424.003) (-424.794) * (-424.311) (-424.422) (-425.126) [-425.421] -- 0:00:02
461000 -- (-425.197) (-425.179) [-423.126] (-424.793) * (-423.283) (-424.347) [-424.381] (-425.372) -- 0:00:02
461500 -- (-425.092) (-424.833) (-426.150) [-423.046] * (-424.259) (-424.599) (-423.666) [-425.082] -- 0:00:02
462000 -- (-424.789) [-424.078] (-423.829) (-427.106) * (-425.117) [-424.234] (-423.770) (-426.302) -- 0:00:02
462500 -- (-424.456) (-426.192) (-425.668) [-424.092] * (-426.260) [-423.959] (-423.551) (-426.322) -- 0:00:02
463000 -- (-426.667) (-425.036) [-424.216] (-424.159) * (-424.256) (-424.475) (-423.252) [-425.252] -- 0:00:02
463500 -- (-425.498) (-425.536) [-424.852] (-426.480) * [-424.800] (-423.746) (-424.232) (-426.499) -- 0:00:02
464000 -- (-430.443) [-424.020] (-425.047) (-424.289) * [-425.448] (-426.359) (-424.840) (-423.993) -- 0:00:02
464500 -- [-426.625] (-424.746) (-425.929) (-427.097) * (-426.207) [-424.621] (-424.026) (-425.269) -- 0:00:02
465000 -- [-424.010] (-424.189) (-424.159) (-424.568) * (-425.341) (-423.805) [-424.852] (-426.580) -- 0:00:02
Average standard deviation of split frequencies: 0.011949
465500 -- (-427.579) (-425.414) (-431.352) [-426.755] * (-426.070) [-423.792] (-425.839) (-425.424) -- 0:00:02
466000 -- (-427.967) [-424.360] (-429.937) (-423.739) * [-424.030] (-423.711) (-426.268) (-425.445) -- 0:00:02
466500 -- [-425.189] (-423.536) (-423.501) (-424.200) * (-428.406) (-423.208) (-424.892) [-428.511] -- 0:00:02
467000 -- (-426.687) (-427.243) (-425.867) [-423.731] * [-424.399] (-422.885) (-425.245) (-425.733) -- 0:00:02
467500 -- (-424.630) (-427.087) [-423.212] (-426.511) * (-427.232) (-423.831) [-423.124] (-425.518) -- 0:00:02
468000 -- (-424.362) (-424.670) (-425.541) [-428.013] * (-425.803) [-425.509] (-428.638) (-423.548) -- 0:00:02
468500 -- (-423.790) [-423.503] (-426.667) (-427.142) * [-425.811] (-425.977) (-426.065) (-423.644) -- 0:00:02
469000 -- [-424.118] (-429.093) (-424.315) (-426.803) * (-428.887) (-432.746) (-426.193) [-422.943] -- 0:00:02
469500 -- (-425.317) [-423.450] (-424.131) (-426.031) * (-425.963) (-429.907) (-424.809) [-425.437] -- 0:00:02
470000 -- (-424.720) (-427.891) [-422.999] (-423.914) * [-423.884] (-426.465) (-433.378) (-423.571) -- 0:00:01
Average standard deviation of split frequencies: 0.012431
470500 -- (-426.068) [-424.250] (-425.627) (-425.202) * (-422.840) (-425.971) (-426.489) [-424.440] -- 0:00:01
471000 -- [-426.156] (-423.506) (-424.784) (-424.546) * (-425.498) (-426.655) (-426.980) [-425.179] -- 0:00:01
471500 -- (-425.076) (-428.057) (-426.072) [-426.838] * (-425.772) (-424.964) (-428.823) [-427.738] -- 0:00:01
472000 -- (-423.982) (-428.669) (-424.321) [-426.092] * (-424.333) (-425.439) (-425.174) [-426.535] -- 0:00:01
472500 -- [-424.856] (-425.949) (-427.886) (-423.100) * (-426.422) (-426.182) [-425.525] (-432.915) -- 0:00:01
473000 -- (-422.753) (-423.763) [-426.836] (-423.261) * [-425.325] (-425.331) (-423.535) (-424.793) -- 0:00:01
473500 -- (-422.680) [-423.447] (-426.435) (-425.261) * [-426.532] (-427.362) (-425.012) (-426.963) -- 0:00:01
474000 -- [-423.836] (-423.581) (-424.578) (-424.215) * [-423.257] (-424.349) (-426.219) (-423.656) -- 0:00:01
474500 -- (-424.642) [-427.278] (-423.613) (-425.666) * (-424.800) (-426.802) [-427.580] (-423.206) -- 0:00:01
475000 -- (-427.462) (-423.519) (-424.582) [-424.676] * (-424.021) [-424.868] (-424.385) (-425.840) -- 0:00:01
Average standard deviation of split frequencies: 0.011418
475500 -- (-426.704) [-424.458] (-425.153) (-424.911) * [-423.605] (-425.587) (-426.772) (-427.110) -- 0:00:01
476000 -- (-432.008) [-425.805] (-426.062) (-424.721) * [-424.973] (-426.298) (-426.912) (-426.078) -- 0:00:01
476500 -- [-429.330] (-424.497) (-425.628) (-426.358) * (-430.431) [-424.130] (-430.719) (-427.141) -- 0:00:01
477000 -- (-430.448) (-423.053) (-423.488) [-425.616] * [-425.985] (-424.468) (-427.059) (-429.293) -- 0:00:01
477500 -- (-429.275) (-424.913) [-427.384] (-425.373) * (-424.952) [-425.526] (-425.211) (-425.777) -- 0:00:01
478000 -- (-427.888) (-424.438) (-426.034) [-427.592] * (-428.751) [-425.273] (-426.968) (-426.332) -- 0:00:01
478500 -- [-425.574] (-423.579) (-422.991) (-424.613) * (-427.700) [-425.730] (-425.070) (-429.094) -- 0:00:01
479000 -- (-424.116) (-422.837) [-426.913] (-425.247) * (-423.944) (-426.188) [-423.743] (-424.323) -- 0:00:01
479500 -- (-424.925) (-423.460) (-425.275) [-423.730] * (-432.109) (-427.212) [-425.131] (-425.527) -- 0:00:01
480000 -- (-424.775) (-424.616) [-424.380] (-424.899) * (-424.597) [-427.050] (-425.529) (-423.009) -- 0:00:01
Average standard deviation of split frequencies: 0.011307
480500 -- (-424.586) (-424.246) (-423.385) [-423.956] * (-427.270) (-423.654) (-425.462) [-427.273] -- 0:00:01
481000 -- (-425.033) [-424.745] (-426.384) (-423.884) * (-425.752) (-426.411) (-430.879) [-428.986] -- 0:00:01
481500 -- (-424.551) (-425.803) (-431.239) [-423.991] * (-426.368) (-424.489) [-428.510] (-424.213) -- 0:00:01
482000 -- (-423.992) (-424.545) [-424.463] (-428.258) * (-426.936) (-425.019) (-425.464) [-424.370] -- 0:00:01
482500 -- [-424.095] (-425.029) (-423.976) (-428.225) * (-424.252) (-424.614) [-424.939] (-434.124) -- 0:00:01
483000 -- [-430.992] (-424.648) (-425.295) (-426.058) * (-424.691) (-425.582) (-424.764) [-425.981] -- 0:00:01
483500 -- (-425.052) (-428.490) [-423.453] (-426.624) * (-425.137) [-424.527] (-426.165) (-428.790) -- 0:00:01
484000 -- (-426.997) (-424.886) (-424.804) [-423.485] * (-423.451) (-424.535) (-425.765) [-426.699] -- 0:00:01
484500 -- (-426.598) [-425.621] (-423.808) (-425.480) * (-424.042) (-423.735) (-423.629) [-424.611] -- 0:00:01
