--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:42:38 GMT 2020
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=500000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=1250
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=1250
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/8res/ML1983/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -639.99 -643.78
2 -640.00 -643.76
--------------------------------------
TOTAL -640.00 -643.77
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898694 0.086082 0.361689 1.467920 0.870915 615.49 683.25 0.999
r(A<->C){all} 0.180770 0.021373 0.000075 0.472030 0.144800 103.76 104.55 1.012
r(A<->G){all} 0.142226 0.015735 0.000028 0.400863 0.103128 63.94 101.00 1.004
r(A<->T){all} 0.167270 0.019844 0.000029 0.449791 0.128177 51.89 67.80 1.010
r(C<->G){all} 0.174144 0.019011 0.000215 0.417438 0.145043 80.67 92.92 1.000
r(C<->T){all} 0.184752 0.021445 0.000120 0.474172 0.146481 65.42 95.40 1.026
r(G<->T){all} 0.150838 0.016860 0.000084 0.414844 0.114339 80.62 81.00 1.024
pi(A){all} 0.226269 0.000378 0.189796 0.265247 0.225448 662.48 706.74 0.999
pi(C){all} 0.253388 0.000403 0.215324 0.294003 0.252887 409.97 509.07 1.000
pi(G){all} 0.316322 0.000439 0.277179 0.360987 0.316030 516.77 633.88 0.999
pi(T){all} 0.204021 0.000342 0.172215 0.244315 0.203332 563.69 657.35 1.000
alpha{1,2} 0.415560 0.225606 0.000313 1.347253 0.247452 502.40 513.96 1.000
alpha{3} 0.502742 0.279839 0.000188 1.558430 0.322222 506.81 589.38 1.002
pinvar{all} 0.996416 0.000020 0.988722 0.999997 0.997785 594.39 659.25 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -628.875204
Model 2: PositiveSelection -628.875195
Model 0: one-ratio -628.875203
Model 3: discrete -628.875198
Model 7: beta -628.875182
Model 8: beta&w>1 -628.87519
Model 0 vs 1 1.9999999949504854E-6
Model 2 vs 1 1.8000000181928044E-5
Model 8 vs 7 1.5999999959603883E-5
>C1
MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
SDGVQ
>C2
MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
SDGVQ
>C3
MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
SDGVQ
>C4
MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
SDGVQ
>C5
MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
SDGVQ
>C6
MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
SDGVQ
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=155
C1 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
C2 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
C3 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
C4 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
C5 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
C6 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
**************************************************
C1 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
C2 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
C3 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
C4 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
C5 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
C6 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
**************************************************
C1 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
C2 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
C3 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
C4 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
C5 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
C6 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
**************************************************
C1 SDGVQ
C2 SDGVQ
C3 SDGVQ
C4 SDGVQ
C5 SDGVQ
C6 SDGVQ
*****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 155 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 155 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4650]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4650]--->[4650]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.468 Mb, Max= 30.690 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
C2 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
C3 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
C4 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
C5 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
C6 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
**************************************************
C1 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
C2 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
C3 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
C4 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
C5 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
C6 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
**************************************************
C1 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
C2 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
C3 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
C4 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
C5 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
C6 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
**************************************************
C1 SDGVQ
C2 SDGVQ
C3 SDGVQ
C4 SDGVQ
C5 SDGVQ
C6 SDGVQ
*****
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC
C2 ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC
C3 ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC
C4 ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC
C5 ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC
C6 ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC
**************************************************
C1 TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT
C2 TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT
C3 TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT
C4 TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT
C5 TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT
C6 TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT
**************************************************
C1 GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG
C2 GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG
C3 GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG
C4 GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG
C5 GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG
C6 GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG
**************************************************
C1 AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT
C2 AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT
C3 AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT
C4 AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT
C5 AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT
C6 AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT
**************************************************
C1 GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA
C2 GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA
C3 GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA
C4 GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA
C5 GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA
C6 GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA
**************************************************
C1 AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT
C2 AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT
C3 AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT
C4 AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT
C5 AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT
C6 AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT
**************************************************
C1 TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT
C2 TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT
C3 TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT
C4 TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT
C5 TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT
C6 TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT
**************************************************
C1 TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG
C2 TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG
C3 TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG
C4 TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG
C5 TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG
C6 TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG
**************************************************
C1 GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG
C2 GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG
C3 GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG
C4 GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG
C5 GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG
C6 GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG
**************************************************
C1 TCGGACGGTGTTCAG
C2 TCGGACGGTGTTCAG
C3 TCGGACGGTGTTCAG
C4 TCGGACGGTGTTCAG
C5 TCGGACGGTGTTCAG
C6 TCGGACGGTGTTCAG
***************
>C1
ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC
TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT
GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG
AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT
GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA
AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT
TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT
TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG
GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG
TCGGACGGTGTTCAG
>C2
ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC
TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT
GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG
AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT
GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA
AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT
TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT
TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG
GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG
TCGGACGGTGTTCAG
>C3
ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC
TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT
GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG
AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT
GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA
AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT
TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT
TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG
GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG
TCGGACGGTGTTCAG
>C4
ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC
TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT
GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG
AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT
GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA
AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT
TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT
TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG
GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG
TCGGACGGTGTTCAG
>C5
ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC
TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT
GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG
AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT
GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA
AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT
TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT
TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG
GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG
TCGGACGGTGTTCAG
>C6
ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC
TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT
GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG
AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT
GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA
AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT
TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT
TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG
GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG
TCGGACGGTGTTCAG
>C1
MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
SDGVQ
>C2
MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
SDGVQ
>C3
MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
SDGVQ
>C4
MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
SDGVQ
>C5
MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
SDGVQ
>C6
MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
SDGVQ
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 465 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855313
Setting output file names to "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1298897908
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 500000
Running Markov chain
MCMC stamp = 5487688786
Seed = 944849244
Swapseed = 1579855313
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1040.692133 -- -24.965149
Chain 2 -- -1040.692292 -- -24.965149
Chain 3 -- -1040.692232 -- -24.965149
Chain 4 -- -1040.692232 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1040.692292 -- -24.965149
Chain 2 -- -1040.692292 -- -24.965149
Chain 3 -- -1040.692292 -- -24.965149
Chain 4 -- -1040.692133 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (500000 generations requested):
0 -- [-1040.692] (-1040.692) (-1040.692) (-1040.692) * [-1040.692] (-1040.692) (-1040.692) (-1040.692)
500 -- (-656.821) [-648.697] (-661.009) (-656.950) * (-650.352) [-650.393] (-654.683) (-650.979) -- 0:00:00
1000 -- [-647.053] (-650.599) (-650.395) (-650.472) * [-654.596] (-654.992) (-647.720) (-649.415) -- 0:00:00
1500 -- (-645.384) (-650.177) (-657.371) [-650.831] * [-647.459] (-652.058) (-651.964) (-654.926) -- 0:00:00
2000 -- (-650.171) (-653.455) (-654.764) [-644.529] * (-650.894) [-643.273] (-646.793) (-650.768) -- 0:00:00
2500 -- (-653.961) (-653.240) [-646.444] (-647.714) * (-651.223) [-647.619] (-661.548) (-644.604) -- 0:00:00
3000 -- (-646.781) (-643.248) (-651.340) [-646.795] * (-655.890) [-647.445] (-644.079) (-651.906) -- 0:00:00
3500 -- (-648.078) [-645.671] (-649.417) (-650.739) * [-651.684] (-644.357) (-645.529) (-663.315) -- 0:00:00
4000 -- (-654.213) (-648.141) (-649.304) [-645.613] * (-648.246) (-655.335) [-645.455] (-648.329) -- 0:00:00
4500 -- (-647.982) [-648.922] (-646.572) (-645.389) * (-650.592) [-651.128] (-658.538) (-648.852) -- 0:00:00
5000 -- (-654.186) [-646.247] (-651.602) (-649.143) * (-651.827) (-650.494) (-651.886) [-647.598] -- 0:00:00
Average standard deviation of split frequencies: 0.109311
5500 -- [-652.125] (-657.612) (-645.017) (-646.336) * (-658.822) [-653.702] (-659.218) (-649.047) -- 0:00:00
6000 -- [-648.926] (-666.400) (-656.785) (-652.479) * (-654.091) (-651.721) [-649.987] (-650.567) -- 0:00:00
6500 -- (-644.055) [-650.573] (-650.107) (-650.234) * (-650.055) (-653.639) (-648.582) [-649.894] -- 0:01:15