485000 -- (-423.889) [-427.649] (-425.163) (-427.904) * (-426.216) (-424.474) (-424.271) [-424.395] -- 0:00:00
Average standard deviation of split frequencies: 0.011240
485500 -- (-423.942) (-424.035) (-423.200) [-422.868] * [-424.038] (-425.388) (-424.174) (-423.636) -- 0:00:00
486000 -- [-423.504] (-423.263) (-422.776) (-427.608) * [-425.499] (-425.344) (-424.455) (-423.494) -- 0:00:00
486500 -- (-426.207) (-429.570) (-424.269) [-428.678] * [-423.698] (-427.320) (-423.761) (-424.509) -- 0:00:00
487000 -- [-423.894] (-428.178) (-427.745) (-429.612) * (-426.112) [-424.720] (-424.859) (-425.133) -- 0:00:00
487500 -- (-423.960) [-425.331] (-423.884) (-426.400) * (-424.156) (-423.133) (-425.714) [-430.373] -- 0:00:00
488000 -- [-425.644] (-424.335) (-428.594) (-424.427) * (-424.151) (-422.822) (-423.421) [-425.917] -- 0:00:00
488500 -- (-424.304) (-425.013) (-424.529) [-423.786] * [-423.419] (-423.145) (-425.736) (-424.285) -- 0:00:00
489000 -- (-424.435) [-424.963] (-425.545) (-423.051) * (-425.663) (-424.707) [-427.190] (-426.582) -- 0:00:00
489500 -- [-426.096] (-423.644) (-424.754) (-424.794) * (-423.991) [-430.356] (-426.767) (-429.362) -- 0:00:00
490000 -- (-424.203) (-424.928) (-429.807) [-424.266] * (-424.536) (-424.095) (-426.012) [-423.869] -- 0:00:00
Average standard deviation of split frequencies: 0.011755
490500 -- (-424.897) (-424.646) [-426.524] (-424.767) * (-424.221) (-424.263) [-426.765] (-427.351) -- 0:00:00
491000 -- (-426.898) [-428.014] (-425.236) (-424.059) * (-424.900) [-424.951] (-425.791) (-423.611) -- 0:00:00
491500 -- [-426.209] (-425.208) (-426.964) (-427.033) * [-425.847] (-423.894) (-426.239) (-428.539) -- 0:00:00
492000 -- (-427.525) (-425.572) (-426.989) [-423.336] * (-428.234) [-424.097] (-425.472) (-427.604) -- 0:00:00
492500 -- (-425.969) [-425.146] (-425.346) (-426.229) * (-426.214) (-426.761) (-427.224) [-423.417] -- 0:00:00
493000 -- [-424.748] (-423.885) (-425.668) (-425.825) * (-430.027) (-425.187) [-424.182] (-428.575) -- 0:00:00
493500 -- [-428.066] (-423.538) (-427.726) (-425.275) * (-430.439) (-427.940) (-425.270) [-424.440] -- 0:00:00
494000 -- (-424.474) (-424.260) (-423.584) [-425.053] * (-429.096) [-424.866] (-425.870) (-426.347) -- 0:00:00
494500 -- (-424.428) [-422.975] (-424.949) (-426.719) * [-423.646] (-426.985) (-424.051) (-424.955) -- 0:00:00
495000 -- (-425.373) (-423.437) [-425.722] (-425.136) * (-426.706) [-424.775] (-426.239) (-424.333) -- 0:00:00
Average standard deviation of split frequencies: 0.010752
495500 -- (-430.089) [-426.333] (-426.775) (-423.728) * (-426.271) [-425.244] (-427.874) (-426.534) -- 0:00:00
496000 -- (-423.338) [-424.014] (-424.311) (-424.989) * (-424.889) (-423.842) [-425.405] (-426.838) -- 0:00:00
496500 -- (-423.613) (-425.746) [-428.171] (-424.409) * (-426.806) [-423.327] (-427.413) (-423.824) -- 0:00:00
497000 -- (-423.564) (-426.889) [-423.884] (-423.781) * [-426.355] (-423.229) (-429.164) (-425.454) -- 0:00:00
497500 -- (-426.429) (-424.018) (-424.094) [-424.455] * (-424.882) (-423.227) (-427.263) [-426.415] -- 0:00:00
498000 -- (-425.123) (-425.075) [-423.743] (-425.776) * (-424.681) (-423.808) (-430.488) [-424.486] -- 0:00:00
498500 -- [-429.179] (-429.817) (-423.825) (-423.225) * (-425.335) (-423.548) (-423.220) [-424.411] -- 0:00:00
499000 -- (-424.624) (-428.131) (-424.401) [-424.751] * (-425.874) [-423.445] (-423.863) (-425.167) -- 0:00:00
499500 -- [-424.778] (-424.727) (-426.540) (-424.321) * (-424.441) (-430.457) [-428.715] (-426.880) -- 0:00:00
500000 -- (-426.399) (-429.849) (-424.925) [-428.517] * (-424.497) (-427.382) (-425.059) [-425.969] -- 0:00:00
Average standard deviation of split frequencies: 0.010887
Analysis completed in 33 seconds
Analysis used 32.17 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -422.58
Likelihood of best state for "cold" chain of run 2 was -422.58
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
78.7 % ( 66 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
44.8 % ( 43 %) Dirichlet(Pi{all})
47.3 % ( 49 %) Slider(Pi{all})
88.2 % ( 83 %) Multiplier(Alpha{1,2})
87.9 % ( 81 %) Multiplier(Alpha{3})
26.8 % ( 28 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
69.9 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 86 %) ParsSPR(Tau{all},V{all})
30.9 % ( 16 %) Multiplier(V{all})
97.3 % (100 %) Nodeslider(V{all})
35.8 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
78.1 % ( 76 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
44.1 % ( 44 %) Dirichlet(Pi{all})
47.0 % ( 36 %) Slider(Pi{all})
88.8 % ( 87 %) Multiplier(Alpha{1,2})
87.5 % ( 75 %) Multiplier(Alpha{3})
28.6 % ( 40 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
30.8 % ( 21 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
35.2 % ( 32 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83291 0.82 0.67
3 | 83522 83647 0.84
4 | 82909 83232 83399
Chain swap information for run 2:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83573 0.82 0.67
3 | 83554 83191 0.84
4 | 83292 83669 82721
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 1250
Summarizing parameters in files /data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -424.07
| 1 1 1 2 |
| 2 1 1 |
| 2 12 1 2 1 2 11 * |
| 2 2 21 1 1 2 1 12 2 2 1 2 |
|11 1 1 1 21 2 1 1 2 11* |
|2 1 1 2 2*2 1 222 1 1 1 2 2|
| 1 121 1 2 2 1 11 1 1 22 1 1 |
| 2 2 1 2 2 2 1 22 2 1|
| 2 2 2 1 11 2 * 1 |
| 1 22 22 2 2 2 1 2 2 |
| 1 22 2 1 |
| 1 2 |
| |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -426.81
^ ^
125000 500000
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -424.32 -429.28
2 -424.38 -427.62
--------------------------------------
TOTAL -424.35 -428.76
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898199 0.089585 0.351766 1.488975 0.863126 673.98 712.49 1.000
r(A<->C){all} 0.173933 0.020398 0.000285 0.461230 0.140122 81.59 105.71 1.004
r(A<->G){all} 0.181600 0.022725 0.000124 0.484576 0.141396 63.97 72.56 1.009
r(A<->T){all} 0.147197 0.015890 0.000009 0.390259 0.114140 135.36 180.11 1.003
r(C<->G){all} 0.168368 0.021966 0.000062 0.487042 0.126095 95.66 95.81 0.999
r(C<->T){all} 0.179213 0.019974 0.000096 0.461030 0.146894 80.11 103.00 1.008
r(G<->T){all} 0.149689 0.014091 0.000028 0.371584 0.121961 98.53 137.42 0.999
pi(A){all} 0.215302 0.000562 0.169111 0.260541 0.215291 637.20 653.31 1.000
pi(C){all} 0.287956 0.000678 0.238704 0.339951 0.287796 615.48 683.24 1.000
pi(G){all} 0.254664 0.000630 0.210670 0.307493 0.253785 624.75 652.86 1.000
pi(T){all} 0.242078 0.000570 0.199446 0.292984 0.241857 638.41 672.22 0.999
alpha{1,2} 0.411463 0.239646 0.000890 1.434141 0.244014 379.15 466.78 1.000
alpha{3} 0.446455 0.223670 0.001055 1.462034 0.299336 541.15 561.42 0.999
pinvar{all} 0.994557 0.000039 0.982302 0.999998 0.996584 422.19 540.62 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 1250
Summarizing trees in files "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 2002 trees in 2 files (sampling 1502 of them)
(Each file contained 1001 trees of which 751 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..****
8 -- ..**..
9 -- .*.***
10 -- .****.
11 -- .*...*
12 -- ...**.
13 -- .*.*..
14 -- ..*..*
15 -- .**.**
16 -- ....**
17 -- ..*.*.
18 -- .***.*
19 -- ...*.*
20 -- .*..*.
21 -- .**...
22 -- ..***.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 243 0.161784 0.002825 0.159787 0.163782 2
8 237 0.157790 0.019773 0.143808 0.171771 2
9 229 0.152463 0.006591 0.147803 0.157124 2
10 224 0.149134 0.001883 0.147803 0.150466 2
11 217 0.144474 0.000942 0.143808 0.145140 2
12 214 0.142477 0.022597 0.126498 0.158455 2
13 213 0.141811 0.006591 0.137150 0.146471 2
14 211 0.140479 0.023539 0.123835 0.157124 2
15 210 0.139814 0.009416 0.133156 0.146471 2
16 208 0.138482 0.005649 0.134487 0.142477 2
17 206 0.137150 0.013182 0.127830 0.146471 2
18 205 0.136485 0.008474 0.130493 0.142477 2
19 201 0.133822 0.017890 0.121172 0.146471 2
20 200 0.133156 0.001883 0.131824 0.134487 2
21 197 0.131158 0.008474 0.125166 0.137150 2
22 132 0.087883 0.024480 0.070573 0.105193 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100097 0.009525 0.000048 0.292341 0.072760 0.999 2
length{all}[2] 0.096135 0.009315 0.000078 0.276268 0.067863 1.002 2
length{all}[3] 0.101832 0.010692 0.000053 0.303920 0.070491 1.000 2
length{all}[4] 0.099165 0.009626 0.000465 0.283123 0.071733 1.000 2
length{all}[5] 0.100362 0.009764 0.000002 0.302827 0.070865 1.001 2
length{all}[6] 0.098848 0.010838 0.000118 0.293165 0.065454 1.000 2
length{all}[7] 0.097966 0.009612 0.000626 0.297204 0.068690 0.996 2
length{all}[8] 0.110262 0.013786 0.000705 0.334147 0.070175 0.998 2
length{all}[9] 0.085671 0.009365 0.000113 0.288524 0.052255 0.996 2
length{all}[10] 0.116234 0.013138 0.000405 0.343195 0.095796 0.996 2
length{all}[11] 0.099786 0.012222 0.000119 0.335345 0.060688 1.006 2
length{all}[12] 0.101325 0.010048 0.000330 0.305140 0.069440 1.006 2
length{all}[13] 0.101836 0.007988 0.000474 0.296513 0.075305 0.998 2
length{all}[14] 0.094665 0.010567 0.000124 0.275945 0.059884 1.018 2
length{all}[15] 0.099817 0.009101 0.000884 0.311060 0.068426 1.010 2
length{all}[16] 0.097039 0.011536 0.000642 0.287046 0.069186 0.995 2
length{all}[17] 0.101308 0.010434 0.000413 0.304026 0.074941 1.001 2
length{all}[18] 0.101435 0.009652 0.000184 0.297831 0.068170 0.997 2
length{all}[19] 0.089182 0.010794 0.000183 0.276726 0.055317 0.996 2
length{all}[20] 0.098362 0.009490 0.000071 0.305825 0.059876 1.003 2
length{all}[21] 0.094212 0.008041 0.000841 0.259866 0.078170 0.995 2
length{all}[22] 0.103579 0.012967 0.000200 0.349656 0.072781 0.994 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.010887
Maximum standard deviation of split frequencies = 0.024480
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.018
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 43 trees
90 % credible set contains 89 trees
95 % credible set contains 96 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 306
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 45 patterns at 102 / 102 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 45 patterns at 102 / 102 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
43920 bytes for conP
3960 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.103596 0.100971 0.012903 0.044860 0.046122 0.088167 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -451.170922
Iterating by ming2
Initial: fx= 451.170922
x= 0.10360 0.10097 0.01290 0.04486 0.04612 0.08817 0.30000 1.30000
1 h-m-p 0.0000 0.0001 245.0629 ++ 443.487462 m 0.0001 13 | 1/8
2 h-m-p 0.0007 0.0200 39.4099 -----------.. | 1/8
3 h-m-p 0.0000 0.0003 223.7902 +++ 427.504713 m 0.0003 45 | 2/8
4 h-m-p 0.0020 0.0323 32.6126 ------------.. | 2/8
5 h-m-p 0.0000 0.0000 200.9592 ++ 426.997062 m 0.0000 77 | 3/8
6 h-m-p 0.0001 0.0526 26.1798 ----------.. | 3/8
7 h-m-p 0.0000 0.0004 173.6981 +++ 414.225693 m 0.0004 108 | 4/8
8 h-m-p 0.0030 0.0691 19.9425 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 142.7065 ++ 411.601122 m 0.0001 140 | 5/8
10 h-m-p 0.0009 0.0998 13.7868 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 101.1016 ++ 411.331187 m 0.0000 171 | 6/8
12 h-m-p 0.1298 8.0000 0.0000 -C 411.331187 0 0.0117 183 | 6/8
13 h-m-p 0.9913 8.0000 0.0000 --------C 411.331187 0 0.0000 204
Out..