7000 -- (-648.709) (-649.514) (-650.608) [-650.782] * [-648.298] (-651.717) (-656.600) (-649.107) -- 0:01:10
7500 -- (-648.815) [-652.677] (-646.287) (-654.039) * (-649.756) [-651.296] (-648.923) (-645.182) -- 0:01:05
8000 -- (-646.204) (-647.792) (-653.029) [-649.788] * (-644.801) [-649.930] (-657.119) (-648.121) -- 0:01:01
8500 -- (-650.503) [-652.242] (-658.904) (-649.107) * (-646.096) (-660.724) (-652.247) [-648.534] -- 0:00:57
9000 -- (-654.680) [-650.410] (-639.045) (-662.346) * (-654.826) (-647.242) [-645.439] (-647.475) -- 0:00:54
9500 -- [-649.856] (-655.198) (-640.430) (-654.017) * (-649.152) [-646.250] (-655.732) (-649.256) -- 0:00:51
10000 -- (-648.374) [-658.225] (-640.876) (-650.295) * (-660.341) (-649.998) (-653.395) [-646.918] -- 0:00:49
Average standard deviation of split frequencies: 0.086380
10500 -- (-647.239) (-656.440) (-640.445) [-649.952] * [-644.717] (-650.764) (-655.385) (-653.805) -- 0:00:46
11000 -- [-647.202] (-658.498) (-640.792) (-649.953) * (-644.361) (-647.005) (-661.066) [-649.658] -- 0:00:44
11500 -- (-649.725) (-650.179) (-639.329) [-649.939] * (-649.882) [-651.548] (-655.307) (-656.223) -- 0:00:42
12000 -- (-643.585) [-639.116] (-640.005) (-646.726) * [-645.552] (-648.429) (-660.645) (-647.694) -- 0:00:40
12500 -- (-645.432) [-638.951] (-642.478) (-653.299) * (-649.782) (-652.628) (-643.326) [-648.758] -- 0:00:39
13000 -- (-647.881) [-638.760] (-639.751) (-650.601) * (-648.065) [-647.977] (-642.395) (-647.710) -- 0:00:37
13500 -- (-655.598) [-643.234] (-639.711) (-653.181) * (-652.920) (-652.765) [-639.418] (-649.972) -- 0:00:36
14000 -- (-660.722) (-643.854) [-638.915] (-651.107) * (-650.394) [-648.028] (-641.797) (-650.688) -- 0:00:34
14500 -- (-647.589) (-641.191) (-640.030) [-648.449] * (-649.836) (-647.899) (-641.792) [-646.127] -- 0:00:33
15000 -- (-649.076) (-641.649) [-638.639] (-644.732) * (-649.816) [-647.573] (-640.649) (-654.696) -- 0:00:32
Average standard deviation of split frequencies: 0.060329
15500 -- (-645.759) (-638.691) [-639.173] (-648.366) * (-654.025) (-649.886) [-640.054] (-658.034) -- 0:00:31
16000 -- (-648.724) (-641.273) [-638.754] (-653.880) * (-652.102) (-651.877) (-639.985) [-649.974] -- 0:00:30
16500 -- (-649.035) (-640.807) [-639.249] (-647.955) * (-653.203) [-650.962] (-642.280) (-656.774) -- 0:00:29
17000 -- (-658.807) (-639.408) (-639.257) [-646.415] * (-654.614) [-651.829] (-640.958) (-655.956) -- 0:00:28
17500 -- (-647.245) (-638.563) [-638.499] (-655.972) * [-651.573] (-648.022) (-641.565) (-657.256) -- 0:00:27
18000 -- (-649.688) [-639.324] (-638.885) (-661.813) * [-647.492] (-651.188) (-640.393) (-645.782) -- 0:00:26
18500 -- (-655.412) (-639.591) [-641.365] (-674.056) * (-648.168) (-656.843) [-641.895] (-657.221) -- 0:00:26
19000 -- [-648.605] (-641.767) (-641.228) (-659.265) * (-651.707) [-643.534] (-642.432) (-647.116) -- 0:00:25
19500 -- (-648.479) (-641.349) (-638.422) [-640.378] * (-652.078) (-642.124) [-644.500] (-649.403) -- 0:00:24
20000 -- [-651.651] (-640.540) (-642.841) (-639.955) * (-660.366) [-641.031] (-643.051) (-643.798) -- 0:00:24
Average standard deviation of split frequencies: 0.052823
20500 -- (-657.348) [-641.261] (-641.599) (-639.511) * (-652.136) (-640.234) (-643.148) [-644.154] -- 0:00:23
21000 -- [-655.148] (-639.197) (-646.159) (-639.552) * (-652.244) [-641.022] (-640.967) (-646.876) -- 0:00:22
21500 -- (-658.504) (-638.648) [-644.324] (-640.301) * (-653.463) (-639.085) (-640.195) [-650.078] -- 0:00:22
22000 -- (-655.813) (-639.064) [-639.566] (-640.337) * (-650.200) (-641.502) (-640.010) [-652.521] -- 0:00:43
22500 -- (-649.608) (-640.445) (-642.499) [-642.599] * [-649.365] (-644.695) (-641.185) (-650.770) -- 0:00:42
23000 -- (-657.513) (-638.554) [-641.112] (-642.763) * (-665.452) [-641.934] (-639.900) (-647.938) -- 0:00:41
23500 -- [-649.693] (-638.814) (-640.655) (-645.815) * (-656.830) [-639.164] (-640.669) (-646.492) -- 0:00:40
24000 -- (-650.556) (-639.839) (-641.613) [-641.313] * [-644.318] (-640.035) (-639.521) (-641.915) -- 0:00:39
24500 -- (-646.832) (-640.315) (-644.799) [-642.332] * (-657.601) [-638.778] (-639.689) (-640.525) -- 0:00:38
25000 -- (-647.200) (-639.962) [-641.065] (-644.406) * (-650.766) (-644.504) [-638.707] (-642.760) -- 0:00:38
Average standard deviation of split frequencies: 0.039415
25500 -- [-647.698] (-643.619) (-639.614) (-640.334) * [-646.380] (-642.763) (-639.978) (-640.510) -- 0:00:37
26000 -- (-648.404) (-638.895) [-640.344] (-642.799) * (-650.334) (-639.296) (-639.541) [-640.887] -- 0:00:36
26500 -- (-654.314) (-638.893) (-644.010) [-639.658] * (-654.044) (-639.448) (-641.918) [-640.094] -- 0:00:35
27000 -- (-653.831) (-639.701) (-641.067) [-639.949] * (-646.263) [-639.742] (-642.131) (-640.623) -- 0:00:35
27500 -- [-645.127] (-640.098) (-639.416) (-638.722) * [-648.965] (-640.176) (-641.098) (-640.736) -- 0:00:34
28000 -- (-652.157) (-639.009) (-640.002) [-639.350] * (-659.640) [-639.512] (-643.530) (-640.864) -- 0:00:33
28500 -- (-650.992) [-639.417] (-642.268) (-642.660) * [-645.937] (-641.807) (-643.894) (-639.801) -- 0:00:33
29000 -- (-650.373) (-641.564) (-641.622) [-643.541] * [-645.745] (-644.049) (-641.478) (-641.396) -- 0:00:32
29500 -- [-643.721] (-641.882) (-645.706) (-641.821) * (-646.799) [-642.021] (-638.918) (-640.693) -- 0:00:31
30000 -- (-649.986) (-641.606) [-640.248] (-641.959) * (-648.123) [-639.187] (-639.540) (-643.371) -- 0:00:31
Average standard deviation of split frequencies: 0.040992
30500 -- [-645.912] (-639.546) (-639.402) (-639.841) * (-653.365) (-643.984) (-641.004) [-640.946] -- 0:00:30
31000 -- [-650.171] (-641.946) (-638.977) (-639.579) * (-649.729) (-639.590) (-640.357) [-640.930] -- 0:00:30
31500 -- (-652.055) (-642.700) (-643.134) [-638.833] * [-647.830] (-641.475) (-641.743) (-642.928) -- 0:00:29
32000 -- (-647.738) (-641.678) (-643.028) [-643.117] * (-651.786) (-640.059) (-639.625) [-639.666] -- 0:00:29
32500 -- (-654.982) (-641.104) (-640.078) [-640.426] * [-649.486] (-641.988) (-640.952) (-641.272) -- 0:00:28
33000 -- (-653.657) (-639.158) (-642.943) [-639.459] * (-653.278) (-638.937) [-641.752] (-643.669) -- 0:00:28
33500 -- [-650.112] (-639.234) (-643.300) (-638.839) * [-650.453] (-638.958) (-639.039) (-641.753) -- 0:00:27
34000 -- (-646.812) [-639.818] (-639.986) (-644.214) * (-651.578) (-638.741) (-640.860) [-640.617] -- 0:00:27
34500 -- [-648.112] (-639.693) (-642.026) (-639.559) * (-647.179) (-642.680) (-642.386) [-638.629] -- 0:00:26
35000 -- (-652.022) (-639.373) (-639.062) [-642.459] * [-653.389] (-645.174) (-639.718) (-640.340) -- 0:00:26
Average standard deviation of split frequencies: 0.038629
35500 -- (-656.760) (-643.376) [-639.221] (-642.152) * [-651.908] (-644.084) (-639.216) (-641.383) -- 0:00:26
36000 -- [-647.947] (-640.975) (-641.118) (-640.604) * [-647.085] (-643.277) (-641.328) (-642.083) -- 0:00:25
36500 -- (-653.305) [-642.151] (-639.182) (-645.098) * (-651.225) [-643.150] (-641.638) (-641.573) -- 0:00:25
37000 -- [-644.113] (-643.283) (-640.535) (-640.154) * (-652.603) [-643.634] (-641.045) (-642.112) -- 0:00:37
37500 -- [-656.372] (-642.755) (-639.841) (-640.925) * (-656.172) (-641.246) [-639.977] (-640.074) -- 0:00:37
38000 -- (-642.872) [-640.057] (-642.615) (-639.006) * (-653.737) [-640.971] (-640.694) (-641.423) -- 0:00:36
38500 -- [-646.205] (-639.826) (-641.944) (-643.368) * [-661.360] (-638.467) (-640.354) (-645.167) -- 0:00:35
39000 -- (-646.301) (-640.050) (-638.672) [-639.748] * (-641.736) (-639.433) [-640.332] (-644.797) -- 0:00:35
39500 -- (-654.144) (-639.263) [-638.903] (-640.370) * [-642.554] (-645.185) (-640.402) (-640.581) -- 0:00:34
40000 -- (-647.506) [-642.622] (-640.034) (-641.300) * [-640.855] (-640.978) (-640.008) (-639.339) -- 0:00:34
Average standard deviation of split frequencies: 0.039992
40500 -- (-648.889) [-640.963] (-640.470) (-638.825) * (-643.735) (-641.146) (-640.324) [-640.599] -- 0:00:34
41000 -- (-647.104) (-638.832) (-640.178) [-639.108] * (-640.650) [-644.595] (-639.253) (-638.745) -- 0:00:33
41500 -- [-648.426] (-639.125) (-642.236) (-641.527) * (-643.505) [-641.470] (-640.570) (-638.650) -- 0:00:33
42000 -- [-645.007] (-643.037) (-639.155) (-644.535) * (-641.990) (-642.422) (-638.764) [-643.431] -- 0:00:32
42500 -- [-651.253] (-646.989) (-639.655) (-650.242) * (-639.943) (-641.358) [-640.792] (-640.112) -- 0:00:32
43000 -- [-645.881] (-644.576) (-640.443) (-640.876) * (-640.180) (-640.802) (-641.058) [-640.446] -- 0:00:31
43500 -- (-652.289) [-642.632] (-646.272) (-645.356) * [-639.115] (-643.225) (-640.901) (-642.690) -- 0:00:31
44000 -- (-648.453) [-645.248] (-642.190) (-641.224) * [-638.715] (-641.529) (-641.533) (-640.143) -- 0:00:31
44500 -- (-650.423) [-641.346] (-639.276) (-644.724) * [-640.015] (-640.211) (-639.622) (-640.185) -- 0:00:30
45000 -- [-652.640] (-639.863) (-641.676) (-641.002) * (-646.161) (-642.225) [-640.152] (-641.396) -- 0:00:30
Average standard deviation of split frequencies: 0.040526
45500 -- [-649.489] (-640.070) (-640.377) (-640.141) * [-642.666] (-641.015) (-640.360) (-640.292) -- 0:00:29
46000 -- (-649.590) [-641.784] (-647.421) (-639.346) * [-639.955] (-642.998) (-639.057) (-638.638) -- 0:00:29
46500 -- [-648.070] (-641.760) (-640.132) (-639.253) * (-641.372) (-639.618) [-640.968] (-638.872) -- 0:00:29
47000 -- (-646.109) (-639.499) [-639.648] (-639.964) * (-645.972) (-639.594) (-641.226) [-640.271] -- 0:00:28
47500 -- [-645.004] (-643.327) (-639.170) (-640.472) * (-642.527) (-645.766) (-640.820) [-643.308] -- 0:00:28
48000 -- (-654.217) (-641.498) [-639.973] (-642.328) * (-641.897) (-641.765) (-641.943) [-641.817] -- 0:00:28
48500 -- (-649.966) (-644.206) [-639.294] (-644.332) * (-639.104) (-642.191) (-640.340) [-641.190] -- 0:00:27
49000 -- [-645.529] (-639.722) (-639.584) (-642.178) * (-642.369) (-639.700) (-641.152) [-639.135] -- 0:00:27
49500 -- (-646.918) (-641.163) (-641.970) [-641.052] * [-642.135] (-640.700) (-641.850) (-640.159) -- 0:00:27
50000 -- (-649.472) (-642.172) (-646.453) [-643.867] * (-638.826) (-640.336) [-643.838] (-639.967) -- 0:00:27
Average standard deviation of split frequencies: 0.031457
50500 -- (-645.649) (-639.576) (-644.057) [-641.172] * (-641.168) (-640.751) (-641.713) [-640.773] -- 0:00:26
51000 -- (-653.415) (-639.928) [-639.676] (-641.990) * (-640.431) [-639.203] (-641.842) (-639.010) -- 0:00:26
51500 -- (-650.257) [-640.579] (-639.328) (-640.706) * (-638.660) [-640.099] (-642.270) (-639.567) -- 0:00:26
52000 -- (-654.402) (-643.779) (-640.236) [-640.749] * (-638.513) [-640.701] (-646.713) (-640.943) -- 0:00:25
52500 -- (-650.025) (-641.321) (-640.382) [-640.118] * [-639.995] (-638.748) (-641.539) (-642.913) -- 0:00:34
53000 -- (-649.616) (-640.410) (-641.308) [-639.586] * (-639.539) (-640.890) (-640.388) [-641.583] -- 0:00:33
53500 -- (-659.555) (-643.387) [-639.720] (-649.423) * [-638.590] (-639.709) (-643.306) (-639.967) -- 0:00:33
54000 -- [-655.152] (-641.414) (-641.198) (-640.589) * [-641.610] (-639.636) (-643.403) (-640.611) -- 0:00:33
54500 -- (-657.020) (-639.369) (-641.136) [-641.075] * (-639.598) (-639.671) [-640.759] (-638.638) -- 0:00:32
55000 -- (-648.612) (-641.407) (-640.179) [-641.825] * (-642.126) (-639.277) [-641.750] (-643.748) -- 0:00:32
Average standard deviation of split frequencies: 0.031267
55500 -- (-652.625) (-641.958) [-639.512] (-640.716) * (-641.843) (-640.183) [-638.685] (-642.341) -- 0:00:32
56000 -- [-646.775] (-640.861) (-638.917) (-640.563) * (-641.757) [-640.046] (-642.733) (-640.578) -- 0:00:31
56500 -- (-660.979) (-643.939) [-639.576] (-643.135) * [-640.409] (-641.305) (-639.158) (-640.441) -- 0:00:31
57000 -- (-657.217) [-647.199] (-640.467) (-641.150) * (-641.400) (-643.881) (-640.966) [-642.727] -- 0:00:31
57500 -- (-650.910) (-643.642) (-640.597) [-639.219] * (-640.432) (-641.146) (-643.108) [-639.948] -- 0:00:30
58000 -- [-644.743] (-641.264) (-639.471) (-639.808) * [-640.089] (-643.742) (-644.859) (-647.642) -- 0:00:30
58500 -- (-654.256) (-639.157) (-639.871) [-640.138] * (-642.414) [-643.004] (-643.580) (-641.041) -- 0:00:30
59000 -- (-647.428) [-648.263] (-640.306) (-640.918) * [-642.385] (-644.687) (-653.397) (-641.773) -- 0:00:29
59500 -- (-654.565) (-641.989) [-640.082] (-640.239) * [-639.557] (-639.501) (-650.619) (-640.658) -- 0:00:29
60000 -- (-655.176) (-641.822) [-639.745] (-640.640) * (-640.199) [-638.920] (-646.714) (-640.008) -- 0:00:29
Average standard deviation of split frequencies: 0.031822
60500 -- (-654.361) [-644.789] (-641.698) (-641.195) * (-641.666) [-639.647] (-642.900) (-641.245) -- 0:00:29
61000 -- (-650.734) (-640.364) (-639.816) [-640.738] * (-640.919) (-643.482) (-640.695) [-639.270] -- 0:00:28
61500 -- (-649.894) [-639.120] (-639.349) (-640.240) * (-640.344) [-642.380] (-638.419) (-638.937) -- 0:00:28
62000 -- [-653.854] (-639.507) (-639.977) (-639.156) * (-640.244) (-639.567) [-641.696] (-641.859) -- 0:00:28
62500 -- [-645.679] (-641.700) (-639.337) (-640.361) * (-640.130) (-640.582) (-638.832) [-641.748] -- 0:00:28
63000 -- (-645.383) (-641.872) [-639.962] (-641.603) * (-640.078) (-640.386) (-639.325) [-642.328] -- 0:00:27
63500 -- (-648.092) (-638.698) (-642.654) [-640.187] * [-639.847] (-640.688) (-639.240) (-640.334) -- 0:00:27
64000 -- (-647.755) (-640.195) (-642.572) [-639.989] * (-648.152) (-640.451) (-643.021) [-640.976] -- 0:00:27
64500 -- (-653.444) (-639.379) (-639.562) [-639.790] * (-641.208) (-641.111) (-640.097) [-646.014] -- 0:00:27
65000 -- (-650.000) (-641.047) (-638.865) [-640.802] * (-639.575) (-642.349) [-639.500] (-641.682) -- 0:00:26
Average standard deviation of split frequencies: 0.031492
65500 -- (-653.169) (-640.763) [-639.104] (-642.030) * [-642.030] (-640.230) (-644.170) (-641.495) -- 0:00:26
66000 -- (-652.763) (-642.139) (-639.059) [-639.182] * (-640.366) (-638.845) (-642.423) [-644.125] -- 0:00:26
66500 -- (-648.490) (-639.673) [-641.509] (-641.610) * [-640.871] (-638.507) (-639.196) (-642.527) -- 0:00:26
67000 -- (-640.916) (-643.647) [-645.621] (-642.383) * (-642.372) (-640.626) (-640.728) [-641.587] -- 0:00:25
67500 -- (-645.867) (-644.103) (-646.406) [-641.058] * (-639.185) (-639.467) (-642.325) [-638.884] -- 0:00:25
68000 -- (-653.168) (-640.682) (-639.409) [-638.730] * [-641.283] (-639.406) (-641.726) (-639.257) -- 0:00:25
68500 -- (-655.871) (-641.579) [-641.182] (-640.716) * [-638.913] (-639.382) (-643.082) (-639.498) -- 0:00:31
69000 -- [-639.323] (-639.144) (-641.232) (-643.702) * [-641.001] (-640.831) (-642.678) (-641.482) -- 0:00:31
69500 -- (-638.635) (-639.144) (-641.798) [-641.570] * (-640.139) [-640.826] (-645.529) (-638.677) -- 0:00:30
70000 -- (-645.449) (-642.495) [-640.345] (-642.221) * (-640.909) (-644.330) (-642.405) [-642.179] -- 0:00:30
Average standard deviation of split frequencies: 0.026048
70500 -- (-642.798) [-638.516] (-639.083) (-642.293) * [-639.792] (-640.914) (-640.927) (-640.385) -- 0:00:30
71000 -- (-641.407) [-642.241] (-640.517) (-645.235) * (-638.935) (-639.910) [-643.393] (-640.476) -- 0:00:30
71500 -- [-643.343] (-643.180) (-639.823) (-641.745) * (-640.563) (-639.818) (-642.348) [-639.447] -- 0:00:29
72000 -- (-642.806) (-641.066) (-642.371) [-642.653] * (-643.127) (-644.101) [-642.249] (-641.753) -- 0:00:29
72500 -- (-640.167) [-640.233] (-639.435) (-641.936) * [-640.522] (-641.515) (-644.637) (-639.790) -- 0:00:29
73000 -- (-642.168) (-641.186) [-642.130] (-640.144) * (-642.123) [-639.947] (-641.388) (-641.163) -- 0:00:29
73500 -- [-643.237] (-641.911) (-642.779) (-639.158) * (-642.120) [-640.981] (-643.012) (-641.091) -- 0:00:29
74000 -- (-643.480) (-644.046) [-640.188] (-640.218) * (-645.051) (-640.919) [-643.822] (-639.645) -- 0:00:28
74500 -- [-639.824] (-640.637) (-641.071) (-642.832) * (-640.721) (-639.072) [-647.453] (-638.561) -- 0:00:28
75000 -- (-640.566) (-639.913) [-638.621] (-640.720) * (-639.877) (-641.178) (-643.413) [-638.968] -- 0:00:28
Average standard deviation of split frequencies: 0.026288
75500 -- [-639.141] (-642.653) (-639.035) (-643.778) * (-641.636) (-641.926) [-642.063] (-643.437) -- 0:00:28
76000 -- [-643.799] (-639.564) (-643.538) (-641.422) * (-639.559) [-640.490] (-644.208) (-640.544) -- 0:00:27
76500 -- (-646.080) [-639.170] (-642.879) (-640.855) * (-642.854) [-640.627] (-639.697) (-641.172) -- 0:00:27
77000 -- (-640.261) (-641.793) (-640.939) [-640.385] * (-640.143) (-642.165) [-640.859] (-640.610) -- 0:00:27
77500 -- (-643.324) [-639.237] (-639.540) (-642.238) * (-639.646) (-641.225) [-641.170] (-643.601) -- 0:00:27
78000 -- [-640.985] (-640.522) (-640.999) (-639.070) * (-639.497) (-639.195) [-640.180] (-642.566) -- 0:00:27
78500 -- (-641.956) [-639.315] (-639.658) (-639.060) * (-641.725) [-641.139] (-638.693) (-641.279) -- 0:00:26
79000 -- (-642.260) (-640.867) (-639.482) [-639.829] * (-641.338) [-642.127] (-641.442) (-642.321) -- 0:00:26
79500 -- (-643.072) (-641.514) (-639.327) [-638.891] * (-641.933) (-641.613) (-638.747) [-638.702] -- 0:00:26
80000 -- [-641.518] (-641.459) (-639.676) (-640.564) * [-639.619] (-641.683) (-641.003) (-639.157) -- 0:00:26
Average standard deviation of split frequencies: 0.027626
80500 -- [-639.507] (-640.826) (-641.267) (-640.232) * (-640.428) (-642.014) (-639.273) [-640.666] -- 0:00:26
81000 -- (-638.940) (-641.197) [-642.190] (-638.895) * [-640.791] (-641.056) (-642.537) (-639.847) -- 0:00:25
81500 -- (-641.782) [-638.717] (-639.006) (-642.285) * (-642.191) (-640.301) (-645.561) [-639.798] -- 0:00:25
82000 -- (-638.944) (-640.320) [-640.456] (-639.682) * (-641.281) (-638.529) [-640.068] (-644.897) -- 0:00:25
82500 -- (-642.425) (-642.201) [-640.666] (-641.596) * (-639.889) (-640.267) [-639.632] (-643.249) -- 0:00:25
83000 -- (-640.904) (-641.884) (-642.545) [-642.611] * [-640.490] (-638.746) (-639.371) (-642.045) -- 0:00:25
83500 -- (-641.641) (-640.133) [-640.796] (-639.647) * (-641.978) [-638.697] (-642.476) (-639.290) -- 0:00:24
84000 -- (-638.362) (-639.699) [-641.458] (-640.062) * (-640.730) (-639.951) (-640.358) [-640.270] -- 0:00:24
84500 -- (-643.760) (-640.304) (-639.919) [-639.101] * (-642.393) (-641.330) (-639.441) [-644.483] -- 0:00:29
85000 -- [-640.783] (-644.055) (-640.379) (-639.613) * (-638.853) [-645.267] (-640.243) (-643.713) -- 0:00:29
Average standard deviation of split frequencies: 0.028404
85500 -- [-641.115] (-645.079) (-638.691) (-640.349) * (-639.576) (-643.447) (-640.735) [-641.085] -- 0:00:29
86000 -- [-640.394] (-645.479) (-640.202) (-639.962) * (-642.527) (-647.778) [-641.752] (-641.253) -- 0:00:28
86500 -- (-639.084) [-641.865] (-643.551) (-640.292) * (-640.558) [-642.867] (-639.673) (-641.413) -- 0:00:28
87000 -- (-641.745) (-641.715) [-640.162] (-640.374) * [-642.240] (-640.161) (-639.475) (-641.432) -- 0:00:28
87500 -- (-640.418) (-639.631) (-642.950) [-639.020] * (-644.479) [-640.319] (-639.230) (-643.314) -- 0:00:28
88000 -- (-639.553) [-642.320] (-642.194) (-639.469) * (-647.228) (-641.655) (-641.474) [-641.520] -- 0:00:28
88500 -- (-639.313) (-641.876) [-638.777] (-640.639) * (-643.706) [-639.182] (-639.014) (-642.330) -- 0:00:27
89000 -- [-639.435] (-639.405) (-639.628) (-639.152) * (-642.357) (-645.894) (-638.842) [-643.769] -- 0:00:27
89500 -- (-640.540) (-639.730) (-641.736) [-639.051] * (-642.225) (-641.486) [-638.605] (-645.333) -- 0:00:27
90000 -- (-639.300) (-640.290) (-642.586) [-639.909] * (-643.205) [-642.100] (-640.027) (-642.676) -- 0:00:27
Average standard deviation of split frequencies: 0.026257
90500 -- (-640.849) (-641.999) [-640.861] (-639.875) * (-640.623) (-639.911) [-639.197] (-642.178) -- 0:00:27
91000 -- [-640.526] (-640.931) (-642.288) (-639.221) * (-643.819) [-643.070] (-643.489) (-642.838) -- 0:00:26
91500 -- [-639.416] (-640.311) (-643.415) (-640.803) * (-640.131) (-640.677) [-641.950] (-642.314) -- 0:00:26
92000 -- (-639.593) (-639.422) [-644.254] (-639.457) * (-641.167) (-642.240) (-640.446) [-640.299] -- 0:00:26
92500 -- (-641.685) [-642.099] (-641.491) (-640.948) * (-641.099) [-642.389] (-643.557) (-640.297) -- 0:00:26
93000 -- (-641.933) (-642.698) [-640.668] (-639.607) * (-648.938) (-640.875) (-640.807) [-639.837] -- 0:00:26
93500 -- (-643.324) [-642.612] (-639.367) (-640.001) * (-642.491) (-642.911) (-643.280) [-640.575] -- 0:00:26
94000 -- (-642.443) (-641.048) (-640.325) [-639.836] * (-641.903) (-641.797) [-639.569] (-641.328) -- 0:00:25
94500 -- (-638.987) [-642.380] (-640.535) (-643.021) * (-642.478) (-641.381) (-640.843) [-644.007] -- 0:00:25
95000 -- [-639.200] (-641.797) (-639.849) (-645.131) * [-639.806] (-638.322) (-641.086) (-640.530) -- 0:00:25
Average standard deviation of split frequencies: 0.022226
95500 -- (-640.041) [-641.376] (-640.774) (-642.599) * [-639.584] (-638.721) (-640.303) (-639.555) -- 0:00:25
96000 -- (-641.302) (-640.894) (-640.539) [-641.626] * [-639.946] (-644.289) (-639.434) (-640.310) -- 0:00:25
96500 -- (-639.633) (-640.287) [-640.336] (-641.578) * (-641.001) [-642.992] (-641.560) (-641.165) -- 0:00:25
97000 -- (-640.406) (-638.756) (-639.020) [-640.040] * (-639.642) (-643.491) (-642.556) [-642.634] -- 0:00:24
97500 -- (-641.094) (-639.285) (-640.560) [-639.523] * [-640.043] (-640.156) (-641.632) (-643.714) -- 0:00:24
98000 -- (-641.599) [-638.832] (-640.014) (-640.337) * (-642.282) (-641.358) [-643.328] (-641.143) -- 0:00:24
98500 -- (-639.093) (-639.261) [-640.793] (-640.563) * (-640.226) (-640.075) [-639.305] (-641.230) -- 0:00:24
99000 -- [-639.649] (-639.385) (-640.055) (-641.679) * (-639.624) (-640.652) [-638.697] (-639.930) -- 0:00:24
99500 -- [-640.953] (-639.686) (-641.618) (-641.594) * (-639.703) (-639.826) (-639.547) [-642.352] -- 0:00:24
100000 -- [-640.672] (-639.550) (-641.873) (-639.625) * (-639.481) (-638.832) (-639.929) [-640.199] -- 0:00:24
Average standard deviation of split frequencies: 0.020032
100500 -- (-640.227) [-638.967] (-639.151) (-639.385) * (-646.081) (-639.925) (-640.389) [-640.003] -- 0:00:27
101000 -- (-640.628) (-640.518) [-639.064] (-638.947) * (-643.046) [-639.417] (-644.326) (-642.793) -- 0:00:27
101500 -- [-640.903] (-641.715) (-643.555) (-639.286) * (-639.866) (-640.403) [-640.318] (-643.385) -- 0:00:27
102000 -- (-640.935) [-639.602] (-645.894) (-638.502) * [-639.031] (-639.374) (-639.887) (-640.458) -- 0:00:27
102500 -- (-642.236) [-640.563] (-641.245) (-639.468) * (-639.114) [-641.754] (-641.107) (-641.814) -- 0:00:27
103000 -- (-640.031) (-639.234) (-641.271) [-640.392] * (-640.138) (-645.590) (-641.653) [-641.214] -- 0:00:26
103500 -- (-642.679) (-639.189) [-639.468] (-640.439) * (-639.800) (-639.982) (-643.155) [-641.781] -- 0:00:26
104000 -- (-641.256) [-639.754] (-642.251) (-639.340) * (-639.636) (-640.840) [-640.620] (-640.592) -- 0:00:26
104500 -- (-641.201) [-638.885] (-641.624) (-639.900) * (-640.496) [-643.021] (-641.677) (-639.976) -- 0:00:26
105000 -- (-641.263) [-640.082] (-641.651) (-640.850) * (-643.056) (-643.656) [-639.378] (-639.871) -- 0:00:26
Average standard deviation of split frequencies: 0.017087
105500 -- (-641.946) (-639.284) (-642.236) [-642.990] * [-642.457] (-639.980) (-641.565) (-640.741) -- 0:00:26
106000 -- (-641.201) (-640.048) [-639.969] (-643.081) * (-642.957) (-640.258) (-639.053) [-642.313] -- 0:00:26
106500 -- (-644.886) [-642.849] (-640.693) (-641.251) * (-642.610) [-640.537] (-648.249) (-641.056) -- 0:00:25
107000 -- (-640.275) [-641.619] (-641.403) (-639.171) * [-640.547] (-643.759) (-642.794) (-639.136) -- 0:00:25
107500 -- (-640.516) [-641.905] (-642.579) (-639.094) * (-640.446) (-641.290) (-639.775) [-639.934] -- 0:00:25
108000 -- (-641.460) (-639.608) [-640.493] (-640.181) * (-639.579) [-639.058] (-640.984) (-641.197) -- 0:00:25
108500 -- (-638.544) (-639.292) [-640.476] (-642.383) * (-640.877) (-641.032) [-638.387] (-639.163) -- 0:00:25
109000 -- [-639.461] (-646.437) (-644.180) (-645.374) * (-643.314) (-639.720) [-641.646] (-639.906) -- 0:00:25
109500 -- (-638.620) [-645.180] (-640.720) (-644.268) * [-642.293] (-639.271) (-640.404) (-645.584) -- 0:00:24
110000 -- [-640.853] (-642.342) (-643.144) (-640.772) * (-642.614) (-639.538) (-640.666) [-639.514] -- 0:00:24
Average standard deviation of split frequencies: 0.014573
110500 -- (-638.920) [-639.892] (-639.817) (-641.056) * (-650.739) [-638.913] (-639.759) (-639.866) -- 0:00:24
111000 -- (-642.966) [-638.823] (-639.310) (-644.276) * (-640.205) [-639.537] (-639.517) (-640.522) -- 0:00:24
111500 -- [-638.931] (-640.275) (-638.966) (-640.370) * (-642.225) (-639.916) (-639.530) [-639.269] -- 0:00:24
112000 -- [-639.783] (-639.954) (-640.734) (-641.120) * [-640.931] (-641.890) (-640.572) (-643.674) -- 0:00:24
112500 -- (-640.093) (-639.631) [-639.166] (-643.762) * (-642.862) [-642.573] (-640.890) (-639.301) -- 0:00:24
113000 -- (-640.538) [-639.921] (-639.705) (-645.312) * (-639.306) [-640.679] (-639.675) (-642.418) -- 0:00:23
113500 -- (-640.953) (-640.116) [-639.614] (-643.075) * [-640.210] (-639.762) (-642.888) (-642.634) -- 0:00:23
114000 -- (-639.473) (-639.383) (-640.110) [-641.767] * (-640.107) [-640.876] (-639.487) (-641.937) -- 0:00:23
114500 -- (-640.177) (-642.541) [-640.308] (-638.942) * (-641.054) [-641.661] (-640.041) (-640.684) -- 0:00:23
115000 -- [-640.796] (-641.585) (-640.344) (-639.047) * (-645.608) (-639.992) (-647.159) [-639.705] -- 0:00:23
Average standard deviation of split frequencies: 0.014731
115500 -- (-642.027) [-641.683] (-640.697) (-640.366) * (-642.027) (-644.610) [-641.293] (-640.494) -- 0:00:23
116000 -- (-641.789) (-640.960) (-641.489) [-644.815] * (-642.958) (-640.802) [-640.493] (-643.590) -- 0:00:26
116500 -- (-641.359) (-641.089) [-641.239] (-640.432) * [-640.301] (-642.731) (-642.122) (-646.040) -- 0:00:26
117000 -- [-641.257] (-644.583) (-641.887) (-641.004) * (-639.755) (-644.761) [-639.542] (-642.274) -- 0:00:26
117500 -- [-639.402] (-639.920) (-640.177) (-642.559) * [-639.231] (-640.860) (-640.330) (-640.067) -- 0:00:26
118000 -- (-639.085) (-639.602) [-638.783] (-643.217) * (-640.096) [-640.044] (-642.423) (-640.922) -- 0:00:25
118500 -- [-639.227] (-640.349) (-638.941) (-640.198) * (-645.470) [-641.709] (-639.609) (-640.407) -- 0:00:25
119000 -- [-640.026] (-639.794) (-642.579) (-642.405) * (-638.783) (-640.970) (-638.778) [-640.382] -- 0:00:25
119500 -- [-640.813] (-642.394) (-640.600) (-641.386) * (-640.421) (-641.147) (-640.755) [-641.991] -- 0:00:25
120000 -- [-640.371] (-641.771) (-639.691) (-640.579) * (-643.647) [-643.549] (-640.877) (-642.571) -- 0:00:25
Average standard deviation of split frequencies: 0.016115
120500 -- (-640.370) [-639.604] (-640.131) (-642.649) * [-643.889] (-642.206) (-641.623) (-641.780) -- 0:00:25
121000 -- [-641.809] (-641.813) (-639.299) (-641.436) * (-642.950) [-639.909] (-645.507) (-640.172) -- 0:00:25
121500 -- (-640.137) (-644.184) [-638.918] (-647.532) * (-644.120) (-640.673) [-639.455] (-642.106) -- 0:00:24
122000 -- (-641.086) (-644.634) (-638.792) [-640.831] * (-638.351) (-640.576) (-639.141) [-641.316] -- 0:00:24
122500 -- (-640.341) (-639.485) [-638.504] (-641.016) * (-639.325) [-640.453] (-639.704) (-640.419) -- 0:00:24
123000 -- [-641.294] (-643.230) (-642.368) (-641.650) * (-638.880) [-641.387] (-641.407) (-639.577) -- 0:00:24
123500 -- (-639.924) [-641.607] (-640.938) (-642.283) * (-640.136) (-639.022) (-644.380) [-639.621] -- 0:00:24
124000 -- (-639.217) (-639.189) (-639.327) [-638.818] * (-641.686) (-638.858) (-640.885) [-638.626] -- 0:00:24
124500 -- (-639.327) [-639.247] (-638.578) (-640.112) * (-639.847) (-640.194) (-641.361) [-638.736] -- 0:00:24
125000 -- [-638.956] (-639.008) (-640.168) (-640.876) * (-639.404) (-639.535) [-640.118] (-638.890) -- 0:00:24
Average standard deviation of split frequencies: 0.016628
125500 -- (-639.767) (-640.441) (-644.324) [-638.718] * [-639.568] (-642.220) (-640.844) (-639.763) -- 0:00:23
126000 -- (-638.939) (-643.745) (-640.104) [-640.453] * (-641.295) [-640.680] (-640.971) (-641.973) -- 0:00:23
126500 -- [-638.665] (-642.267) (-639.117) (-641.004) * [-638.781] (-640.600) (-640.768) (-639.531) -- 0:00:23
127000 -- (-638.840) (-639.058) (-642.858) [-641.419] * (-638.841) [-640.516] (-642.277) (-640.098) -- 0:00:23
127500 -- (-642.788) (-641.329) [-643.353] (-641.108) * [-645.716] (-645.218) (-640.958) (-641.203) -- 0:00:23
128000 -- (-646.511) (-642.699) [-641.356] (-642.647) * (-641.975) [-648.377] (-640.872) (-639.435) -- 0:00:23
128500 -- (-641.086) [-638.970] (-641.088) (-639.742) * [-639.414] (-639.807) (-640.116) (-642.953) -- 0:00:23
129000 -- [-640.044] (-639.045) (-641.382) (-640.476) * (-641.415) (-639.681) (-644.990) [-639.406] -- 0:00:23
129500 -- [-638.787] (-640.293) (-641.597) (-641.712) * (-644.151) (-639.618) [-639.758] (-640.371) -- 0:00:22
130000 -- [-642.107] (-638.546) (-640.613) (-647.259) * [-639.408] (-638.802) (-641.779) (-640.320) -- 0:00:22
Average standard deviation of split frequencies: 0.014631
130500 -- (-642.124) (-638.638) (-643.485) [-642.566] * (-640.041) (-639.066) [-639.079] (-641.931) -- 0:00:25
131000 -- [-643.499] (-640.406) (-639.610) (-644.331) * (-639.657) [-639.939] (-642.319) (-640.515) -- 0:00:25
131500 -- [-640.295] (-639.894) (-639.895) (-639.336) * (-639.325) (-644.596) [-639.129] (-639.617) -- 0:00:25
132000 -- [-639.427] (-640.193) (-640.698) (-638.530) * (-638.972) [-640.746] (-638.862) (-639.493) -- 0:00:25
132500 -- (-641.128) (-642.097) (-640.807) [-640.310] * [-641.099] (-639.840) (-642.818) (-639.560) -- 0:00:24
133000 -- (-643.903) (-641.010) [-644.000] (-639.910) * [-639.114] (-639.687) (-641.493) (-641.233) -- 0:00:24
133500 -- (-644.480) [-640.518] (-642.031) (-645.720) * (-639.205) (-643.601) [-640.081] (-641.138) -- 0:00:24
134000 -- (-640.164) (-641.408) (-644.207) [-638.786] * (-639.332) (-642.597) (-639.739) [-644.887] -- 0:00:24