lnL = -411.331187
205 lfun, 205 eigenQcodon, 1230 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.049865 0.024801 0.088886 0.075116 0.019979 0.071665 0.299960 0.759296 0.202018
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 15.196441
np = 9
lnL0 = -442.419046
Iterating by ming2
Initial: fx= 442.419046
x= 0.04986 0.02480 0.08889 0.07512 0.01998 0.07167 0.29996 0.75930 0.20202
1 h-m-p 0.0000 0.0002 220.6464 +++ 431.539560 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0001 166.6538 ++ 429.224179 m 0.0001 27 | 2/9
3 h-m-p 0.0001 0.0004 137.8434 ++ 420.538794 m 0.0004 39 | 3/9
4 h-m-p 0.0002 0.0008 123.1859 ++ 413.713015 m 0.0008 51 | 4/9
5 h-m-p 0.0000 0.0000 50837.4027 ++ 412.938390 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 3079.6080 ++ 411.331094 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 411.331093 m 8.0000 87 | 6/9
8 h-m-p 0.0065 3.2444 0.2904 ------------.. | 6/9
9 h-m-p 0.0160 8.0000 0.0004 +++++ 411.331092 m 8.0000 130 | 6/9
10 h-m-p 0.0166 6.4233 0.1696 ----------C 411.331092 0 0.0000 155 | 6/9
11 h-m-p 0.0160 8.0000 0.0018 +++++ 411.331088 m 8.0000 173 | 6/9
12 h-m-p 0.0731 5.9334 0.1918 -----------C 411.331088 0 0.0000 199 | 6/9
13 h-m-p 0.0160 8.0000 0.0004 +++++ 411.331087 m 8.0000 217 | 6/9
14 h-m-p 0.0141 3.7327 0.2288 ----------Y 411.331087 0 0.0000 242 | 6/9
15 h-m-p 0.0160 8.0000 0.0020 +++++ 411.331082 m 8.0000 260 | 6/9
16 h-m-p 0.0415 0.2074 0.3118 --------------.. | 6/9
17 h-m-p 0.0160 8.0000 0.0004 +++++ 411.331081 m 8.0000 305 | 6/9
18 h-m-p 0.0214 7.3260 0.1564 -------------.. | 6/9
19 h-m-p 0.0160 8.0000 0.0004 +++++ 411.331080 m 8.0000 349 | 6/9
20 h-m-p 0.0221 7.4241 0.1549 -------------.. | 6/9
21 h-m-p 0.0160 8.0000 0.0004 +++++ 411.331078 m 8.0000 393 | 6/9
22 h-m-p 0.0228 7.5233 0.1533 -------------.. | 6/9
23 h-m-p 0.0160 8.0000 0.0004 +++++ 411.331076 m 8.0000 437 | 6/9
24 h-m-p 0.0236 7.6335 0.1516 -------------.. | 6/9
25 h-m-p 0.0064 3.2047 0.0005 +++++ 411.331076 m 3.2047 481 | 7/9
26 h-m-p 0.0153 7.6419 0.1151 ------------C 411.331076 0 0.0000 508 | 7/9
27 h-m-p 0.0160 8.0000 0.0074 +++++ 411.331052 m 8.0000 525 | 7/9
28 h-m-p 0.2450 4.0758 0.2432 --------------C 411.331052 0 0.0000 553 | 7/9
29 h-m-p 0.0160 8.0000 0.0001 -------C 411.331052 0 0.0000 574 | 7/9
30 h-m-p 0.0000 0.0244 3.2360 +++++ 411.331007 m 0.0244 591 | 8/9
31 h-m-p 0.3251 8.0000 0.0740 ---------------.. | 8/9
32 h-m-p 0.0160 8.0000 0.0001 +++++ 411.331007 m 8.0000 632 | 8/9
33 h-m-p 0.0160 8.0000 0.8113 ------------Y 411.331007 0 0.0000 657 | 8/9
34 h-m-p 0.0160 8.0000 0.0000 +++++ 411.331007 m 8.0000 673 | 8/9
35 h-m-p 0.0160 8.0000 0.9716 -----------Y 411.331007 0 0.0000 697 | 8/9
36 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/9
37 h-m-p 0.0160 8.0000 0.0001 +++++ 411.331007 m 8.0000 737 | 8/9
38 h-m-p 0.0160 8.0000 0.7594 -------------.. | 8/9
39 h-m-p 0.0160 8.0000 0.0001 +++++ 411.331006 m 8.0000 777 | 8/9
40 h-m-p 0.0160 8.0000 0.7919 ------------N 411.331006 0 0.0000 802 | 8/9
41 h-m-p 0.0160 8.0000 0.0000 ----C 411.331006 0 0.0000 819 | 8/9
42 h-m-p 0.0160 8.0000 0.0000 ----Y 411.331006 0 0.0000 836
Out..
lnL = -411.331006
837 lfun, 2511 eigenQcodon, 10044 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.072652 0.098409 0.050329 0.017507 0.082104 0.075120 0.225473 1.526558 0.414801 0.115794 1.337511
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 14.133130
np = 11
lnL0 = -446.984774
Iterating by ming2
Initial: fx= 446.984774
x= 0.07265 0.09841 0.05033 0.01751 0.08210 0.07512 0.22547 1.52656 0.41480 0.11579 1.33751
1 h-m-p 0.0000 0.0002 201.2622 +++ 438.258394 m 0.0002 17 | 1/11
2 h-m-p 0.0002 0.0008 164.0548 ++ 423.902952 m 0.0008 31 | 2/11
3 h-m-p 0.0024 0.0122 24.3048 ++ 421.178706 m 0.0122 45 | 3/11
4 h-m-p 0.0002 0.0008 582.2044 ++ 412.695985 m 0.0008 59 | 4/11
5 h-m-p 0.0002 0.0008 334.1484 ++ 411.552165 m 0.0008 73 | 5/11
6 h-m-p 0.0000 0.0000 3980.4930 ++ 411.449713 m 0.0000 87 | 6/11
7 h-m-p 0.0000 0.0000 18365.5114 ++ 411.331129 m 0.0000 101 | 7/11
8 h-m-p 1.6000 8.0000 0.0016 ++ 411.331129 m 8.0000 115 | 7/11
9 h-m-p 0.0201 1.0562 0.6521 ----------C 411.331129 0 0.0000 143 | 7/11
10 h-m-p 0.0160 8.0000 0.0003 +++++ 411.331129 m 8.0000 164 | 7/11
11 h-m-p 0.0020 0.7536 1.2064 ------------.. | 7/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 411.331129 m 8.0000 209 | 7/11
13 h-m-p 0.0160 8.0000 0.0721 --------Y 411.331129 0 0.0000 235 | 7/11
14 h-m-p 0.0160 8.0000 0.0003 +++++ 411.331129 m 8.0000 256 | 7/11
15 h-m-p 0.0160 8.0000 2.0785 -----------Y 411.331129 0 0.0000 285 | 7/11
16 h-m-p 0.0160 8.0000 0.0004 -------N 411.331129 0 0.0000 306 | 7/11
17 h-m-p 0.0160 8.0000 0.0010 +++++ 411.331129 m 8.0000 327 | 7/11
18 h-m-p 0.0160 8.0000 3.2830 ------------C 411.331129 0 0.0000 357 | 7/11
19 h-m-p 0.0160 8.0000 0.0003 +++++ 411.331129 m 8.0000 374 | 7/11
20 h-m-p 0.0019 0.9250 2.4531 -----------Y 411.331129 0 0.0000 403 | 7/11
21 h-m-p 0.0160 8.0000 0.0008 +++++ 411.331128 m 8.0000 420 | 7/11
22 h-m-p 0.0039 1.9432 2.3536 -----------Y 411.331128 0 0.0000 449 | 7/11
23 h-m-p 0.0160 8.0000 0.0000 ----C 411.331128 0 0.0000 467 | 7/11
24 h-m-p 0.0160 8.0000 0.0000 +++++ 411.331128 m 8.0000 488 | 7/11
25 h-m-p 0.0061 3.0648 1.4694 ----------N 411.331128 0 0.0000 516 | 7/11
26 h-m-p 0.0160 8.0000 0.0000 ----C 411.331128 0 0.0000 534 | 7/11
27 h-m-p 0.0160 8.0000 0.0000 ---Y 411.331128 0 0.0000 555
Out..