134500 -- (-639.513) (-641.883) (-641.434) [-640.759] * (-639.239) [-640.365] (-640.623) (-644.931) -- 0:00:24
135000 -- (-640.384) [-640.576] (-641.223) (-639.589) * [-639.381] (-640.360) (-640.814) (-639.035) -- 0:00:24
Average standard deviation of split frequencies: 0.015142
135500 -- (-639.456) (-639.076) [-640.446] (-638.324) * [-639.938] (-640.502) (-640.986) (-639.070) -- 0:00:24
136000 -- (-641.093) (-641.445) [-639.957] (-638.337) * (-641.633) (-639.598) (-643.334) [-638.824] -- 0:00:24
136500 -- (-639.168) (-639.603) (-639.512) [-639.930] * (-642.194) (-641.731) [-640.341] (-638.605) -- 0:00:23
137000 -- (-641.067) (-641.107) [-638.802] (-640.291) * (-640.340) (-641.173) [-640.070] (-645.920) -- 0:00:23
137500 -- [-640.237] (-642.702) (-640.610) (-641.692) * [-643.139] (-640.231) (-640.320) (-641.802) -- 0:00:23
138000 -- (-640.991) (-641.769) [-642.678] (-643.073) * [-648.668] (-641.353) (-642.982) (-641.231) -- 0:00:23
138500 -- (-642.593) (-639.768) (-643.012) [-641.800] * (-640.930) [-639.790] (-641.068) (-641.365) -- 0:00:23
139000 -- [-641.420] (-639.120) (-643.488) (-640.007) * [-644.411] (-638.962) (-644.953) (-642.146) -- 0:00:23
139500 -- (-647.201) (-642.332) [-639.875] (-640.024) * (-638.744) (-640.882) [-641.492] (-647.043) -- 0:00:23
140000 -- (-640.749) [-640.990] (-640.198) (-641.067) * (-638.869) (-640.100) (-638.740) [-639.736] -- 0:00:23
Average standard deviation of split frequencies: 0.016011
140500 -- (-639.873) [-639.659] (-643.250) (-640.433) * (-638.548) (-640.309) [-641.396] (-639.556) -- 0:00:23
141000 -- (-639.633) [-639.185] (-648.227) (-644.890) * (-638.973) [-640.649] (-644.552) (-640.428) -- 0:00:22
141500 -- [-639.517] (-646.560) (-644.305) (-643.097) * (-640.445) (-639.434) [-641.453] (-642.029) -- 0:00:22
142000 -- [-640.101] (-638.782) (-642.369) (-640.784) * (-640.579) [-640.627] (-639.658) (-642.713) -- 0:00:22
142500 -- (-639.540) [-639.776] (-642.068) (-639.815) * [-642.839] (-639.469) (-640.324) (-639.385) -- 0:00:22
143000 -- (-639.823) (-642.212) [-640.159] (-639.652) * [-646.752] (-640.889) (-639.297) (-641.026) -- 0:00:22
143500 -- (-640.580) (-643.566) [-639.588] (-642.045) * (-645.474) [-641.377] (-640.111) (-642.427) -- 0:00:22
144000 -- [-639.515] (-642.514) (-639.769) (-639.224) * (-641.402) [-640.958] (-639.564) (-641.364) -- 0:00:22
144500 -- (-639.344) (-640.743) [-638.581] (-641.165) * (-638.662) (-640.781) [-642.313] (-643.027) -- 0:00:22
145000 -- (-641.312) [-639.312] (-638.785) (-639.852) * (-643.831) (-646.854) (-641.324) [-644.210] -- 0:00:22
Average standard deviation of split frequencies: 0.013765
145500 -- [-639.603] (-639.998) (-641.273) (-639.375) * (-641.721) (-643.598) (-642.755) [-640.207] -- 0:00:24
146000 -- [-641.145] (-647.067) (-641.732) (-638.984) * (-639.117) (-640.608) (-642.693) [-638.911] -- 0:00:24
146500 -- (-640.720) [-639.731] (-644.598) (-639.843) * (-641.707) (-640.900) (-640.581) [-638.996] -- 0:00:24
147000 -- [-642.530] (-639.602) (-645.225) (-641.195) * (-640.172) (-641.276) (-640.771) [-639.652] -- 0:00:24
147500 -- (-642.709) (-639.093) (-639.774) [-639.137] * (-639.833) [-639.322] (-642.066) (-640.680) -- 0:00:23
148000 -- (-639.640) (-638.417) [-642.175] (-639.668) * (-643.200) (-640.673) (-642.864) [-642.135] -- 0:00:23
148500 -- (-639.133) (-645.225) [-639.794] (-641.309) * (-640.539) (-639.590) [-639.701] (-640.791) -- 0:00:23
149000 -- (-640.425) (-640.055) (-641.609) [-641.314] * [-638.672] (-643.792) (-640.176) (-641.580) -- 0:00:23
149500 -- [-640.421] (-642.391) (-645.152) (-641.340) * (-639.705) (-640.547) (-644.233) [-640.464] -- 0:00:23
150000 -- [-644.675] (-639.892) (-641.078) (-639.789) * (-640.113) (-643.956) (-638.778) [-642.351] -- 0:00:23
Average standard deviation of split frequencies: 0.013454
150500 -- (-640.559) (-640.472) (-639.732) [-643.473] * (-639.810) (-643.439) [-640.987] (-640.955) -- 0:00:23
151000 -- (-646.288) (-641.976) (-639.799) [-640.038] * (-642.876) (-640.836) [-639.669] (-639.708) -- 0:00:23
151500 -- (-641.728) (-642.188) [-640.801] (-643.615) * (-641.415) (-640.729) (-640.062) [-639.334] -- 0:00:23
152000 -- (-641.177) (-642.181) [-641.754] (-644.059) * (-645.873) (-644.028) [-640.738] (-640.702) -- 0:00:22
152500 -- [-641.575] (-642.133) (-640.392) (-642.049) * (-641.125) (-639.617) (-643.560) [-639.539] -- 0:00:22
153000 -- (-641.443) (-647.034) (-640.972) [-642.393] * [-641.295] (-640.133) (-638.991) (-640.082) -- 0:00:22
153500 -- [-640.800] (-645.743) (-643.680) (-641.334) * (-641.087) (-639.631) [-643.217] (-640.910) -- 0:00:22
154000 -- (-640.222) (-643.325) (-641.525) [-639.713] * (-640.147) (-640.392) [-638.613] (-639.561) -- 0:00:22
154500 -- (-639.723) (-640.519) [-641.914] (-639.138) * [-638.829] (-639.890) (-638.465) (-641.853) -- 0:00:22
155000 -- (-638.978) [-648.006] (-641.527) (-641.755) * [-639.288] (-639.942) (-640.192) (-639.770) -- 0:00:22
Average standard deviation of split frequencies: 0.016063
155500 -- (-639.791) (-638.896) (-641.347) [-640.758] * (-638.857) (-641.107) [-639.211] (-643.575) -- 0:00:22
156000 -- (-639.995) (-643.942) (-640.829) [-640.528] * (-641.906) [-641.358] (-643.060) (-639.394) -- 0:00:22
156500 -- (-641.412) [-641.108] (-640.607) (-640.089) * (-638.570) [-640.034] (-640.031) (-639.074) -- 0:00:21
157000 -- (-640.266) (-639.333) (-641.207) [-642.871] * (-638.609) (-647.515) (-641.891) [-638.304] -- 0:00:21
157500 -- (-640.851) (-642.799) (-639.257) [-640.977] * (-643.223) [-642.295] (-640.650) (-644.069) -- 0:00:21
158000 -- (-643.017) (-642.658) (-640.092) [-641.354] * (-642.220) [-640.134] (-645.382) (-642.096) -- 0:00:21
158500 -- (-641.502) [-638.778] (-640.414) (-642.492) * (-642.472) [-639.122] (-642.013) (-640.702) -- 0:00:21
159000 -- (-641.105) (-642.006) [-640.259] (-639.353) * (-644.165) (-642.380) [-644.437] (-639.887) -- 0:00:21
159500 -- (-641.860) (-641.684) [-638.870] (-639.469) * (-642.343) [-639.774] (-639.081) (-642.517) -- 0:00:21
160000 -- (-641.255) [-640.304] (-639.895) (-645.143) * (-642.334) [-641.381] (-639.855) (-642.364) -- 0:00:21
Average standard deviation of split frequencies: 0.017295
160500 -- (-640.225) (-640.247) [-640.141] (-644.064) * (-639.885) (-642.421) (-644.115) [-640.892] -- 0:00:23
161000 -- [-639.918] (-638.716) (-639.131) (-642.570) * (-640.542) (-641.496) [-641.269] (-640.319) -- 0:00:23
161500 -- (-642.840) [-638.628] (-639.089) (-641.729) * [-643.333] (-643.208) (-640.809) (-638.852) -- 0:00:23
162000 -- (-640.488) (-648.722) [-638.569] (-640.803) * (-644.771) (-643.532) (-642.333) [-641.789] -- 0:00:22
162500 -- [-641.686] (-641.211) (-640.120) (-640.752) * (-640.592) (-642.534) (-640.659) [-638.940] -- 0:00:22
163000 -- [-640.259] (-639.863) (-641.353) (-642.126) * (-642.499) (-640.426) [-640.602] (-639.198) -- 0:00:22
163500 -- (-640.705) [-644.013] (-643.089) (-640.960) * [-639.874] (-640.712) (-640.432) (-639.868) -- 0:00:22
164000 -- [-641.380] (-644.115) (-640.864) (-643.161) * (-639.492) [-640.770] (-642.541) (-641.729) -- 0:00:22
164500 -- (-640.872) [-639.092] (-643.492) (-639.776) * (-643.673) (-640.667) (-639.401) [-639.057] -- 0:00:22
165000 -- [-638.853] (-640.494) (-642.032) (-640.115) * (-643.585) (-641.063) [-639.004] (-640.504) -- 0:00:22
Average standard deviation of split frequencies: 0.016187
165500 -- [-640.181] (-639.620) (-645.192) (-642.041) * (-641.823) (-640.413) (-642.163) [-640.305] -- 0:00:22
166000 -- (-642.629) [-641.587] (-647.250) (-642.148) * (-641.890) [-641.706] (-641.005) (-640.928) -- 0:00:22
166500 -- (-639.779) [-642.101] (-643.090) (-642.341) * (-639.225) (-640.570) [-640.122] (-641.324) -- 0:00:22
167000 -- (-640.914) (-642.075) (-643.628) [-640.187] * (-640.456) (-641.434) [-641.055] (-640.815) -- 0:00:21
167500 -- (-640.965) (-641.408) (-639.813) [-640.787] * (-640.747) (-640.922) (-639.298) [-640.817] -- 0:00:21
168000 -- (-644.094) (-640.184) [-642.660] (-640.354) * (-641.616) [-648.781] (-642.006) (-639.231) -- 0:00:21
168500 -- (-641.092) (-640.376) [-640.189] (-643.811) * (-639.351) (-644.994) (-641.604) [-639.171] -- 0:00:21
169000 -- [-639.865] (-641.167) (-639.421) (-640.997) * (-639.919) (-647.176) [-639.072] (-639.024) -- 0:00:21
169500 -- (-640.312) (-639.605) (-638.897) [-647.957] * (-638.562) (-639.363) (-639.134) [-639.606] -- 0:00:21
170000 -- (-640.299) (-644.822) (-640.116) [-639.207] * (-641.156) (-640.103) [-639.595] (-641.171) -- 0:00:21
Average standard deviation of split frequencies: 0.017494
170500 -- (-645.760) (-644.886) (-641.020) [-642.439] * (-643.435) (-640.573) (-638.641) [-640.445] -- 0:00:21
171000 -- (-639.656) [-643.129] (-641.593) (-641.150) * (-644.737) (-641.813) (-638.684) [-640.017] -- 0:00:21
171500 -- (-640.542) (-640.774) [-640.841] (-640.105) * (-639.628) (-640.715) [-640.517] (-640.651) -- 0:00:21
172000 -- (-641.849) (-643.327) (-644.609) [-639.763] * (-639.467) [-642.144] (-640.213) (-638.501) -- 0:00:20
172500 -- (-647.049) (-643.749) [-643.861] (-639.800) * (-641.593) (-641.474) [-639.380] (-639.084) -- 0:00:20
173000 -- [-644.854] (-651.688) (-645.826) (-640.407) * [-639.893] (-642.271) (-640.935) (-641.938) -- 0:00:20
173500 -- [-641.989] (-646.891) (-645.723) (-641.702) * [-640.755] (-639.544) (-638.318) (-639.210) -- 0:00:20
174000 -- (-640.078) (-641.760) (-639.677) [-640.674] * (-646.523) [-639.181] (-641.148) (-639.527) -- 0:00:20
174500 -- (-641.527) (-642.120) (-649.305) [-641.764] * [-644.155] (-639.367) (-640.358) (-647.688) -- 0:00:20
175000 -- (-640.246) (-639.920) (-641.242) [-640.303] * [-641.690] (-643.906) (-638.395) (-643.027) -- 0:00:20
Average standard deviation of split frequencies: 0.016858
175500 -- (-639.861) (-639.246) (-640.079) [-638.626] * [-641.436] (-640.594) (-638.890) (-641.928) -- 0:00:22
176000 -- (-642.360) [-639.705] (-639.756) (-640.258) * (-641.165) [-640.951] (-639.476) (-641.963) -- 0:00:22
176500 -- (-639.085) (-638.926) [-641.412] (-640.251) * (-641.404) (-641.560) [-639.953] (-645.466) -- 0:00:21
177000 -- (-643.813) (-640.108) [-641.447] (-639.897) * (-642.644) (-640.911) (-638.899) [-639.952] -- 0:00:21
177500 -- (-642.427) (-639.727) (-640.844) [-639.441] * (-641.397) [-639.714] (-640.241) (-645.172) -- 0:00:21
178000 -- (-640.411) (-639.164) [-641.409] (-642.047) * (-644.623) [-639.239] (-647.428) (-642.576) -- 0:00:21
178500 -- (-644.527) (-640.024) (-639.573) [-640.969] * (-641.834) (-643.090) [-639.267] (-643.110) -- 0:00:21
179000 -- (-641.520) (-639.069) [-640.946] (-639.320) * (-640.505) (-639.997) (-641.387) [-643.948] -- 0:00:21
179500 -- (-640.042) [-639.006] (-642.253) (-640.765) * (-640.207) (-642.513) [-639.994] (-643.542) -- 0:00:21
180000 -- (-641.144) [-640.523] (-641.788) (-638.696) * (-639.722) (-640.765) (-638.614) [-639.948] -- 0:00:21
Average standard deviation of split frequencies: 0.017395
180500 -- (-639.305) (-641.590) [-639.534] (-642.836) * (-643.852) (-640.236) [-641.119] (-639.146) -- 0:00:21
181000 -- (-640.000) (-639.699) [-638.926] (-640.162) * (-646.904) [-638.622] (-643.123) (-638.781) -- 0:00:21
181500 -- (-639.263) (-642.208) (-641.692) [-638.599] * (-640.575) [-640.856] (-638.629) (-641.743) -- 0:00:21
182000 -- (-640.328) (-638.572) (-638.513) [-640.391] * (-639.656) [-640.877] (-639.043) (-639.866) -- 0:00:20
182500 -- (-640.571) [-642.048] (-641.391) (-639.338) * [-639.935] (-639.661) (-640.610) (-639.209) -- 0:00:20
183000 -- (-640.321) (-643.189) (-639.061) [-642.552] * (-639.665) (-639.554) (-645.882) [-643.364] -- 0:00:20
183500 -- (-641.887) (-643.459) [-639.701] (-642.335) * [-641.121] (-639.299) (-643.449) (-643.830) -- 0:00:20
184000 -- (-639.969) (-640.302) [-640.792] (-639.964) * (-640.496) (-640.037) [-641.464] (-640.817) -- 0:00:20
184500 -- [-638.712] (-639.889) (-641.973) (-641.245) * (-641.957) (-638.997) (-639.726) [-643.545] -- 0:00:20
185000 -- [-638.878] (-642.462) (-643.218) (-642.697) * (-643.058) [-639.152] (-638.995) (-640.548) -- 0:00:20
Average standard deviation of split frequencies: 0.017178
185500 -- (-644.218) (-639.557) [-643.027] (-639.072) * [-641.400] (-639.352) (-639.155) (-642.849) -- 0:00:20
186000 -- (-641.561) (-639.246) [-641.143] (-638.652) * (-639.553) [-641.512] (-641.547) (-641.157) -- 0:00:20
186500 -- [-640.723] (-644.943) (-641.419) (-641.227) * (-639.216) (-638.949) (-643.573) [-640.332] -- 0:00:20
187000 -- (-638.895) (-641.243) [-639.663] (-642.301) * (-638.681) [-639.471] (-641.146) (-639.543) -- 0:00:20
187500 -- (-644.572) [-639.825] (-639.706) (-640.319) * (-640.309) (-641.580) (-642.521) [-640.436] -- 0:00:20
188000 -- (-640.111) [-641.183] (-639.673) (-640.453) * (-642.547) (-639.782) (-640.529) [-640.624] -- 0:00:19
188500 -- (-640.540) (-642.115) (-640.628) [-649.866] * (-644.750) [-642.908] (-640.867) (-640.286) -- 0:00:19
189000 -- (-640.740) (-638.681) (-641.998) [-641.829] * (-643.970) [-640.865] (-640.940) (-641.129) -- 0:00:19
189500 -- (-643.512) [-639.930] (-642.056) (-639.340) * (-642.072) [-640.164] (-639.311) (-643.331) -- 0:00:19
190000 -- (-641.223) (-643.907) (-640.631) [-640.207] * [-639.241] (-639.523) (-639.322) (-645.721) -- 0:00:21
Average standard deviation of split frequencies: 0.016006
190500 -- (-644.475) (-639.895) (-639.813) [-640.871] * (-639.288) [-642.423] (-643.688) (-640.566) -- 0:00:21
191000 -- [-642.233] (-645.796) (-639.989) (-641.645) * (-642.972) [-638.866] (-640.163) (-641.159) -- 0:00:21
191500 -- [-641.010] (-642.419) (-638.875) (-640.128) * [-639.488] (-640.294) (-646.700) (-642.180) -- 0:00:20
192000 -- (-638.773) (-641.678) (-641.998) [-642.150] * (-641.181) [-641.078] (-641.379) (-640.530) -- 0:00:20
192500 -- [-638.838] (-639.701) (-643.473) (-639.455) * (-640.488) (-641.099) (-639.936) [-641.885] -- 0:00:20
193000 -- [-640.082] (-645.613) (-641.464) (-640.245) * (-640.021) (-640.130) (-639.273) [-640.097] -- 0:00:20
193500 -- [-640.113] (-645.054) (-638.802) (-640.952) * (-639.339) (-640.941) (-641.089) [-640.734] -- 0:00:20
194000 -- (-647.495) (-640.122) [-640.472] (-640.145) * (-640.102) (-641.107) (-642.380) [-638.920] -- 0:00:20
194500 -- [-644.386] (-642.170) (-639.038) (-640.618) * (-642.602) [-642.424] (-642.302) (-641.276) -- 0:00:20
195000 -- [-641.195] (-643.590) (-644.295) (-642.569) * (-638.759) [-640.583] (-644.433) (-643.023) -- 0:00:20
Average standard deviation of split frequencies: 0.015633
195500 -- (-639.606) [-639.249] (-640.296) (-641.805) * (-642.275) [-640.026] (-644.155) (-640.632) -- 0:00:20
196000 -- (-642.140) (-641.543) [-640.750] (-639.679) * (-640.729) (-641.203) (-643.217) [-640.021] -- 0:00:20
196500 -- [-640.106] (-640.484) (-640.241) (-639.724) * (-641.810) (-638.898) [-640.753] (-639.112) -- 0:00:20
197000 -- [-639.950] (-639.764) (-641.367) (-639.881) * (-642.093) (-642.686) (-641.291) [-640.062] -- 0:00:19
197500 -- (-641.442) (-641.378) (-644.012) [-639.579] * (-640.517) [-643.094] (-641.016) (-642.284) -- 0:00:19
198000 -- (-643.434) (-644.886) (-643.553) [-641.076] * [-638.929] (-641.175) (-640.761) (-642.748) -- 0:00:19
198500 -- (-644.581) (-641.347) [-643.114] (-643.174) * [-639.185] (-642.394) (-639.385) (-639.863) -- 0:00:19
199000 -- (-641.337) (-640.385) [-638.911] (-639.555) * (-640.961) (-639.751) [-640.251] (-640.167) -- 0:00:19
199500 -- [-640.659] (-643.251) (-638.859) (-638.936) * (-641.794) (-644.790) (-640.749) [-640.270] -- 0:00:19
200000 -- (-644.193) (-643.015) [-639.088] (-640.783) * (-640.353) (-638.998) (-639.738) [-642.731] -- 0:00:19
Average standard deviation of split frequencies: 0.014648
200500 -- [-643.098] (-638.869) (-640.716) (-643.874) * (-642.808) (-639.605) [-641.024] (-641.849) -- 0:00:19
201000 -- (-642.172) (-639.558) [-641.416] (-641.365) * (-640.902) (-642.053) (-640.425) [-640.197] -- 0:00:19
201500 -- [-642.036] (-639.664) (-641.377) (-639.799) * [-640.520] (-641.560) (-640.700) (-641.175) -- 0:00:19
202000 -- (-640.484) [-642.853] (-639.553) (-641.042) * (-642.411) (-639.997) [-641.384] (-639.749) -- 0:00:19
202500 -- (-640.314) (-643.985) [-639.841] (-641.291) * (-639.858) [-643.329] (-640.725) (-639.168) -- 0:00:19
203000 -- [-640.316] (-641.891) (-640.606) (-643.716) * (-644.295) [-641.663] (-640.133) (-638.589) -- 0:00:19
203500 -- [-639.494] (-640.936) (-641.123) (-641.811) * (-641.547) (-639.770) [-642.713] (-642.700) -- 0:00:18
204000 -- (-642.477) (-640.432) [-640.467] (-641.071) * [-642.325] (-639.077) (-640.845) (-644.728) -- 0:00:20
204500 -- (-644.039) (-641.744) (-644.039) [-639.295] * (-640.288) [-639.004] (-642.794) (-640.460) -- 0:00:20
205000 -- (-639.222) (-642.508) [-641.412] (-639.330) * (-638.950) (-638.699) [-640.499] (-642.952) -- 0:00:20
Average standard deviation of split frequencies: 0.014453
205500 -- (-642.336) [-643.132] (-639.521) (-642.565) * (-638.951) (-640.760) (-639.660) [-641.334] -- 0:00:20
206000 -- (-641.357) (-639.717) (-640.400) [-640.257] * [-638.623] (-640.627) (-645.406) (-643.250) -- 0:00:19
206500 -- (-642.573) (-641.384) (-639.158) [-641.860] * (-639.510) (-640.028) [-639.624] (-641.201) -- 0:00:19
207000 -- (-641.139) (-641.975) [-641.691] (-643.341) * (-638.609) (-642.627) (-644.119) [-641.216] -- 0:00:19
207500 -- (-641.669) (-641.758) (-642.885) [-640.503] * (-638.808) (-646.107) (-641.457) [-639.994] -- 0:00:19
208000 -- (-639.023) [-640.726] (-640.223) (-639.953) * (-643.325) [-640.026] (-642.016) (-639.108) -- 0:00:19
208500 -- [-638.987] (-641.122) (-641.323) (-643.541) * (-638.570) (-642.085) (-643.360) [-640.989] -- 0:00:19
209000 -- (-640.187) [-638.839] (-641.507) (-638.695) * (-639.658) (-639.383) [-639.921] (-643.079) -- 0:00:19
209500 -- (-640.051) [-639.138] (-641.394) (-640.961) * [-645.644] (-644.046) (-646.096) (-642.989) -- 0:00:19
210000 -- (-641.968) [-641.930] (-641.097) (-640.940) * [-643.579] (-642.873) (-643.133) (-640.275) -- 0:00:19
Average standard deviation of split frequencies: 0.015291
210500 -- [-641.137] (-640.923) (-641.417) (-640.278) * (-640.507) (-640.583) [-639.210] (-640.336) -- 0:00:19
211000 -- [-639.515] (-644.588) (-641.118) (-641.565) * (-639.310) (-641.388) (-644.899) [-638.992] -- 0:00:19
211500 -- (-641.887) [-641.091] (-640.241) (-641.641) * [-638.806] (-639.165) (-639.771) (-640.092) -- 0:00:19
212000 -- [-639.337] (-639.628) (-644.667) (-644.779) * (-641.887) (-641.360) (-646.746) [-640.734] -- 0:00:19
212500 -- [-641.055] (-642.825) (-642.791) (-640.594) * (-641.743) [-643.623] (-640.205) (-640.518) -- 0:00:18
213000 -- (-643.207) (-639.867) (-640.512) [-640.121] * [-639.317] (-641.560) (-641.722) (-642.720) -- 0:00:18
213500 -- (-640.394) [-640.922] (-641.794) (-639.054) * [-639.163] (-641.821) (-639.932) (-640.122) -- 0:00:18
214000 -- (-641.869) [-641.842] (-639.760) (-639.079) * (-639.817) (-640.355) (-651.966) [-642.434] -- 0:00:18
214500 -- (-639.076) (-641.507) [-641.003] (-639.096) * (-643.039) (-642.827) (-640.054) [-640.628] -- 0:00:18
215000 -- (-640.357) (-641.049) [-639.438] (-639.821) * (-640.022) (-641.472) (-642.422) [-641.798] -- 0:00:18
Average standard deviation of split frequencies: 0.014122
215500 -- [-641.523] (-642.763) (-643.518) (-639.973) * (-643.319) (-640.179) [-642.289] (-641.268) -- 0:00:18
216000 -- (-641.118) (-642.415) (-643.260) [-641.308] * (-640.648) [-638.934] (-641.238) (-639.510) -- 0:00:18
216500 -- [-638.796] (-642.554) (-643.188) (-639.937) * (-640.507) [-638.693] (-644.929) (-638.848) -- 0:00:18
217000 -- [-638.797] (-640.418) (-641.217) (-642.057) * (-641.072) (-639.449) (-640.778) [-644.973] -- 0:00:18
217500 -- (-639.195) (-643.633) (-641.420) [-640.986] * [-642.790] (-639.210) (-641.299) (-644.978) -- 0:00:18
218000 -- (-640.284) (-640.103) [-641.330] (-642.416) * (-641.142) (-641.385) (-640.667) [-641.181] -- 0:00:18
218500 -- (-644.676) (-639.192) (-639.251) [-641.210] * (-641.169) (-639.931) (-638.872) [-638.876] -- 0:00:18
219000 -- (-641.327) (-640.020) [-639.473] (-643.635) * (-639.932) (-639.530) (-642.533) [-640.630] -- 0:00:17
219500 -- (-639.162) [-642.625] (-640.355) (-640.198) * (-639.452) [-638.824] (-642.475) (-638.757) -- 0:00:19
220000 -- (-641.567) (-646.110) (-640.512) [-642.755] * (-639.208) (-644.114) (-640.322) [-642.041] -- 0:00:19
Average standard deviation of split frequencies: 0.015331
220500 -- [-640.417] (-640.209) (-639.373) (-640.313) * [-639.333] (-639.462) (-642.566) (-642.710) -- 0:00:19
221000 -- (-645.661) [-640.063] (-639.351) (-640.040) * (-639.881) (-639.673) (-651.874) [-639.776] -- 0:00:18
221500 -- (-640.670) (-639.975) [-639.764] (-638.856) * (-642.476) [-641.177] (-642.217) (-641.207) -- 0:00:18
222000 -- [-639.389] (-646.814) (-641.772) (-639.497) * (-639.638) (-641.538) (-640.152) [-641.084] -- 0:00:18
222500 -- [-645.785] (-643.090) (-642.390) (-639.408) * [-639.367] (-641.431) (-638.500) (-643.460) -- 0:00:18
223000 -- (-641.841) (-640.520) (-642.674) [-640.069] * (-641.415) (-642.535) (-639.255) [-642.206] -- 0:00:18
223500 -- (-640.563) [-641.280] (-640.724) (-640.346) * (-640.529) (-639.248) (-640.450) [-641.870] -- 0:00:18
224000 -- [-640.747] (-641.079) (-640.899) (-643.179) * (-641.585) [-643.045] (-643.368) (-640.899) -- 0:00:18
224500 -- (-639.263) (-639.842) (-642.321) [-642.566] * (-642.335) (-639.781) [-641.396] (-639.532) -- 0:00:18
225000 -- (-642.104) [-641.406] (-641.086) (-639.209) * (-639.740) (-641.304) [-639.684] (-641.439) -- 0:00:18
Average standard deviation of split frequencies: 0.015337
225500 -- (-643.676) (-642.911) [-639.964] (-640.931) * (-642.939) [-640.060] (-639.945) (-643.698) -- 0:00:18
226000 -- (-641.082) (-642.183) [-639.435] (-642.096) * (-639.920) [-642.625] (-640.813) (-638.877) -- 0:00:18
226500 -- (-639.677) [-640.264] (-642.188) (-639.161) * (-641.408) (-643.026) (-643.954) [-639.805] -- 0:00:18
227000 -- (-643.628) [-643.618] (-641.180) (-640.262) * [-639.534] (-642.095) (-639.060) (-640.055) -- 0:00:18
227500 -- (-645.113) [-640.842] (-641.831) (-638.770) * (-640.709) (-642.313) [-641.073] (-645.393) -- 0:00:17
228000 -- (-645.875) (-642.858) (-638.679) [-639.475] * (-639.706) (-642.093) [-640.578] (-641.966) -- 0:00:17
228500 -- [-644.413] (-644.413) (-638.629) (-639.709) * (-640.756) (-641.425) (-638.686) [-647.373] -- 0:00:17
229000 -- [-643.272] (-641.301) (-643.099) (-642.443) * (-639.576) (-645.519) (-640.663) [-640.651] -- 0:00:17
229500 -- (-644.540) [-641.914] (-642.307) (-642.576) * (-641.652) [-641.490] (-642.710) (-640.531) -- 0:00:17
230000 -- (-640.874) (-648.661) (-645.005) [-641.552] * (-643.003) (-641.802) (-644.315) [-638.622] -- 0:00:17
Average standard deviation of split frequencies: 0.014786
230500 -- (-642.923) (-640.863) (-638.624) [-641.856] * (-642.668) (-643.092) [-646.470] (-639.625) -- 0:00:17
231000 -- (-645.260) (-641.348) [-638.559] (-642.483) * (-645.434) [-645.247] (-642.215) (-639.784) -- 0:00:17
231500 -- (-640.820) [-639.656] (-639.024) (-640.448) * (-644.430) (-640.925) (-640.316) [-642.233] -- 0:00:17
232000 -- (-640.585) (-639.585) [-639.996] (-640.579) * (-645.529) (-640.381) [-639.806] (-640.503) -- 0:00:17
232500 -- (-643.889) (-642.817) (-641.621) [-645.232] * [-642.157] (-639.549) (-639.534) (-643.745) -- 0:00:17
233000 -- (-639.141) [-642.732] (-641.565) (-642.151) * (-640.539) (-640.538) [-641.402] (-643.674) -- 0:00:17
233500 -- (-639.794) [-639.985] (-640.841) (-640.512) * [-638.934] (-639.960) (-641.757) (-641.208) -- 0:00:17
234000 -- (-639.620) (-642.652) (-643.751) [-639.579] * (-640.988) (-639.367) (-639.920) [-640.901] -- 0:00:18
234500 -- (-640.652) (-639.637) [-640.619] (-645.042) * [-640.021] (-639.316) (-640.390) (-642.752) -- 0:00:18
235000 -- (-639.882) [-639.906] (-639.856) (-639.105) * (-640.207) [-639.322] (-642.555) (-641.226) -- 0:00:18
Average standard deviation of split frequencies: 0.013649
235500 -- (-641.580) (-641.050) [-639.778] (-640.002) * (-641.425) (-640.200) [-640.185] (-640.118) -- 0:00:17
236000 -- (-640.550) [-642.425] (-640.511) (-638.879) * (-644.599) (-640.932) [-642.833] (-645.073) -- 0:00:17
236500 -- [-639.403] (-639.578) (-642.657) (-642.703) * (-640.421) (-642.099) [-640.757] (-642.618) -- 0:00:17
237000 -- (-640.217) [-639.583] (-642.526) (-640.551) * (-641.668) (-640.099) (-643.604) [-641.232] -- 0:00:17
237500 -- (-640.681) [-639.717] (-641.080) (-640.615) * [-640.508] (-640.306) (-644.440) (-641.741) -- 0:00:17
238000 -- (-639.929) (-640.967) [-641.510] (-641.833) * (-639.788) (-640.729) (-639.589) [-640.481] -- 0:00:17
238500 -- (-642.914) [-644.664] (-640.154) (-639.956) * [-640.025] (-640.775) (-640.644) (-640.483) -- 0:00:17
239000 -- [-640.321] (-640.203) (-641.070) (-639.289) * (-639.466) [-641.460] (-640.898) (-642.730) -- 0:00:17
239500 -- (-641.244) (-641.128) [-640.033] (-642.259) * [-642.494] (-641.284) (-641.412) (-641.380) -- 0:00:17
240000 -- (-640.393) (-639.368) (-645.524) [-639.162] * (-642.602) (-642.275) [-639.472] (-638.908) -- 0:00:17
Average standard deviation of split frequencies: 0.014038
240500 -- (-643.187) [-640.415] (-639.555) (-642.763) * (-639.713) [-640.722] (-643.142) (-638.604) -- 0:00:17
241000 -- (-640.971) [-640.274] (-639.285) (-639.779) * (-639.485) [-640.711] (-641.845) (-643.386) -- 0:00:17
241500 -- (-640.739) [-640.471] (-640.761) (-642.412) * (-639.409) [-643.077] (-642.586) (-643.223) -- 0:00:17
242000 -- (-640.181) (-641.762) [-640.203] (-643.196) * (-639.886) (-641.778) (-640.449) [-639.289] -- 0:00:17
242500 -- [-640.661] (-642.807) (-640.703) (-641.032) * [-639.643] (-639.540) (-640.075) (-639.504) -- 0:00:16
243000 -- (-640.703) (-639.393) [-643.018] (-641.929) * (-640.662) [-639.472] (-641.032) (-638.859) -- 0:00:16
243500 -- (-641.361) [-642.344] (-641.948) (-641.912) * (-639.435) (-639.969) (-640.205) [-639.387] -- 0:00:16
244000 -- (-641.746) [-641.815] (-641.148) (-641.363) * [-641.498] (-647.631) (-640.024) (-639.386) -- 0:00:16
244500 -- (-639.815) (-641.145) [-641.447] (-643.076) * [-640.109] (-641.437) (-643.801) (-639.519) -- 0:00:16
245000 -- [-641.690] (-643.059) (-639.568) (-642.174) * (-641.748) (-639.187) [-643.222] (-642.180) -- 0:00:16
Average standard deviation of split frequencies: 0.013946
245500 -- (-639.917) (-640.856) (-644.082) [-638.976] * [-638.982] (-641.821) (-644.140) (-641.587) -- 0:00:16
246000 -- (-642.816) [-641.610] (-640.538) (-639.389) * (-640.847) [-644.564] (-639.452) (-640.769) -- 0:00:16
246500 -- (-644.830) (-642.449) (-640.686) [-640.534] * (-640.965) (-640.117) [-639.914] (-639.999) -- 0:00:16
247000 -- (-641.048) (-641.983) [-640.941] (-643.213) * [-640.754] (-641.202) (-639.551) (-640.115) -- 0:00:16
247500 -- [-639.026] (-645.661) (-640.230) (-639.479) * (-640.827) [-640.716] (-642.520) (-640.290) -- 0:00:16
248000 -- [-638.980] (-643.460) (-639.082) (-640.642) * (-639.473) (-640.128) (-640.586) [-640.230] -- 0:00:16
248500 -- (-649.924) (-640.643) [-639.336] (-644.856) * [-639.329] (-641.186) (-640.493) (-643.308) -- 0:00:16
249000 -- (-643.578) [-641.347] (-640.076) (-640.118) * (-639.866) [-640.000] (-639.583) (-641.444) -- 0:00:17
249500 -- (-639.265) (-640.148) [-640.145] (-643.197) * (-640.811) [-642.258] (-643.643) (-641.814) -- 0:00:17
250000 -- (-641.323) (-646.709) [-641.197] (-639.251) * (-642.178) (-640.801) (-642.767) [-645.110] -- 0:00:17
Average standard deviation of split frequencies: 0.014000
250500 -- (-639.473) (-648.231) (-639.989) [-640.096] * [-640.937] (-639.283) (-643.139) (-640.792) -- 0:00:16
251000 -- (-640.874) [-644.753] (-639.775) (-640.329) * (-642.466) (-640.697) [-639.835] (-640.808) -- 0:00:16
251500 -- (-639.897) (-642.943) (-644.154) [-639.886] * (-640.935) (-641.764) [-640.649] (-642.290) -- 0:00:16
252000 -- (-641.960) (-642.029) (-639.767) [-638.698] * (-641.541) [-643.764] (-640.079) (-641.563) -- 0:00:16
252500 -- [-639.365] (-643.321) (-639.518) (-638.588) * (-642.148) (-639.678) [-639.977] (-642.135) -- 0:00:16
253000 -- [-641.343] (-640.473) (-639.356) (-639.739) * (-640.192) (-639.562) [-642.174] (-640.146) -- 0:00:16
253500 -- (-640.234) [-639.966] (-640.315) (-640.554) * (-640.356) (-639.447) [-639.097] (-640.268) -- 0:00:16
254000 -- (-639.037) [-639.559] (-638.992) (-639.248) * (-640.046) (-640.167) (-639.675) [-641.657] -- 0:00:16
254500 -- (-644.699) [-643.812] (-642.584) (-639.540) * (-641.440) [-638.587] (-639.649) (-643.620) -- 0:00:16
255000 -- (-640.781) (-640.341) [-639.654] (-639.461) * (-643.848) [-642.345] (-646.357) (-643.397) -- 0:00:16
Average standard deviation of split frequencies: 0.013606
255500 -- (-639.552) [-639.714] (-640.758) (-638.930) * [-643.346] (-639.294) (-640.027) (-643.602) -- 0:00:16
256000 -- (-641.185) (-640.066) [-641.382] (-638.540) * (-641.378) (-642.496) (-642.702) [-639.918] -- 0:00:16
256500 -- (-640.590) (-639.884) (-643.005) [-640.771] * (-640.606) [-643.708] (-639.320) (-638.756) -- 0:00:16
257000 -- [-641.273] (-644.646) (-640.552) (-640.418) * (-639.208) (-640.135) (-642.923) [-638.704] -- 0:00:16
257500 -- [-640.191] (-640.144) (-638.757) (-639.295) * (-643.098) [-639.731] (-642.726) (-638.647) -- 0:00:16
258000 -- [-640.478] (-640.186) (-642.363) (-643.051) * (-639.446) (-641.528) (-642.530) [-639.118] -- 0:00:15
258500 -- (-640.902) [-639.587] (-640.739) (-641.844) * (-639.462) [-643.129] (-640.357) (-639.579) -- 0:00:15
259000 -- (-639.079) (-641.397) [-642.032] (-640.257) * (-638.707) (-638.791) [-639.424] (-639.816) -- 0:00:15
259500 -- [-640.417] (-644.812) (-641.095) (-640.473) * (-638.954) (-639.718) [-643.129] (-640.895) -- 0:00:15
260000 -- (-640.244) [-642.531] (-642.031) (-640.293) * (-642.204) (-639.270) (-641.779) [-639.752] -- 0:00:15
Average standard deviation of split frequencies: 0.012961