lnL = -411.331128
556 lfun, 2224 eigenQcodon, 10008 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -411.338684 S = -411.329914 -0.003354
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 45 patterns 0:06
did 20 / 45 patterns 0:06
did 30 / 45 patterns 0:06
did 40 / 45 patterns 0:06
did 45 / 45 patterns 0:06
Time used: 0:06
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.067455 0.037554 0.037362 0.041581 0.056137 0.026491 0.112218 0.900556 0.507217 0.649885 1.653131 2.370628
ntime & nrate & np: 6 4 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 7.215938
np = 12
lnL0 = -437.435619
Iterating by ming2
Initial: fx= 437.435619
x= 0.06745 0.03755 0.03736 0.04158 0.05614 0.02649 0.11222 0.90056 0.50722 0.64989 1.65313 2.37063
1 h-m-p 0.0000 0.0003 232.4067 +++ 422.129605 m 0.0003 18 | 1/12
2 h-m-p 0.0011 0.0056 38.0496 ++ 416.164792 m 0.0056 33 | 2/12
3 h-m-p 0.0000 0.0000 18231.6477 ++ 416.088276 m 0.0000 48 | 3/12
4 h-m-p 0.0000 0.0000 2243.5978 ++ 414.803307 m 0.0000 63 | 4/12
5 h-m-p 0.0000 0.0001 2383.2056 ++ 412.220558 m 0.0001 78 | 5/12
6 h-m-p 0.0000 0.0000 4238.8954 ++ 411.331177 m 0.0000 93 | 6/12
7 h-m-p 1.6000 8.0000 0.0003 ++ 411.331177 m 8.0000 108 | 6/12
8 h-m-p 0.0211 0.7186 0.1123 +++ 411.331175 m 0.7186 130 | 7/12
9 h-m-p 0.1523 8.0000 0.1905 -------------C 411.331175 0 0.0000 164 | 7/12
10 h-m-p 0.0160 8.0000 0.0010 +++++ 411.331175 m 8.0000 187 | 7/12
11 h-m-p 0.0073 3.6712 1.2348 ---------Y 411.331175 0 0.0000 216 | 7/12
12 h-m-p 0.0160 8.0000 0.0001 +++++ 411.331175 m 8.0000 234 | 7/12
13 h-m-p 0.0001 0.0481 5.8448 ----------.. | 7/12
14 h-m-p 0.0160 8.0000 0.0000 +++++ 411.331175 m 8.0000 280 | 7/12
15 h-m-p 0.0025 1.2302 0.6519 +++++ 411.331142 m 1.2302 303 | 8/12
16 h-m-p 0.3906 8.0000 2.0497 --------------C 411.331142 0 0.0000 337 | 8/12
17 h-m-p 0.0160 8.0000 0.0001 +++++ 411.331142 m 8.0000 355 | 8/12
18 h-m-p 0.0160 8.0000 2.2357 -------------.. | 8/12
19 h-m-p 0.0160 8.0000 0.0001 +++++ 411.331142 m 8.0000 403 | 8/12
20 h-m-p 0.0126 6.3247 0.5876 +++++ 411.330988 m 6.3247 425 | 9/12
21 h-m-p 0.8173 4.0864 0.8459 ++ 411.330980 m 4.0864 444 | 10/12
22 h-m-p 1.6000 8.0000 0.0000 Y 411.330980 0 1.6000 462 | 10/12
23 h-m-p 0.2887 8.0000 0.0002 -------------N 411.330980 0 0.0000 492
Out..
lnL = -411.330980
493 lfun, 1972 eigenQcodon, 8874 P(t)
Time used: 0:09
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.068971 0.045037 0.066486 0.028679 0.038582 0.069424 0.000100 0.507156 1.952847
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 24.670462
np = 9
lnL0 = -440.735802
Iterating by ming2
Initial: fx= 440.735802
x= 0.06897 0.04504 0.06649 0.02868 0.03858 0.06942 0.00011 0.50716 1.95285
1 h-m-p 0.0000 0.0000 217.9697 ++ 440.574655 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0187 26.9693 +++++ 433.648993 m 0.0187 29 | 2/9
3 h-m-p 0.0000 0.0000 6710.3385 ++ 419.943472 m 0.0000 41 | 3/9
4 h-m-p 0.0001 0.0005 20.8614 ++ 419.855536 m 0.0005 53 | 4/9
5 h-m-p 0.0000 0.0001 64.9716 ++ 418.546156 m 0.0001 65 | 5/9
6 h-m-p 0.0007 0.0062 10.8081 -----------.. | 5/9
7 h-m-p 0.0000 0.0003 156.4816 +++ 411.903047 m 0.0003 99 | 6/9
8 h-m-p 0.0216 8.0000 1.5877 -------------.. | 6/9
9 h-m-p 0.0000 0.0000 130.4645 ++ 411.375558 m 0.0000 134 | 7/9
10 h-m-p 0.0160 8.0000 1.1199 -------------.. | 7/9
11 h-m-p 0.0000 0.0000 92.4682 ++ 411.330980 m 0.0000 169 | 8/9
12 h-m-p 1.6000 8.0000 0.0000 N 411.330980 0 1.6000 181 | 8/9
13 h-m-p 0.0160 8.0000 0.0000 +Y 411.330980 0 0.0640 195
Out..