260500 -- (-641.092) (-640.231) (-641.603) [-642.956] * [-641.207] (-639.232) (-640.658) (-640.711) -- 0:00:15
261000 -- [-639.671] (-638.971) (-641.051) (-639.441) * (-643.427) (-640.765) (-641.169) [-640.657] -- 0:00:15
261500 -- (-641.950) (-638.919) [-641.215] (-640.559) * [-640.975] (-640.685) (-643.149) (-639.771) -- 0:00:15
262000 -- [-639.673] (-639.624) (-641.991) (-641.809) * (-642.618) [-641.101] (-646.191) (-641.992) -- 0:00:15
262500 -- (-639.674) (-639.004) [-640.169] (-641.782) * (-643.078) [-640.745] (-645.306) (-643.101) -- 0:00:15
263000 -- (-641.746) [-639.908] (-642.356) (-640.829) * (-642.470) (-639.996) [-647.903] (-641.111) -- 0:00:15
263500 -- (-638.947) (-643.517) [-640.910] (-645.683) * (-642.757) [-638.883] (-643.226) (-641.833) -- 0:00:16
264000 -- (-640.960) (-641.182) (-643.656) [-639.928] * (-640.624) (-639.765) [-642.522] (-643.125) -- 0:00:16
264500 -- (-640.788) (-641.198) (-643.399) [-639.501] * [-640.412] (-640.126) (-639.677) (-643.905) -- 0:00:16
265000 -- (-640.215) (-643.159) (-641.850) [-640.185] * (-640.002) [-641.105] (-643.442) (-641.610) -- 0:00:15
Average standard deviation of split frequencies: 0.012778
265500 -- (-639.263) [-641.032] (-640.606) (-642.355) * (-640.706) (-639.830) (-644.766) [-640.058] -- 0:00:15
266000 -- (-641.153) (-642.319) [-639.853] (-642.484) * (-642.708) (-640.443) [-641.509] (-641.257) -- 0:00:15
266500 -- (-638.838) (-642.927) [-639.220] (-641.666) * (-640.473) (-641.043) [-640.741] (-643.434) -- 0:00:15
267000 -- (-639.739) [-643.240] (-643.620) (-643.843) * (-642.259) (-642.337) (-641.056) [-641.974] -- 0:00:15
267500 -- (-641.209) [-641.777] (-642.284) (-641.945) * [-641.602] (-642.241) (-640.001) (-641.267) -- 0:00:15
268000 -- (-641.125) (-643.564) [-639.639] (-640.688) * (-646.224) (-639.566) [-638.816] (-640.378) -- 0:00:15
268500 -- (-642.380) (-644.802) (-640.379) [-639.115] * (-640.082) [-641.564] (-640.497) (-640.122) -- 0:00:15
269000 -- (-644.152) [-642.704] (-640.509) (-641.063) * [-639.098] (-641.578) (-642.345) (-640.120) -- 0:00:15
269500 -- (-641.332) (-642.772) [-639.411] (-639.669) * (-639.681) (-642.202) (-641.614) [-638.747] -- 0:00:15
270000 -- (-640.417) [-645.005] (-639.102) (-642.064) * (-641.554) [-640.312] (-641.121) (-639.375) -- 0:00:15
Average standard deviation of split frequencies: 0.013566
270500 -- [-640.822] (-639.203) (-639.957) (-643.469) * [-639.290] (-639.506) (-644.287) (-639.888) -- 0:00:15
271000 -- [-639.467] (-641.174) (-638.578) (-643.134) * (-639.585) (-640.980) [-643.075] (-642.393) -- 0:00:15
271500 -- (-656.801) (-641.201) (-641.306) [-639.313] * (-642.427) [-642.995] (-643.322) (-641.163) -- 0:00:15
272000 -- [-640.560] (-642.313) (-640.006) (-647.030) * (-638.418) [-639.605] (-643.545) (-642.952) -- 0:00:15
272500 -- (-642.216) [-642.573] (-639.982) (-642.463) * (-639.195) (-641.648) (-639.072) [-641.049] -- 0:00:15
273000 -- (-646.869) (-638.478) [-643.635] (-641.253) * [-647.478] (-641.435) (-642.501) (-642.566) -- 0:00:14
273500 -- [-641.315] (-640.104) (-646.827) (-646.498) * (-642.358) (-642.327) [-642.477] (-640.438) -- 0:00:14
274000 -- (-639.904) (-639.548) (-646.512) [-639.342] * [-642.200] (-643.843) (-640.688) (-640.422) -- 0:00:14
274500 -- [-642.527] (-643.662) (-639.587) (-647.281) * (-646.173) (-641.824) (-642.298) [-639.607] -- 0:00:14
275000 -- (-642.337) [-642.118] (-640.750) (-643.614) * (-641.729) (-640.934) [-640.947] (-638.635) -- 0:00:14
Average standard deviation of split frequencies: 0.013125
275500 -- (-645.372) (-640.165) (-640.118) [-642.748] * [-641.211] (-639.744) (-647.608) (-642.635) -- 0:00:14
276000 -- (-646.317) [-639.282] (-641.523) (-640.665) * [-638.818] (-640.415) (-640.642) (-640.978) -- 0:00:14
276500 -- (-640.683) [-639.787] (-641.323) (-642.103) * (-641.570) (-639.806) [-640.425] (-641.411) -- 0:00:14
277000 -- (-640.994) (-641.048) (-638.920) [-639.369] * (-642.451) (-640.406) [-639.830] (-641.021) -- 0:00:14
277500 -- (-643.612) (-642.378) (-639.819) [-640.995] * (-640.994) [-638.696] (-640.975) (-644.787) -- 0:00:14
278000 -- (-641.177) [-644.125] (-638.884) (-639.940) * (-641.329) (-640.310) [-642.450] (-642.902) -- 0:00:14
278500 -- (-642.323) (-640.416) (-638.673) [-639.869] * (-641.232) (-640.034) (-639.514) [-640.221] -- 0:00:14
279000 -- (-639.433) (-639.940) (-639.903) [-640.437] * (-639.505) (-640.659) (-643.663) [-639.529] -- 0:00:15
279500 -- (-638.736) [-642.579] (-643.796) (-642.121) * (-638.787) (-639.877) (-639.527) [-642.084] -- 0:00:14
280000 -- (-639.683) (-642.503) (-639.431) [-642.904] * [-639.435] (-639.261) (-639.823) (-647.672) -- 0:00:14
Average standard deviation of split frequencies: 0.013717
280500 -- (-640.062) (-641.180) (-640.620) [-639.577] * [-642.460] (-639.408) (-638.877) (-642.657) -- 0:00:14
281000 -- (-640.356) (-641.359) (-641.320) [-639.038] * (-645.653) (-638.354) (-639.585) [-639.097] -- 0:00:14
281500 -- (-642.867) [-640.265] (-645.702) (-645.021) * (-641.450) (-641.500) [-642.617] (-642.662) -- 0:00:14
282000 -- (-639.891) (-640.848) (-642.748) [-639.709] * (-640.747) [-639.902] (-639.839) (-640.637) -- 0:00:14
282500 -- (-640.959) [-641.171] (-641.484) (-640.251) * (-639.822) (-642.630) [-643.952] (-645.742) -- 0:00:14
283000 -- (-639.556) (-639.316) (-640.595) [-641.115] * (-640.242) (-640.055) (-641.164) [-641.649] -- 0:00:14
283500 -- (-645.565) [-639.340] (-641.348) (-640.241) * [-643.508] (-639.535) (-642.352) (-641.016) -- 0:00:14
284000 -- (-640.110) [-641.401] (-640.785) (-643.285) * (-644.457) [-643.565] (-644.005) (-645.296) -- 0:00:14
284500 -- [-641.822] (-642.098) (-645.659) (-640.314) * (-643.453) [-641.883] (-645.198) (-641.993) -- 0:00:14
285000 -- (-640.146) [-640.621] (-643.571) (-642.238) * (-641.493) (-640.724) [-639.663] (-640.686) -- 0:00:14
Average standard deviation of split frequencies: 0.014193
285500 -- (-641.241) (-641.473) [-641.733] (-640.421) * (-643.547) [-642.598] (-640.632) (-641.977) -- 0:00:14
286000 -- [-639.026] (-639.164) (-642.976) (-639.185) * (-642.069) (-639.756) (-639.344) [-643.140] -- 0:00:14
286500 -- (-649.181) [-638.887] (-639.260) (-640.328) * (-641.311) (-640.627) (-640.695) [-639.047] -- 0:00:14
287000 -- (-645.520) (-641.271) [-639.880] (-642.648) * (-643.304) (-642.674) [-640.563] (-640.350) -- 0:00:14
287500 -- (-643.207) (-639.926) [-640.633] (-641.916) * (-641.340) (-641.654) (-639.824) [-639.451] -- 0:00:14
288000 -- (-640.983) (-638.591) (-642.400) [-641.423] * (-638.773) (-642.312) [-640.150] (-641.726) -- 0:00:13
288500 -- (-642.347) [-639.735] (-639.251) (-648.357) * [-638.799] (-643.952) (-639.885) (-639.125) -- 0:00:13
289000 -- (-641.830) [-639.359] (-641.708) (-638.654) * [-641.724] (-642.696) (-642.904) (-639.288) -- 0:00:13
289500 -- (-644.364) (-641.724) [-641.623] (-641.300) * (-641.771) (-643.489) (-641.235) [-643.998] -- 0:00:13
290000 -- (-639.353) (-642.382) [-639.288] (-641.038) * (-639.119) [-639.427] (-642.830) (-644.624) -- 0:00:13
Average standard deviation of split frequencies: 0.015002
290500 -- (-641.322) (-643.002) (-647.752) [-644.730] * (-640.775) (-640.097) [-641.291] (-639.374) -- 0:00:13
291000 -- (-640.761) [-641.525] (-641.087) (-639.246) * (-640.174) [-640.386] (-646.714) (-642.076) -- 0:00:13
291500 -- (-644.127) (-639.810) (-642.410) [-642.811] * [-639.991] (-642.100) (-641.989) (-642.884) -- 0:00:13
292000 -- (-641.020) [-640.599] (-641.495) (-641.196) * (-639.985) [-641.724] (-642.860) (-640.202) -- 0:00:13
292500 -- [-639.086] (-642.652) (-640.416) (-638.740) * (-638.729) [-641.084] (-640.353) (-643.932) -- 0:00:13
293000 -- (-638.694) (-640.898) [-640.351] (-639.554) * (-640.862) [-640.753] (-643.596) (-641.061) -- 0:00:13
293500 -- (-640.644) (-642.244) (-640.773) [-639.458] * (-642.953) (-641.590) [-642.327] (-643.486) -- 0:00:13
294000 -- (-640.289) [-639.396] (-645.080) (-639.500) * [-642.081] (-639.929) (-640.879) (-641.850) -- 0:00:13
294500 -- [-640.966] (-640.919) (-639.259) (-639.220) * (-640.410) (-642.645) (-640.407) [-643.703] -- 0:00:13
295000 -- [-640.219] (-644.188) (-639.340) (-640.330) * (-641.276) (-640.488) (-641.157) [-639.528] -- 0:00:13
Average standard deviation of split frequencies: 0.015528
295500 -- (-641.118) [-639.541] (-640.271) (-644.429) * [-641.273] (-639.919) (-639.195) (-639.087) -- 0:00:13
296000 -- (-640.011) (-641.713) [-641.697] (-644.844) * [-639.376] (-640.919) (-640.252) (-639.166) -- 0:00:13
296500 -- [-644.221] (-641.102) (-638.976) (-640.130) * (-642.893) (-641.019) (-639.763) [-640.054] -- 0:00:13
297000 -- (-639.086) [-640.500] (-640.848) (-639.569) * (-642.963) [-640.476] (-640.961) (-642.926) -- 0:00:13
297500 -- (-638.891) [-639.416] (-639.444) (-639.471) * (-640.077) [-639.579] (-641.339) (-639.756) -- 0:00:13
298000 -- (-639.152) [-638.972] (-640.132) (-641.525) * (-642.292) (-641.305) [-640.945] (-640.353) -- 0:00:13
298500 -- (-641.776) [-643.567] (-642.627) (-643.755) * [-641.713] (-642.660) (-640.480) (-639.223) -- 0:00:13
299000 -- [-640.143] (-640.443) (-641.002) (-641.054) * [-639.622] (-642.971) (-638.840) (-642.143) -- 0:00:13
299500 -- (-641.637) [-641.523] (-641.713) (-641.478) * [-641.571] (-639.332) (-639.406) (-641.877) -- 0:00:13
300000 -- (-640.096) (-639.897) [-644.806] (-644.735) * [-640.872] (-639.261) (-638.427) (-640.829) -- 0:00:13
Average standard deviation of split frequencies: 0.016463
300500 -- (-640.067) (-641.288) (-639.607) [-639.121] * [-641.508] (-641.164) (-638.890) (-641.631) -- 0:00:13
301000 -- (-639.620) (-639.684) (-643.614) [-639.562] * (-642.000) (-640.083) [-638.661] (-638.872) -- 0:00:13
301500 -- (-643.130) (-640.085) (-643.042) [-639.902] * (-641.209) (-643.034) [-640.573] (-642.384) -- 0:00:13
302000 -- (-643.314) (-641.861) [-638.912] (-642.130) * (-643.689) (-642.710) [-642.153] (-639.386) -- 0:00:13
302500 -- (-638.837) (-638.819) [-641.428] (-639.186) * (-641.631) (-641.683) [-641.566] (-641.293) -- 0:00:13
303000 -- (-640.663) (-640.174) [-638.647] (-641.509) * [-641.383] (-641.868) (-640.747) (-642.921) -- 0:00:13
303500 -- (-639.860) (-642.556) (-638.899) [-638.548] * (-641.481) (-644.859) [-643.568] (-641.358) -- 0:00:12
304000 -- (-639.572) (-640.272) (-639.964) [-639.094] * (-640.556) (-642.027) (-640.014) [-641.374] -- 0:00:12
304500 -- (-644.393) (-641.309) (-638.541) [-639.339] * [-642.911] (-639.446) (-642.705) (-639.281) -- 0:00:12
305000 -- (-639.277) (-647.783) (-641.716) [-639.674] * (-639.411) (-641.568) (-640.362) [-639.853] -- 0:00:12
Average standard deviation of split frequencies: 0.016860
305500 -- (-642.695) [-638.933] (-640.364) (-640.268) * (-640.342) (-641.954) [-640.278] (-639.896) -- 0:00:12
306000 -- (-641.811) [-641.603] (-642.787) (-641.190) * (-638.601) (-640.946) (-642.619) [-639.330] -- 0:00:12
306500 -- (-642.655) (-639.596) [-638.943] (-640.852) * (-639.549) [-639.256] (-641.676) (-640.950) -- 0:00:12
307000 -- (-642.447) (-641.623) [-639.606] (-639.190) * [-645.651] (-642.741) (-643.078) (-640.215) -- 0:00:12
307500 -- [-641.624] (-640.479) (-641.683) (-639.928) * (-642.498) (-640.602) (-641.521) [-640.885] -- 0:00:12
308000 -- (-643.171) [-639.168] (-641.772) (-639.840) * (-642.486) (-641.456) (-639.780) [-639.034] -- 0:00:12
308500 -- (-642.571) (-639.289) (-638.687) [-640.968] * (-641.216) (-640.653) (-644.335) [-639.160] -- 0:00:12
309000 -- (-639.440) [-639.758] (-639.823) (-640.560) * (-643.494) [-638.442] (-644.491) (-640.115) -- 0:00:12
309500 -- (-638.882) [-638.809] (-642.726) (-644.723) * [-640.138] (-640.037) (-644.821) (-639.549) -- 0:00:12
310000 -- [-639.425] (-644.883) (-641.903) (-641.928) * (-640.071) (-638.577) (-643.382) [-640.015] -- 0:00:12
Average standard deviation of split frequencies: 0.016186
310500 -- (-640.263) (-640.644) (-640.466) [-638.611] * [-641.916] (-640.013) (-640.835) (-640.569) -- 0:00:12
311000 -- (-639.592) [-640.141] (-640.842) (-639.914) * [-639.676] (-641.975) (-639.610) (-639.810) -- 0:00:12
311500 -- (-639.249) (-642.891) [-641.001] (-640.178) * (-639.014) (-638.566) [-640.343] (-639.577) -- 0:00:12
312000 -- (-642.615) (-639.825) (-641.198) [-641.235] * (-638.920) (-639.254) [-640.964] (-640.053) -- 0:00:12
312500 -- [-640.257] (-642.315) (-643.466) (-640.935) * (-639.792) (-639.627) [-641.517] (-641.790) -- 0:00:12
313000 -- (-641.882) [-638.427] (-643.169) (-640.802) * (-639.010) [-641.273] (-640.261) (-641.692) -- 0:00:12
313500 -- [-642.273] (-638.405) (-641.179) (-640.279) * [-640.930] (-639.331) (-640.933) (-639.461) -- 0:00:12
314000 -- (-639.665) [-638.888] (-640.312) (-647.557) * (-643.363) [-639.530] (-642.879) (-638.816) -- 0:00:12
314500 -- (-641.399) [-639.075] (-640.777) (-644.303) * (-644.904) [-639.590] (-644.767) (-639.987) -- 0:00:12
315000 -- (-643.530) (-641.904) (-643.548) [-641.412] * [-643.427] (-640.056) (-641.649) (-641.060) -- 0:00:12
Average standard deviation of split frequencies: 0.015747
315500 -- (-640.660) (-639.856) [-642.153] (-641.946) * (-642.054) (-645.439) [-639.901] (-641.014) -- 0:00:12
316000 -- (-641.164) [-640.506] (-643.697) (-643.130) * [-641.071] (-640.592) (-641.604) (-642.238) -- 0:00:12
316500 -- (-641.184) [-641.787] (-641.289) (-641.015) * (-641.086) (-639.449) [-639.695] (-638.558) -- 0:00:12
317000 -- [-640.351] (-644.216) (-640.955) (-643.258) * (-640.335) (-639.271) [-640.362] (-642.333) -- 0:00:12
317500 -- (-641.030) [-639.034] (-641.202) (-639.184) * (-644.902) [-643.831] (-640.529) (-640.206) -- 0:00:12
318000 -- (-641.257) (-642.335) (-641.631) [-639.800] * (-638.637) (-642.351) [-642.323] (-640.467) -- 0:00:12
318500 -- (-641.782) (-639.440) [-643.096] (-640.670) * (-639.235) (-643.225) (-640.561) [-640.622] -- 0:00:11
319000 -- (-640.423) [-639.265] (-642.417) (-640.117) * [-641.639] (-642.785) (-640.848) (-640.090) -- 0:00:11
319500 -- (-639.890) (-638.997) [-641.238] (-641.875) * (-640.705) (-639.756) [-642.614] (-640.881) -- 0:00:11
320000 -- (-640.064) (-641.629) [-642.652] (-639.987) * (-641.920) (-640.079) (-642.327) [-640.014] -- 0:00:11
Average standard deviation of split frequencies: 0.015047
320500 -- (-639.945) (-642.334) [-642.877] (-640.760) * (-641.995) (-643.036) [-642.083] (-639.885) -- 0:00:11
321000 -- [-640.159] (-641.699) (-642.006) (-640.619) * (-645.636) [-641.004] (-643.892) (-640.927) -- 0:00:11
321500 -- (-642.416) (-644.293) (-646.932) [-639.077] * [-639.188] (-644.560) (-639.891) (-640.449) -- 0:00:11
322000 -- (-641.965) (-640.569) (-640.807) [-641.557] * (-640.372) [-639.415] (-643.350) (-644.217) -- 0:00:11
322500 -- (-640.525) [-640.560] (-638.736) (-642.353) * (-639.441) (-638.946) [-643.912] (-643.237) -- 0:00:11
323000 -- (-646.191) (-647.207) (-645.058) [-640.716] * (-639.713) (-639.114) (-641.273) [-638.802] -- 0:00:12
323500 -- (-638.966) (-642.120) (-642.881) [-640.867] * (-640.986) (-645.017) [-642.845] (-640.159) -- 0:00:12