lnL = -411.330980
196 lfun, 2156 eigenQcodon, 11760 P(t)
Time used: 0:12
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.027521 0.064525 0.023704 0.057015 0.071249 0.092956 0.000100 0.900000 0.945166 1.896778 1.299770
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.983285
np = 11
lnL0 = -442.750146
Iterating by ming2
Initial: fx= 442.750146
x= 0.02752 0.06453 0.02370 0.05701 0.07125 0.09296 0.00011 0.90000 0.94517 1.89678 1.29977
1 h-m-p 0.0000 0.0000 216.6736 ++ 442.532759 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0032 70.7364 ++++ 429.237452 m 0.0032 32 | 2/11
3 h-m-p 0.0000 0.0000 514.8591 ++ 427.457702 m 0.0000 46 | 3/11
4 h-m-p 0.0008 0.0224 28.3996 +++ 418.277942 m 0.0224 61 | 4/11
5 h-m-p 0.0000 0.0002 280.0842 ++ 416.122517 m 0.0002 75 | 5/11
6 h-m-p 0.0001 0.0007 210.1402 ++ 414.927173 m 0.0007 89 | 6/11
7 h-m-p 0.0001 0.0006 232.2365 ++ 411.331139 m 0.0006 103 | 7/11
8 h-m-p 1.6000 8.0000 0.0004 ++ 411.331139 m 8.0000 117 | 7/11
9 h-m-p 0.0022 0.6451 1.4066 +++++ 411.331102 m 0.6451 138 | 8/11
10 h-m-p 0.1894 0.9468 1.1037 +
QuantileBeta(0.15, 0.00500, 2.21977) = 1.180754e-160 2000 rounds
+ 411.330980 m 0.9468 152
QuantileBeta(0.15, 0.00500, 2.21977) = 1.180754e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21977) = 1.180754e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21977) = 1.180754e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21977) = 1.180754e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21977) = 1.180754e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21977) = 1.180754e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21977) = 1.180754e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21977) = 1.180754e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21977) = 1.221973e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21977) = 1.180753e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21977) = 1.180754e-160 2000 rounds
| 9/11
11 h-m-p 1.6000 8.0000 0.0035
QuantileBeta(0.15, 0.00500, 2.21789) = 1.182014e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21224) = 1.185810e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.21035) = 1.187080e-160 2000 rounds
+ 411.330980 m 8.0000 166
QuantileBeta(0.15, 0.00500, 2.21035) = 1.187080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21035) = 1.187080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21035) = 1.187080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21035) = 1.187080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21035) = 1.187080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21035) = 1.187080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21035) = 1.187080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21035) = 1.187080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21035) = 1.228521e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21048) = 1.186998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21023) = 1.187163e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21035) = 1.187080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21035) = 1.187080e-160 2000 rounds
| 9/11
12 h-m-p 1.6000 8.0000 0.0074
QuantileBeta(0.15, 0.00500, 2.20641) = 1.189747e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19459) = 1.197820e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19065) = 1.200535e-160 2000 rounds
+ 411.330980 m 8.0000 182
QuantileBeta(0.15, 0.00500, 2.19065) = 1.200535e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19065) = 1.200535e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19065) = 1.200535e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19065) = 1.200535e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19065) = 1.200535e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19065) = 1.200535e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19065) = 1.200535e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19065) = 1.200535e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19077) = 1.200451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19053) = 1.200619e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19065) = 1.200535e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19065) = 1.200535e-160 2000 rounds
| 9/11
13 h-m-p 0.0468 0.8566 1.2585
QuantileBeta(0.15, 0.00500, 2.17095) = 1.214294e-160 2000 rounds
+++ 411.330980 m 0.8566 199 | 9/11
14 h-m-p 1.1022 8.0000 0.9781
QuantileBeta(0.15, 0.00500, 2.19065) = 1.200535e-160 2000 rounds
--------C 411.330980 0 0.0000 221 | 9/11
15 h-m-p 1.6000 8.0000 0.0000 C 411.330980 0 0.4000 237 | 9/11
16 h-m-p 0.0113 0.3068 0.0000 -----Y 411.330980 0 0.0000 258
Out..
lnL = -411.330980
259 lfun, 3108 eigenQcodon, 17094 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -411.358282 S = -411.331403 -0.011843
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 45 patterns 0:16
did 20 / 45 patterns 0:16
did 30 / 45 patterns 0:17
did 40 / 45 patterns 0:17
did 45 / 45 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=102
NC_011896_1_WP_010908655_1_2113_MLBR_RS10040 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
NC_002677_1_NP_302335_1_1207_ML1982 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
NZ_LVXE01000003_1_WP_010908655_1_1302_A3216_RS02215 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
NZ_LYPH01000033_1_WP_010908655_1_1381_A8144_RS06605 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
NZ_CP029543_1_WP_010908655_1_2134_DIJ64_RS10865 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
NZ_AP014567_1_WP_010908655_1_2194_JK2ML_RS11165 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR
**************************************************
NC_011896_1_WP_010908655_1_2113_MLBR_RS10040 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
NC_002677_1_NP_302335_1_1207_ML1982 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
NZ_LVXE01000003_1_WP_010908655_1_1302_A3216_RS02215 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
NZ_LYPH01000033_1_WP_010908655_1_1381_A8144_RS06605 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
NZ_CP029543_1_WP_010908655_1_2134_DIJ64_RS10865 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
NZ_AP014567_1_WP_010908655_1_2194_JK2ML_RS11165 YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK
**************************************************
NC_011896_1_WP_010908655_1_2113_MLBR_RS10040 AL
NC_002677_1_NP_302335_1_1207_ML1982 AL
NZ_LVXE01000003_1_WP_010908655_1_1302_A3216_RS02215 AL
NZ_LYPH01000033_1_WP_010908655_1_1381_A8144_RS06605 AL