324000 -- (-642.419) [-640.577] (-645.754) (-640.600) * [-640.001] (-640.574) (-642.891) (-639.567) -- 0:00:11
324500 -- [-641.076] (-638.694) (-639.510) (-639.635) * (-642.130) (-641.318) [-640.304] (-640.385) -- 0:00:11
325000 -- [-638.473] (-639.347) (-646.156) (-639.963) * (-639.617) [-639.400] (-645.013) (-643.318) -- 0:00:11
Average standard deviation of split frequencies: 0.014290
325500 -- [-638.658] (-640.279) (-639.593) (-640.584) * [-640.481] (-642.468) (-640.400) (-641.896) -- 0:00:11
326000 -- (-638.859) [-642.013] (-640.518) (-641.100) * (-642.107) (-640.883) [-639.258] (-642.510) -- 0:00:11
326500 -- (-643.104) (-640.527) (-642.777) [-639.338] * (-640.133) (-642.775) (-639.223) [-642.017] -- 0:00:11
327000 -- (-640.060) (-641.050) [-640.199] (-640.303) * [-639.579] (-640.024) (-644.436) (-640.057) -- 0:00:11
327500 -- (-638.941) (-644.446) [-641.220] (-643.185) * (-639.399) (-638.680) (-641.212) [-639.745] -- 0:00:11
328000 -- (-641.585) [-641.419] (-645.547) (-640.569) * (-639.844) (-642.164) [-642.907] (-641.419) -- 0:00:11
328500 -- (-640.779) [-643.428] (-640.355) (-643.273) * (-638.740) (-638.759) [-640.152] (-641.405) -- 0:00:11
329000 -- [-640.920] (-643.576) (-640.143) (-644.602) * (-642.154) [-642.890] (-640.164) (-638.646) -- 0:00:11
329500 -- (-641.154) [-644.848] (-640.831) (-641.336) * (-643.443) (-641.807) [-639.422] (-640.235) -- 0:00:11
330000 -- (-639.765) [-642.761] (-640.618) (-643.017) * (-644.440) (-642.919) [-642.923] (-639.893) -- 0:00:11
Average standard deviation of split frequencies: 0.013250
330500 -- (-639.532) (-644.882) (-641.547) [-639.514] * (-644.957) [-638.790] (-640.344) (-646.477) -- 0:00:11
331000 -- [-639.841] (-643.869) (-640.855) (-641.341) * [-643.242] (-638.930) (-638.519) (-640.162) -- 0:00:11
331500 -- (-639.406) (-640.535) [-639.401] (-642.692) * (-641.333) (-640.981) (-638.686) [-639.412] -- 0:00:11
332000 -- (-643.931) [-638.796] (-639.103) (-641.186) * (-640.819) (-644.410) [-639.120] (-640.355) -- 0:00:11
332500 -- (-644.852) (-639.452) (-638.794) [-644.152] * (-640.714) (-641.530) [-639.226] (-639.530) -- 0:00:11
333000 -- [-639.485] (-642.182) (-642.880) (-643.774) * (-641.738) (-642.613) [-643.976] (-641.952) -- 0:00:11
333500 -- (-639.599) (-642.094) (-644.027) [-638.907] * (-641.088) (-646.137) (-642.851) [-639.168] -- 0:00:10
334000 -- (-642.471) (-641.625) [-641.220] (-640.175) * (-639.841) (-639.938) [-643.984] (-638.765) -- 0:00:10
334500 -- [-639.826] (-641.396) (-640.425) (-639.672) * (-643.545) (-639.880) [-639.114] (-642.779) -- 0:00:10
335000 -- [-639.448] (-641.591) (-639.741) (-639.750) * (-641.916) [-638.938] (-642.477) (-639.358) -- 0:00:10
Average standard deviation of split frequencies: 0.013700
335500 -- (-639.127) [-638.759] (-641.013) (-639.735) * (-640.843) [-643.466] (-641.596) (-641.456) -- 0:00:10
336000 -- (-640.205) [-640.377] (-642.579) (-640.998) * (-638.552) (-642.105) [-641.179] (-639.627) -- 0:00:10
336500 -- (-641.502) (-640.579) (-642.951) [-639.502] * (-642.340) [-640.214] (-644.455) (-642.069) -- 0:00:10
337000 -- (-643.061) [-639.190] (-642.958) (-639.936) * (-643.306) (-639.822) (-639.645) [-641.680] -- 0:00:10
337500 -- (-639.236) [-639.088] (-639.520) (-640.989) * [-644.090] (-640.480) (-640.983) (-642.012) -- 0:00:10
338000 -- [-640.903] (-641.045) (-638.924) (-639.060) * [-642.643] (-643.804) (-639.696) (-640.088) -- 0:00:10
338500 -- (-641.858) [-640.194] (-646.439) (-642.054) * (-643.298) [-641.002] (-641.369) (-638.598) -- 0:00:10
339000 -- (-642.343) (-640.643) [-640.543] (-639.195) * (-639.791) [-639.200] (-642.978) (-641.533) -- 0:00:10
339500 -- [-640.289] (-640.260) (-639.175) (-640.316) * (-641.179) [-639.805] (-642.231) (-640.807) -- 0:00:10
340000 -- (-638.821) (-639.163) (-639.618) [-642.465] * (-640.121) (-639.604) [-640.816] (-640.491) -- 0:00:10
Average standard deviation of split frequencies: 0.013675
340500 -- [-640.855] (-642.240) (-640.591) (-640.244) * (-642.209) (-640.756) (-644.155) [-639.484] -- 0:00:10
341000 -- (-638.832) (-638.266) [-640.492] (-642.071) * (-641.280) [-643.823] (-640.447) (-639.417) -- 0:00:10
341500 -- (-640.276) (-640.321) (-639.622) [-639.939] * (-646.407) [-640.448] (-643.882) (-640.122) -- 0:00:10
342000 -- (-644.405) (-646.959) (-641.401) [-644.230] * (-640.742) [-639.295] (-639.669) (-639.789) -- 0:00:10
342500 -- (-644.417) [-639.574] (-642.178) (-644.779) * [-639.496] (-642.217) (-639.953) (-641.095) -- 0:00:10
343000 -- (-649.002) (-639.935) [-640.132] (-642.768) * (-641.585) [-641.594] (-640.707) (-641.299) -- 0:00:10
343500 -- (-647.750) (-640.593) [-640.964] (-639.619) * (-639.462) (-639.961) (-640.707) [-642.254] -- 0:00:10
344000 -- (-642.283) [-640.795] (-647.829) (-639.884) * (-642.124) (-644.886) (-640.288) [-642.002] -- 0:00:10
344500 -- (-639.662) (-644.788) (-640.773) [-639.821] * (-642.781) [-639.401] (-639.461) (-639.333) -- 0:00:10
345000 -- [-639.376] (-642.551) (-645.112) (-640.010) * (-641.962) (-641.256) (-639.718) [-643.595] -- 0:00:10
Average standard deviation of split frequencies: 0.014746
345500 -- [-640.800] (-646.077) (-641.368) (-639.722) * (-641.071) (-639.644) (-641.141) [-641.613] -- 0:00:10
346000 -- (-641.247) (-639.709) [-641.849] (-643.943) * (-639.853) [-638.960] (-639.021) (-639.977) -- 0:00:10
346500 -- (-639.760) (-642.905) [-640.532] (-639.813) * (-641.814) (-639.485) [-641.595] (-638.937) -- 0:00:10
347000 -- (-642.328) [-641.904] (-639.667) (-640.367) * (-646.410) (-640.062) (-641.081) [-639.520] -- 0:00:10
347500 -- [-639.578] (-643.069) (-642.425) (-643.691) * (-639.447) (-638.492) [-640.150] (-644.544) -- 0:00:10
348000 -- (-639.283) (-644.266) [-640.478] (-639.582) * (-641.267) (-640.797) [-639.917] (-640.964) -- 0:00:10
348500 -- (-641.844) [-642.367] (-647.931) (-641.421) * (-641.411) (-638.372) [-638.729] (-640.184) -- 0:00:09
349000 -- (-640.853) [-640.732] (-652.783) (-640.962) * (-638.806) [-642.921] (-641.168) (-639.031) -- 0:00:09
349500 -- (-640.529) [-640.272] (-644.497) (-642.325) * (-638.646) (-640.486) (-640.770) [-641.703] -- 0:00:09
350000 -- (-642.092) (-640.341) (-652.123) [-639.694] * (-640.131) [-641.360] (-642.480) (-639.099) -- 0:00:09
Average standard deviation of split frequencies: 0.014629
350500 -- [-639.527] (-639.350) (-648.167) (-639.412) * (-640.713) (-640.539) [-644.525] (-640.257) -- 0:00:09
351000 -- [-640.792] (-645.481) (-642.316) (-640.911) * [-643.265] (-642.143) (-644.368) (-638.942) -- 0:00:09
351500 -- (-640.763) (-639.839) [-641.552] (-643.530) * (-641.154) (-642.233) (-642.586) [-640.354] -- 0:00:09
352000 -- [-639.640] (-640.445) (-645.122) (-639.339) * (-641.909) (-640.140) [-639.236] (-642.996) -- 0:00:09
352500 -- (-643.680) [-639.006] (-640.616) (-639.231) * (-642.986) [-639.522] (-639.439) (-639.594) -- 0:00:09
353000 -- [-640.206] (-638.868) (-642.828) (-640.216) * (-643.246) [-641.551] (-639.985) (-639.792) -- 0:00:09
353500 -- (-641.291) (-642.233) [-639.386] (-640.871) * (-639.733) [-641.156] (-639.748) (-639.154) -- 0:00:09
354000 -- [-646.088] (-641.824) (-643.398) (-640.138) * [-641.105] (-639.355) (-639.557) (-642.494) -- 0:00:09
354500 -- (-639.809) [-640.091] (-643.381) (-639.400) * (-639.189) [-641.728] (-640.478) (-643.355) -- 0:00:09
355000 -- (-640.118) (-640.668) (-641.713) [-638.552] * (-642.237) [-641.943] (-640.713) (-639.881) -- 0:00:09
Average standard deviation of split frequencies: 0.013943
355500 -- (-640.360) (-642.736) [-639.323] (-639.474) * (-640.789) (-639.914) (-639.950) [-643.985] -- 0:00:09
356000 -- (-640.479) (-642.132) [-638.563] (-640.733) * [-641.254] (-643.935) (-639.292) (-642.481) -- 0:00:09
356500 -- (-643.156) [-642.653] (-643.128) (-639.837) * (-640.402) [-640.688] (-640.496) (-643.142) -- 0:00:09
357000 -- (-638.722) (-642.110) (-643.645) [-642.488] * [-639.427] (-640.637) (-641.745) (-642.442) -- 0:00:09
357500 -- (-640.534) [-640.768] (-644.110) (-638.455) * (-641.700) [-640.361] (-640.374) (-641.248) -- 0:00:09
358000 -- (-641.103) (-640.151) (-641.314) [-638.974] * (-640.983) (-640.338) [-640.035] (-640.124) -- 0:00:09
358500 -- (-641.000) [-643.196] (-642.304) (-644.827) * [-639.242] (-644.632) (-640.889) (-643.936) -- 0:00:09
359000 -- (-640.121) (-640.498) (-639.068) [-639.814] * (-640.526) (-640.574) [-639.235] (-641.813) -- 0:00:09
359500 -- (-639.178) (-641.745) (-639.517) [-641.868] * (-639.756) (-641.727) (-642.788) [-641.966] -- 0:00:09
360000 -- (-642.373) (-640.392) (-640.048) [-639.781] * (-641.649) (-640.987) (-639.549) [-641.859] -- 0:00:09
Average standard deviation of split frequencies: 0.012993
360500 -- [-641.001] (-642.052) (-641.010) (-640.572) * [-641.374] (-647.238) (-641.694) (-645.826) -- 0:00:09
361000 -- (-643.485) [-641.631] (-642.523) (-638.799) * (-640.118) (-642.559) (-640.964) [-643.659] -- 0:00:09
361500 -- (-640.269) (-642.641) [-642.182] (-639.056) * (-643.005) (-643.977) [-640.154] (-639.546) -- 0:00:09
362000 -- (-642.399) (-639.778) (-639.553) [-639.143] * [-640.925] (-644.591) (-639.297) (-638.836) -- 0:00:09
362500 -- (-644.666) [-640.334] (-639.211) (-639.967) * [-640.295] (-642.637) (-639.825) (-642.554) -- 0:00:09
363000 -- [-640.166] (-641.366) (-638.978) (-639.717) * [-640.014] (-641.193) (-644.497) (-641.725) -- 0:00:09
363500 -- (-640.955) [-640.411] (-647.451) (-640.371) * (-640.021) [-640.886] (-639.350) (-642.403) -- 0:00:09
364000 -- (-642.080) [-639.234] (-641.566) (-644.096) * [-640.144] (-643.492) (-640.614) (-640.254) -- 0:00:08
364500 -- (-640.013) (-641.040) (-639.649) [-639.090] * (-643.786) (-640.417) [-639.616] (-640.309) -- 0:00:08
365000 -- (-641.419) [-639.960] (-642.530) (-639.063) * (-638.707) (-645.168) [-643.236] (-638.812) -- 0:00:08
Average standard deviation of split frequencies: 0.012577
365500 -- (-640.570) [-640.292] (-640.102) (-642.370) * (-639.882) (-643.304) (-641.613) [-640.702] -- 0:00:08
366000 -- [-639.860] (-644.204) (-642.969) (-639.183) * (-640.210) (-639.696) (-640.277) [-640.187] -- 0:00:08
366500 -- (-640.781) [-639.989] (-640.091) (-644.299) * (-646.290) (-641.682) [-641.903] (-640.375) -- 0:00:08
367000 -- (-643.657) (-644.061) (-639.763) [-642.605] * [-639.246] (-639.015) (-639.967) (-639.387) -- 0:00:08
367500 -- (-640.231) (-641.979) (-640.442) [-643.956] * (-638.872) [-639.370] (-639.392) (-642.831) -- 0:00:08
368000 -- (-639.300) (-641.945) [-638.930] (-642.309) * (-640.358) (-639.823) [-639.103] (-639.010) -- 0:00:08
368500 -- (-639.212) (-644.550) [-639.342] (-642.857) * (-644.027) (-641.320) (-642.191) [-640.318] -- 0:00:08
369000 -- [-639.760] (-644.708) (-642.940) (-638.821) * (-646.649) (-643.853) [-639.043] (-646.286) -- 0:00:08
369500 -- [-638.766] (-643.540) (-639.740) (-640.909) * (-639.879) (-640.295) [-640.899] (-638.862) -- 0:00:08
370000 -- (-641.240) (-642.831) [-643.583] (-644.878) * (-641.837) (-638.735) (-647.104) [-639.156] -- 0:00:08
Average standard deviation of split frequencies: 0.013036
370500 -- (-640.283) [-640.470] (-646.495) (-641.197) * (-643.006) [-639.896] (-638.730) (-644.262) -- 0:00:08
371000 -- [-640.685] (-639.368) (-639.922) (-639.215) * (-641.215) (-642.548) [-639.508] (-638.672) -- 0:00:08
371500 -- (-641.501) [-642.145] (-641.874) (-639.404) * (-639.766) (-640.286) (-640.648) [-639.306] -- 0:00:08
372000 -- (-639.710) [-640.509] (-642.504) (-639.809) * [-638.779] (-642.593) (-640.658) (-640.069) -- 0:00:08
372500 -- (-639.219) (-640.389) [-640.051] (-642.164) * (-639.890) (-639.746) [-639.686] (-642.560) -- 0:00:08
373000 -- (-639.272) (-638.744) (-643.121) [-641.012] * (-642.909) [-643.836] (-640.849) (-639.577) -- 0:00:08
373500 -- (-641.682) (-639.966) (-640.192) [-642.498] * [-639.096] (-641.146) (-639.191) (-639.365) -- 0:00:08
374000 -- [-641.777] (-639.941) (-640.191) (-642.537) * (-643.595) (-644.464) (-639.513) [-638.670] -- 0:00:08
374500 -- (-640.952) (-641.197) [-642.855] (-643.156) * (-639.740) (-641.783) (-641.001) [-639.721] -- 0:00:08
375000 -- (-641.911) (-640.092) [-641.842] (-640.680) * [-643.648] (-640.194) (-638.648) (-641.731) -- 0:00:08
Average standard deviation of split frequencies: 0.013039
375500 -- [-640.868] (-641.677) (-640.451) (-641.426) * (-639.520) [-641.518] (-640.318) (-641.146) -- 0:00:08
376000 -- (-641.275) (-639.668) (-639.266) [-639.218] * (-643.723) [-638.861] (-642.448) (-640.163) -- 0:00:08
376500 -- (-640.871) (-640.140) [-642.692] (-639.806) * (-639.522) (-638.836) (-641.956) [-639.216] -- 0:00:08
377000 -- [-640.516] (-640.716) (-639.554) (-639.012) * (-640.663) (-639.626) (-639.639) [-639.125] -- 0:00:08
377500 -- [-639.386] (-640.868) (-639.649) (-641.211) * [-640.550] (-640.461) (-638.695) (-642.359) -- 0:00:08
378000 -- (-640.792) (-639.282) (-639.667) [-639.028] * (-640.530) (-639.863) [-640.557] (-641.638) -- 0:00:08
378500 -- (-641.867) (-639.340) (-639.410) [-642.147] * (-640.043) [-639.313] (-639.715) (-641.829) -- 0:00:08
379000 -- (-641.628) [-641.383] (-639.447) (-641.807) * [-640.146] (-639.693) (-639.355) (-640.094) -- 0:00:07
379500 -- [-640.533] (-642.464) (-639.004) (-639.820) * (-640.321) [-641.127] (-640.555) (-639.564) -- 0:00:07
380000 -- (-640.081) [-639.461] (-639.177) (-640.082) * (-644.416) [-643.892] (-640.849) (-640.141) -- 0:00:07
Average standard deviation of split frequencies: 0.012538
380500 -- [-638.953] (-645.469) (-640.022) (-641.507) * [-641.276] (-641.678) (-639.653) (-639.671) -- 0:00:07
381000 -- (-639.697) [-639.164] (-641.505) (-640.535) * [-640.789] (-640.599) (-639.641) (-639.378) -- 0:00:07
381500 -- (-642.954) (-638.839) (-641.629) [-639.473] * (-640.370) (-642.313) (-639.596) [-639.260] -- 0:00:07
382000 -- (-638.856) (-638.917) [-639.875] (-639.641) * (-640.097) (-640.437) [-639.586] (-639.310) -- 0:00:07
382500 -- (-640.027) (-638.914) (-639.558) [-639.796] * (-643.066) (-642.760) (-639.188) [-643.112] -- 0:00:07
383000 -- (-639.989) (-641.190) (-638.389) [-641.070] * [-640.615] (-639.917) (-639.672) (-643.010) -- 0:00:07
383500 -- (-641.375) (-641.469) [-639.262] (-640.389) * (-640.021) [-642.111] (-642.295) (-639.366) -- 0:00:07
384000 -- (-640.149) (-640.856) [-642.548] (-643.526) * (-639.826) [-640.902] (-642.521) (-643.532) -- 0:00:07
384500 -- [-639.650] (-643.265) (-640.723) (-640.335) * (-640.380) (-641.060) (-639.280) [-641.112] -- 0:00:07
385000 -- (-643.299) [-640.078] (-640.246) (-639.553) * [-639.120] (-643.889) (-639.598) (-642.510) -- 0:00:07
Average standard deviation of split frequencies: 0.011638
385500 -- (-642.760) [-639.803] (-639.537) (-641.895) * (-639.215) (-640.131) [-641.197] (-644.787) -- 0:00:07
386000 -- (-639.202) (-639.324) [-639.103] (-641.868) * [-639.440] (-640.182) (-644.425) (-641.326) -- 0:00:07
386500 -- (-642.397) [-639.140] (-640.347) (-642.044) * (-641.248) (-640.410) [-640.190] (-641.231) -- 0:00:07
387000 -- (-640.822) (-639.870) (-640.871) [-640.491] * [-641.806] (-639.827) (-642.080) (-641.297) -- 0:00:07