NZ_CP029543_1_WP_010908655_1_2134_DIJ64_RS10865 AL
NZ_AP014567_1_WP_010908655_1_2194_JK2ML_RS11165 AL
**
>NC_011896_1_WP_010908655_1_2113_MLBR_RS10040 ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG GCACTC >NC_002677_1_NP_302335_1_1207_ML1982 ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG GCACTC >NZ_LVXE01000003_1_WP_010908655_1_1302_A3216_RS02215 ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG GCACTC >NZ_LYPH01000033_1_WP_010908655_1_1381_A8144_RS06605 ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG GCACTC >NZ_CP029543_1_WP_010908655_1_2134_DIJ64_RS10865 ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG GCACTC >NZ_AP014567_1_WP_010908655_1_2194_JK2ML_RS11165 ATGTCGCACCTCACCAGGCTATGTGTCCGCTACGTCAAACGCTTTATGCC AGATCCGTACTTATTCGCTGCCATCCTTACCATCATTGTGGTGATGCTTA CCGCGCCGCTCGTCAGAGACACGACGGCCGCCAGCATGTTCAAAGCGCGG TACAGCGGAGTATGGGGATCGCAGCATATCTTCCACCTTCACGTTACAGA TGGTGCGGGTCCTAGTGACTGGGCTACACGCTGGCCTAGGCTACCTGTTC TGAGTAGCGCCATCGTCCATATCGGAGTAAACTTAAGAATTAGGTGCAAG GCACTC
>NC_011896_1_WP_010908655_1_2113_MLBR_RS10040 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK AL >NC_002677_1_NP_302335_1_1207_ML1982 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK AL >NZ_LVXE01000003_1_WP_010908655_1_1302_A3216_RS02215 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK AL >NZ_LYPH01000033_1_WP_010908655_1_1381_A8144_RS06605 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK AL >NZ_CP029543_1_WP_010908655_1_2134_DIJ64_RS10865 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK AL >NZ_AP014567_1_WP_010908655_1_2194_JK2ML_RS11165 MSHLTRLCVRYVKRFMPDPYLFAAILTIIVVMLTAPLVRDTTAASMFKAR YSGVWGSQHIFHLHVTDGAGPSDWATRWPRLPVLSSAIVHIGVNLRIRCK AL
#NEXUS
[ID: 5225382452]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908655_1_2113_MLBR_RS10040
NC_002677_1_NP_302335_1_1207_ML1982
NZ_LVXE01000003_1_WP_010908655_1_1302_A3216_RS02215
NZ_LYPH01000033_1_WP_010908655_1_1381_A8144_RS06605
NZ_CP029543_1_WP_010908655_1_2134_DIJ64_RS10865
NZ_AP014567_1_WP_010908655_1_2194_JK2ML_RS11165
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908655_1_2113_MLBR_RS10040,
2 NC_002677_1_NP_302335_1_1207_ML1982,
3 NZ_LVXE01000003_1_WP_010908655_1_1302_A3216_RS02215,
4 NZ_LYPH01000033_1_WP_010908655_1_1381_A8144_RS06605,
5 NZ_CP029543_1_WP_010908655_1_2134_DIJ64_RS10865,
6 NZ_AP014567_1_WP_010908655_1_2194_JK2ML_RS11165
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0727597,2:0.06786328,3:0.0704907,4:0.07173328,5:0.070865,6:0.06545372);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0727597,2:0.06786328,3:0.0704907,4:0.07173328,5:0.070865,6:0.06545372);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -424.32 -429.28
2 -424.38 -427.62
--------------------------------------
TOTAL -424.35 -428.76
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML1982/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898199 0.089585 0.351766 1.488975 0.863126 673.98 712.49 1.000
r(A<->C){all} 0.173933 0.020398 0.000285 0.461230 0.140122 81.59 105.71 1.004
r(A<->G){all} 0.181600 0.022725 0.000124 0.484576 0.141396 63.97 72.56 1.009
r(A<->T){all} 0.147197 0.015890 0.000009 0.390259 0.114140 135.36 180.11 1.003
r(C<->G){all} 0.168368 0.021966 0.000062 0.487042 0.126095 95.66 95.81 0.999
r(C<->T){all} 0.179213 0.019974 0.000096 0.461030 0.146894 80.11 103.00 1.008
r(G<->T){all} 0.149689 0.014091 0.000028 0.371584 0.121961 98.53 137.42 0.999
pi(A){all} 0.215302 0.000562 0.169111 0.260541 0.215291 637.20 653.31 1.000
pi(C){all} 0.287956 0.000678 0.238704 0.339951 0.287796 615.48 683.24 1.000
pi(G){all} 0.254664 0.000630 0.210670 0.307493 0.253785 624.75 652.86 1.000
pi(T){all} 0.242078 0.000570 0.199446 0.292984 0.241857 638.41 672.22 0.999
alpha{1,2} 0.411463 0.239646 0.000890 1.434141 0.244014 379.15 466.78 1.000
alpha{3} 0.446455 0.223670 0.001055 1.462034 0.299336 541.15 561.42 0.999
pinvar{all} 0.994557 0.000039 0.982302 0.999998 0.996584 422.19 540.62 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML1982/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 102
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 1 1 1 1 1 1
TTC 3 3 3 3 3 3 | TCC 0 0 0 0 0 0 | TAC 3 3 3 3 3 3 | TGC 1 1 1 1 1 1
Leu TTA 2 2 2 2 2 2 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 3 3 3 3 3 3 | His CAT 2 2 2 2 2 2 | Arg CGT 0 0 0 0 0 0
CTC 3 3 3 3 3 3 | CCC 0 0 0 0 0 0 | CAC 3 3 3 3 3 3 | CGC 3 3 3 3 3 3
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 1 1 1 1 1 1 | CCG 2 2 2 2 2 2 | CAG 1 1 1 1 1 1 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 2 2 2 2 2 2
ATC 5 5 5 5 5 5 | ACC 3 3 3 3 3 3 | AAC 1 1 1 1 1 1 | AGC 3 3 3 3 3 3
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 2 2 2 2 2 2
Met ATG 4 4 4 4 4 4 | ACG 2 2 2 2 2 2 | AAG 1 1 1 1 1 1 | AGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 2 2 2 2 2 2 | Asp GAT 2 2 2 2 2 2 | Gly GGT 2 2 2 2 2 2
GTC 4 4 4 4 4 4 | GCC 4 4 4 4 4 4 | GAC 2 2 2 2 2 2 | GGC 0 0 0 0 0 0
GTA 2 2 2 2 2 2 | GCA 1 1 1 1 1 1 | Glu GAA 0 0 0 0 0 0 | GGA 3 3 3 3 3 3
GTG 2 2 2 2 2 2 | GCG 3 3 3 3 3 3 | GAG 0 0 0 0 0 0 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908655_1_2113_MLBR_RS10040
position 1: T:0.15686 C:0.24510 A:0.31373 G:0.28431
position 2: T:0.35294 C:0.24510 A:0.16667 G:0.23529
position 3: T:0.21569 C:0.37255 A:0.16667 G:0.24510
Average T:0.24183 C:0.28758 A:0.21569 G:0.25490
#2: NC_002677_1_NP_302335_1_1207_ML1982
position 1: T:0.15686 C:0.24510 A:0.31373 G:0.28431
position 2: T:0.35294 C:0.24510 A:0.16667 G:0.23529
position 3: T:0.21569 C:0.37255 A:0.16667 G:0.24510
Average T:0.24183 C:0.28758 A:0.21569 G:0.25490
#3: NZ_LVXE01000003_1_WP_010908655_1_1302_A3216_RS02215
position 1: T:0.15686 C:0.24510 A:0.31373 G:0.28431
position 2: T:0.35294 C:0.24510 A:0.16667 G:0.23529
position 3: T:0.21569 C:0.37255 A:0.16667 G:0.24510
Average T:0.24183 C:0.28758 A:0.21569 G:0.25490
#4: NZ_LYPH01000033_1_WP_010908655_1_1381_A8144_RS06605
position 1: T:0.15686 C:0.24510 A:0.31373 G:0.28431
position 2: T:0.35294 C:0.24510 A:0.16667 G:0.23529
position 3: T:0.21569 C:0.37255 A:0.16667 G:0.24510
Average T:0.24183 C:0.28758 A:0.21569 G:0.25490
#5: NZ_CP029543_1_WP_010908655_1_2134_DIJ64_RS10865
position 1: T:0.15686 C:0.24510 A:0.31373 G:0.28431
position 2: T:0.35294 C:0.24510 A:0.16667 G:0.23529
position 3: T:0.21569 C:0.37255 A:0.16667 G:0.24510
Average T:0.24183 C:0.28758 A:0.21569 G:0.25490
#6: NZ_AP014567_1_WP_010908655_1_2194_JK2ML_RS11165
position 1: T:0.15686 C:0.24510 A:0.31373 G:0.28431
position 2: T:0.35294 C:0.24510 A:0.16667 G:0.23529
position 3: T:0.21569 C:0.37255 A:0.16667 G:0.24510
Average T:0.24183 C:0.28758 A:0.21569 G:0.25490
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 6
TTC 18 | TCC 0 | TAC 18 | TGC 6
Leu L TTA 12 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 12 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 18 | His H CAT 12 | Arg R CGT 0
CTC 18 | CCC 0 | CAC 18 | CGC 18
CTA 12 | CCA 6 | Gln Q CAA 0 | CGA 0
CTG 6 | CCG 12 | CAG 6 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 12
ATC 30 | ACC 18 | AAC 6 | AGC 18
ATA 0 | ACA 12 | Lys K AAA 12 | Arg R AGA 12
Met M ATG 24 | ACG 12 | AAG 6 | AGG 18
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 12 | Asp D GAT 12 | Gly G GGT 12
GTC 24 | GCC 24 | GAC 12 | GGC 0
GTA 12 | GCA 6 | Glu E GAA 0 | GGA 18
GTG 12 | GCG 18 | GAG 0 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15686 C:0.24510 A:0.31373 G:0.28431
position 2: T:0.35294 C:0.24510 A:0.16667 G:0.23529
position 3: T:0.21569 C:0.37255 A:0.16667 G:0.24510
Average T:0.24183 C:0.28758 A:0.21569 G:0.25490
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -411.331187 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299960 1.299770
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908655_1_2113_MLBR_RS10040: 0.000004, NC_002677_1_NP_302335_1_1207_ML1982: 0.000004, NZ_LVXE01000003_1_WP_010908655_1_1302_A3216_RS02215: 0.000004, NZ_LYPH01000033_1_WP_010908655_1_1381_A8144_RS06605: 0.000004, NZ_CP029543_1_WP_010908655_1_2134_DIJ64_RS10865: 0.000004, NZ_AP014567_1_WP_010908655_1_2194_JK2ML_RS11165: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29996
omega (dN/dS) = 1.29977
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 233.0 73.0 1.2998 0.0000 0.0000 0.0 0.0
7..2 0.000 233.0 73.0 1.2998 0.0000 0.0000 0.0 0.0
7..3 0.000 233.0 73.0 1.2998 0.0000 0.0000 0.0 0.0
7..4 0.000 233.0 73.0 1.2998 0.0000 0.0000 0.0 0.0
7..5 0.000 233.0 73.0 1.2998 0.0000 0.0000 0.0 0.0
7..6 0.000 233.0 73.0 1.2998 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -411.331006 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.225473 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908655_1_2113_MLBR_RS10040: 0.000004, NC_002677_1_NP_302335_1_1207_ML1982: 0.000004, NZ_LVXE01000003_1_WP_010908655_1_1302_A3216_RS02215: 0.000004, NZ_LYPH01000033_1_WP_010908655_1_1381_A8144_RS06605: 0.000004, NZ_CP029543_1_WP_010908655_1_2134_DIJ64_RS10865: 0.000004, NZ_AP014567_1_WP_010908655_1_2194_JK2ML_RS11165: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.22547
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 233.9 72.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 233.9 72.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 233.9 72.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 233.9 72.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 233.9 72.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 233.9 72.1 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -411.331128 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.112218 0.679908 0.186552 0.000001 1.512143
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908655_1_2113_MLBR_RS10040: 0.000004, NC_002677_1_NP_302335_1_1207_ML1982: 0.000004, NZ_LVXE01000003_1_WP_010908655_1_1302_A3216_RS02215: 0.000004, NZ_LYPH01000033_1_WP_010908655_1_1381_A8144_RS06605: 0.000004, NZ_CP029543_1_WP_010908655_1_2134_DIJ64_RS10865: 0.000004, NZ_AP014567_1_WP_010908655_1_2194_JK2ML_RS11165: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.11222
MLEs of dN/dS (w) for site classes (K=3)
p: 0.67991 0.18655 0.13354
w: 0.00000 1.00000 1.51214
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 235.2 70.8 0.3885 0.0000 0.0000 0.0 0.0
7..2 0.000 235.2 70.8 0.3885 0.0000 0.0000 0.0 0.0
7..3 0.000 235.2 70.8 0.3885 0.0000 0.0000 0.0 0.0
7..4 0.000 235.2 70.8 0.3885 0.0000 0.0000 0.0 0.0
7..5 0.000 235.2 70.8 0.3885 0.0000 0.0000 0.0 0.0
7..6 0.000 235.2 70.8 0.3885 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908655_1_2113_MLBR_RS10040)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908655_1_2113_MLBR_RS10040)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 12): -411.330980 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000053 0.000390 0.000001 0.000001 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908655_1_2113_MLBR_RS10040: 0.000004, NC_002677_1_NP_302335_1_1207_ML1982: 0.000004, NZ_LVXE01000003_1_WP_010908655_1_1302_A3216_RS02215: 0.000004, NZ_LYPH01000033_1_WP_010908655_1_1381_A8144_RS06605: 0.000004, NZ_CP029543_1_WP_010908655_1_2134_DIJ64_RS10865: 0.000004, NZ_AP014567_1_WP_010908655_1_2194_JK2ML_RS11165: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00005 0.00039 0.99956
w: 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Time used: 0:09
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -411.330980 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.843061
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908655_1_2113_MLBR_RS10040: 0.000004, NC_002677_1_NP_302335_1_1207_ML1982: 0.000004, NZ_LVXE01000003_1_WP_010908655_1_1302_A3216_RS02215: 0.000004, NZ_LYPH01000033_1_WP_010908655_1_1381_A8144_RS06605: 0.000004, NZ_CP029543_1_WP_010908655_1_2134_DIJ64_RS10865: 0.000004, NZ_AP014567_1_WP_010908655_1_2194_JK2ML_RS11165: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.84306
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:12
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -411.330980 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.829938 1.000004
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908655_1_2113_MLBR_RS10040: 0.000004, NC_002677_1_NP_302335_1_1207_ML1982: 0.000004, NZ_LVXE01000003_1_WP_010908655_1_1302_A3216_RS02215: 0.000004, NZ_LYPH01000033_1_WP_010908655_1_1381_A8144_RS06605: 0.000004, NZ_CP029543_1_WP_010908655_1_2134_DIJ64_RS10865: 0.000004, NZ_AP014567_1_WP_010908655_1_2194_JK2ML_RS11165: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.82994
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.00000
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 236.7 69.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908655_1_2113_MLBR_RS10040)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Time used: 0:17
Model 1: NearlyNeutral -411.331006 Model 2: PositiveSelection -411.331128 Model 0: one-ratio -411.331187 Model 3: discrete -411.33098 Model 7: beta -411.33098 Model 8: beta&w>1 -411.33098 Model 0 vs 1 3.6199999999553256E-4 Model 2 vs 1 2.439999999523934E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