387500 -- (-639.462) (-640.498) [-642.476] (-642.778) * (-639.769) [-641.318] (-641.716) (-640.370) -- 0:00:07
388000 -- (-642.062) [-639.987] (-640.711) (-641.979) * [-639.602] (-640.747) (-645.976) (-640.431) -- 0:00:07
388500 -- (-640.548) [-639.100] (-642.190) (-640.037) * (-638.865) [-643.484] (-640.977) (-639.060) -- 0:00:07
389000 -- (-639.301) (-640.413) [-640.910] (-641.545) * (-639.402) (-639.363) (-640.954) [-640.457] -- 0:00:07
389500 -- (-639.780) [-640.495] (-641.319) (-640.626) * (-642.043) (-639.342) [-640.854] (-641.683) -- 0:00:07
390000 -- (-644.713) [-641.724] (-641.566) (-639.148) * (-639.604) (-643.022) (-639.070) [-643.300] -- 0:00:07
Average standard deviation of split frequencies: 0.011712
390500 -- (-641.825) (-639.434) (-649.044) [-639.280] * [-639.118] (-641.515) (-642.059) (-639.333) -- 0:00:07
391000 -- (-641.621) (-639.464) [-643.382] (-643.342) * (-641.881) [-642.611] (-639.080) (-639.595) -- 0:00:07
391500 -- [-641.883] (-640.302) (-641.801) (-642.322) * (-642.585) (-639.517) (-640.899) [-638.623] -- 0:00:07
392000 -- (-640.609) [-639.853] (-640.055) (-639.822) * (-639.100) (-642.463) [-639.267] (-643.057) -- 0:00:07
392500 -- (-639.892) (-641.841) (-645.440) [-640.686] * (-644.380) (-651.637) [-643.762] (-643.378) -- 0:00:07
393000 -- [-639.493] (-645.207) (-642.585) (-641.690) * (-639.830) (-639.633) (-643.809) [-639.593] -- 0:00:07
393500 -- [-639.675] (-639.196) (-643.931) (-642.573) * [-638.989] (-640.249) (-643.314) (-647.377) -- 0:00:07
394000 -- (-638.700) [-638.795] (-643.889) (-642.754) * (-638.877) (-639.782) (-642.707) [-640.068] -- 0:00:06
394500 -- (-640.804) (-638.857) [-641.032] (-641.457) * (-641.438) (-641.051) (-640.688) [-638.912] -- 0:00:06
395000 -- (-638.919) [-639.281] (-639.337) (-640.293) * (-640.473) [-641.054] (-642.675) (-639.277) -- 0:00:06
Average standard deviation of split frequencies: 0.011160
395500 -- [-640.041] (-643.206) (-638.545) (-640.899) * (-640.284) [-644.180] (-639.234) (-641.411) -- 0:00:06
396000 -- (-641.207) (-641.692) (-644.839) [-638.934] * (-641.287) (-642.229) (-640.533) [-642.065] -- 0:00:06
396500 -- (-642.421) [-640.862] (-640.577) (-640.421) * (-641.809) [-641.691] (-639.019) (-643.106) -- 0:00:07
397000 -- (-640.524) (-641.308) [-644.286] (-643.404) * [-639.374] (-639.775) (-639.021) (-639.886) -- 0:00:07
397500 -- (-639.782) (-638.460) (-639.442) [-641.590] * (-638.757) (-640.058) (-639.092) [-643.807] -- 0:00:06
398000 -- (-644.322) (-638.988) [-638.788] (-641.489) * (-640.929) [-639.428] (-641.122) (-641.034) -- 0:00:06
398500 -- (-640.090) [-640.017] (-642.183) (-641.231) * (-641.844) [-639.349] (-642.463) (-639.813) -- 0:00:06
399000 -- (-641.725) (-642.819) (-639.580) [-641.824] * (-639.522) (-640.798) (-640.803) [-642.159] -- 0:00:06
399500 -- (-640.023) (-639.025) (-639.572) [-638.563] * (-641.429) [-642.210] (-639.077) (-641.863) -- 0:00:06
400000 -- (-643.882) (-640.147) [-642.281] (-640.003) * (-640.387) (-642.393) (-639.796) [-640.890] -- 0:00:06
Average standard deviation of split frequencies: 0.010221
400500 -- (-643.028) (-641.862) [-645.753] (-640.685) * (-642.046) (-641.361) [-638.789] (-638.799) -- 0:00:06
401000 -- (-639.143) (-642.606) (-641.900) [-642.858] * (-641.363) (-641.985) (-639.629) [-639.810] -- 0:00:06
401500 -- [-639.186] (-641.238) (-641.916) (-642.492) * (-638.957) (-641.591) [-638.586] (-638.984) -- 0:00:06
402000 -- (-640.986) [-642.514] (-639.525) (-638.921) * (-639.940) [-639.481] (-639.611) (-639.036) -- 0:00:06
402500 -- (-646.594) [-641.265] (-642.249) (-639.996) * [-640.896] (-639.386) (-638.905) (-639.811) -- 0:00:06
403000 -- (-641.453) (-640.164) (-639.989) [-641.132] * (-641.462) (-640.708) [-639.423] (-642.774) -- 0:00:06
403500 -- (-641.245) [-641.031] (-639.340) (-638.647) * (-639.504) (-638.932) (-641.173) [-643.885] -- 0:00:06
404000 -- (-641.216) [-640.847] (-642.995) (-639.963) * (-639.366) (-639.793) [-639.649] (-644.434) -- 0:00:06
404500 -- (-639.568) (-641.934) [-640.152] (-639.566) * (-643.479) (-639.846) (-639.544) [-640.628] -- 0:00:06
405000 -- (-641.559) (-641.220) (-640.043) [-640.994] * (-640.121) (-643.551) [-639.332] (-639.904) -- 0:00:06
Average standard deviation of split frequencies: 0.010087
405500 -- (-639.398) [-641.777] (-641.598) (-647.715) * [-639.498] (-641.030) (-639.427) (-644.637) -- 0:00:06
406000 -- [-641.827] (-640.361) (-643.729) (-641.708) * (-640.747) [-638.759] (-642.312) (-639.273) -- 0:00:06
406500 -- (-646.083) [-640.123] (-642.043) (-641.379) * [-641.488] (-640.988) (-643.069) (-642.502) -- 0:00:06
407000 -- [-640.170] (-639.947) (-640.124) (-639.122) * [-639.152] (-640.075) (-641.203) (-642.296) -- 0:00:06
407500 -- (-639.450) (-640.008) [-641.876] (-640.365) * (-641.694) (-642.186) [-639.829] (-640.023) -- 0:00:06
408000 -- [-639.278] (-641.318) (-641.920) (-645.200) * (-641.860) (-639.606) (-639.953) [-640.782] -- 0:00:06
408500 -- (-639.921) (-639.039) (-642.900) [-639.253] * (-640.825) (-638.774) [-640.842] (-641.678) -- 0:00:06
409000 -- (-640.126) (-641.620) [-640.382] (-640.055) * (-641.543) [-642.069] (-638.676) (-646.043) -- 0:00:06
409500 -- [-641.481] (-642.303) (-641.582) (-640.540) * [-640.186] (-643.186) (-639.697) (-643.239) -- 0:00:05
410000 -- (-641.290) (-641.464) (-639.615) [-643.849] * (-640.450) (-640.899) [-638.971] (-641.944) -- 0:00:05
Average standard deviation of split frequencies: 0.009614
410500 -- (-640.144) (-640.481) (-641.054) [-640.486] * (-643.591) [-643.915] (-639.659) (-645.735) -- 0:00:06
411000 -- (-639.497) [-641.148] (-641.253) (-643.595) * (-643.256) [-639.784] (-640.279) (-640.541) -- 0:00:06
411500 -- (-641.980) (-644.695) (-639.295) [-639.418] * (-642.736) [-639.774] (-643.896) (-640.937) -- 0:00:06
412000 -- (-641.018) (-640.251) [-642.773] (-639.137) * (-640.763) [-641.332] (-641.388) (-640.637) -- 0:00:05
412500 -- (-640.571) (-644.378) (-640.609) [-640.092] * (-641.772) (-645.322) (-643.320) [-640.700] -- 0:00:05
413000 -- (-639.117) (-641.446) (-643.297) [-639.898] * (-644.365) [-640.493] (-641.095) (-641.108) -- 0:00:05
413500 -- (-640.936) (-641.909) (-648.707) [-639.962] * (-643.754) (-641.864) (-641.763) [-642.022] -- 0:00:05
414000 -- [-639.295] (-642.880) (-642.650) (-639.864) * (-640.653) (-639.486) [-640.549] (-645.283) -- 0:00:05
414500 -- (-641.216) [-639.609] (-640.176) (-640.188) * [-639.690] (-640.072) (-642.742) (-639.738) -- 0:00:05
415000 -- (-639.821) (-642.512) (-640.417) [-640.405] * (-641.461) [-641.267] (-644.567) (-642.550) -- 0:00:05
Average standard deviation of split frequencies: 0.009420
415500 -- (-639.722) (-642.151) [-639.700] (-642.580) * [-639.304] (-639.461) (-641.040) (-640.235) -- 0:00:05
416000 -- (-640.177) (-643.217) (-643.473) [-640.483] * (-638.960) [-640.151] (-640.845) (-641.352) -- 0:00:05
416500 -- [-641.428] (-641.016) (-640.468) (-640.633) * (-642.350) [-641.309] (-642.149) (-640.977) -- 0:00:05
417000 -- (-642.094) (-641.286) (-639.620) [-640.815] * (-642.185) (-641.545) [-641.657] (-640.832) -- 0:00:05
417500 -- (-642.497) (-640.571) [-638.989] (-643.511) * [-644.648] (-641.342) (-639.438) (-644.197) -- 0:00:05
418000 -- [-640.222] (-640.328) (-641.877) (-644.659) * (-640.963) [-641.125] (-640.068) (-644.841) -- 0:00:05
418500 -- (-643.191) (-641.677) [-640.635] (-643.405) * (-641.808) (-642.503) [-646.114] (-640.549) -- 0:00:05
419000 -- (-642.326) (-639.814) [-639.234] (-642.156) * (-642.238) (-639.835) [-638.707] (-641.520) -- 0:00:05
419500 -- (-647.814) (-641.116) [-639.550] (-639.544) * (-643.281) (-641.841) (-639.521) [-640.059] -- 0:00:05
420000 -- (-639.609) [-641.935] (-641.312) (-639.844) * (-648.179) (-640.225) (-641.084) [-641.528] -- 0:00:05
Average standard deviation of split frequencies: 0.009455
420500 -- [-640.325] (-640.778) (-642.441) (-642.099) * [-643.538] (-640.007) (-640.986) (-641.530) -- 0:00:05
421000 -- [-639.242] (-640.419) (-640.876) (-640.143) * (-642.241) (-643.134) (-642.366) [-642.122] -- 0:00:05
421500 -- (-639.753) (-644.560) [-638.747] (-641.215) * [-642.253] (-639.541) (-643.459) (-643.161) -- 0:00:05
422000 -- (-638.491) (-646.173) [-639.004] (-639.269) * [-639.260] (-641.755) (-641.556) (-643.961) -- 0:00:05
422500 -- (-638.965) (-639.295) [-639.754] (-640.626) * (-639.799) (-643.427) (-640.485) [-641.582] -- 0:00:05
423000 -- [-642.898] (-643.174) (-642.374) (-642.126) * (-639.903) [-639.528] (-641.346) (-639.982) -- 0:00:05
423500 -- (-639.666) (-642.844) (-641.176) [-639.808] * (-643.328) (-639.342) (-639.479) [-640.385] -- 0:00:05
424000 -- (-639.515) (-641.916) [-638.925] (-640.090) * [-642.963] (-640.490) (-641.138) (-641.782) -- 0:00:05
424500 -- (-641.389) [-642.223] (-639.818) (-639.870) * (-641.512) (-639.551) (-644.996) [-642.943] -- 0:00:04
425000 -- (-644.007) [-639.260] (-643.873) (-641.609) * (-638.753) [-644.077] (-640.049) (-639.608) -- 0:00:04
Average standard deviation of split frequencies: 0.009890
425500 -- (-640.173) [-639.115] (-642.481) (-643.000) * (-639.473) [-639.898] (-638.683) (-650.274) -- 0:00:05
426000 -- (-642.683) (-639.106) [-641.641] (-638.540) * (-638.999) (-638.704) (-639.764) [-641.878] -- 0:00:05
426500 -- [-639.325] (-642.643) (-644.581) (-640.690) * [-639.099] (-639.066) (-639.445) (-638.992) -- 0:00:04
427000 -- (-640.715) (-640.174) (-639.105) [-639.334] * (-640.360) [-639.503] (-641.800) (-639.896) -- 0:00:04
427500 -- [-642.082] (-640.290) (-645.561) (-639.214) * (-638.911) (-650.902) (-642.945) [-638.915] -- 0:00:04
428000 -- (-640.904) (-645.677) [-642.187] (-638.947) * (-640.590) (-639.963) (-642.442) [-639.204] -- 0:00:04
428500 -- (-639.585) (-643.190) [-638.506] (-643.907) * [-640.219] (-644.170) (-642.749) (-645.171) -- 0:00:04
429000 -- (-639.526) (-643.469) (-640.500) [-640.912] * (-639.993) [-643.731] (-642.839) (-640.394) -- 0:00:04
429500 -- (-642.394) [-642.001] (-642.773) (-642.566) * [-644.377] (-642.320) (-641.216) (-640.251) -- 0:00:04
430000 -- (-644.047) (-639.186) (-641.748) [-641.144] * (-640.951) (-642.285) (-639.365) [-639.424] -- 0:00:04
Average standard deviation of split frequencies: 0.010399
430500 -- [-639.821] (-641.510) (-640.011) (-642.138) * [-640.614] (-640.576) (-639.857) (-643.944) -- 0:00:04
431000 -- (-639.680) (-643.407) (-641.364) [-639.810] * (-641.636) (-644.838) (-641.607) [-641.444] -- 0:00:04
431500 -- [-639.847] (-642.153) (-642.608) (-639.212) * (-645.350) [-639.609] (-643.391) (-643.937) -- 0:00:04
432000 -- (-641.760) (-642.946) [-640.595] (-639.406) * (-644.780) [-639.531] (-638.751) (-641.266) -- 0:00:04
432500 -- (-643.466) (-638.897) [-643.147] (-641.950) * (-642.526) [-643.153] (-639.473) (-638.554) -- 0:00:04
433000 -- (-639.310) (-639.395) (-639.178) [-638.904] * (-642.311) (-643.497) (-639.287) [-641.618] -- 0:00:04
433500 -- (-639.863) [-639.532] (-639.197) (-640.389) * (-642.150) (-643.248) (-639.587) [-639.611] -- 0:00:04
434000 -- (-638.888) [-642.732] (-639.706) (-643.332) * (-638.370) [-638.584] (-639.968) (-642.176) -- 0:00:04
434500 -- (-640.947) (-641.128) [-639.742] (-640.764) * (-640.723) (-641.092) (-640.070) [-641.849] -- 0:00:04
435000 -- (-640.572) (-646.621) [-639.734] (-638.913) * (-641.534) (-639.743) [-639.342] (-639.630) -- 0:00:04
Average standard deviation of split frequencies: 0.009866
435500 -- (-639.475) (-643.756) (-640.597) [-638.892] * (-644.628) (-640.009) [-641.287] (-639.515) -- 0:00:04
436000 -- (-641.505) (-643.100) [-641.758] (-638.382) * (-639.640) (-639.296) [-641.235] (-641.660) -- 0:00:04
436500 -- (-641.478) (-641.970) [-640.835] (-642.066) * (-639.450) [-640.627] (-640.076) (-641.817) -- 0:00:04
437000 -- (-640.215) (-639.047) (-640.999) [-641.573] * (-639.753) (-640.715) (-638.968) [-640.827] -- 0:00:04
437500 -- (-640.854) (-639.792) [-639.725] (-640.734) * (-640.184) (-645.384) [-639.120] (-642.684) -- 0:00:04
438000 -- (-641.685) (-640.992) (-645.715) [-640.343] * (-639.548) (-642.443) (-640.405) [-641.547] -- 0:00:04
438500 -- (-640.011) (-639.848) (-645.078) [-639.744] * (-640.353) [-643.376] (-641.171) (-644.604) -- 0:00:04
439000 -- (-641.510) [-640.671] (-639.927) (-639.471) * [-640.233] (-643.973) (-638.920) (-639.147) -- 0:00:04
439500 -- (-642.404) [-643.137] (-639.634) (-640.504) * (-640.538) (-645.549) [-638.817] (-641.012) -- 0:00:03
440000 -- (-644.974) (-641.627) [-640.655] (-644.226) * [-643.558] (-642.826) (-641.251) (-639.920) -- 0:00:04
Average standard deviation of split frequencies: 0.009962
440500 -- [-642.889] (-638.801) (-639.976) (-641.519) * (-639.830) (-641.120) (-639.599) [-641.171] -- 0:00:04
441000 -- (-640.328) (-640.556) (-639.535) [-639.335] * [-645.528] (-643.089) (-644.969) (-639.037) -- 0:00:04
441500 -- [-639.050] (-641.741) (-641.922) (-639.309) * (-643.743) [-644.428] (-640.361) (-639.198) -- 0:00:03
442000 -- [-646.016] (-640.393) (-642.144) (-641.397) * (-640.571) (-650.848) [-639.713] (-639.853) -- 0:00:03
442500 -- [-641.430] (-639.437) (-639.811) (-641.670) * [-643.523] (-640.698) (-640.861) (-639.016) -- 0:00:03
443000 -- (-641.233) (-639.888) [-641.355] (-642.178) * (-640.573) (-639.462) [-640.412] (-641.508) -- 0:00:03
443500 -- (-640.055) (-640.546) (-639.520) [-641.769] * (-640.857) [-638.593] (-641.578) (-639.019) -- 0:00:03
444000 -- (-643.119) (-640.545) (-639.222) [-642.441] * (-641.300) (-643.619) (-640.136) [-639.914] -- 0:00:03
444500 -- (-641.509) [-642.151] (-638.549) (-643.645) * (-641.152) (-645.874) (-641.605) [-641.767] -- 0:00:03
445000 -- (-642.187) [-641.037] (-639.471) (-647.887) * (-639.787) (-639.255) (-642.418) [-641.988] -- 0:00:03
Average standard deviation of split frequencies: 0.010107
445500 -- [-640.104] (-640.710) (-642.830) (-643.220) * [-640.642] (-640.021) (-639.518) (-639.979) -- 0:00:03
446000 -- (-639.010) (-644.276) (-643.367) [-641.586] * [-638.708] (-641.866) (-639.815) (-641.647) -- 0:00:03
446500 -- (-639.534) (-639.468) [-641.025] (-638.951) * [-638.983] (-640.127) (-641.832) (-639.234) -- 0:00:03
447000 -- (-639.625) (-639.205) [-640.419] (-639.251) * (-639.466) (-640.110) [-641.554] (-640.920) -- 0:00:03
447500 -- [-639.567] (-639.079) (-639.273) (-638.923) * (-640.935) (-640.163) [-643.090] (-638.465) -- 0:00:03
448000 -- (-638.743) (-642.086) [-640.989] (-641.398) * (-640.935) (-642.694) [-640.559] (-638.954) -- 0:00:03
448500 -- (-640.130) (-639.469) [-639.801] (-639.321) * (-639.551) (-642.578) (-641.686) [-642.773] -- 0:00:03
449000 -- (-644.331) [-640.473] (-640.564) (-639.667) * (-640.398) (-642.567) [-641.644] (-641.316) -- 0:00:03
449500 -- (-639.824) (-640.726) (-639.465) [-639.360] * (-646.510) (-641.481) (-639.954) [-639.493] -- 0:00:03
450000 -- (-640.584) [-641.923] (-639.955) (-640.817) * (-644.881) (-645.491) (-639.954) [-638.892] -- 0:00:03
Average standard deviation of split frequencies: 0.009741
450500 -- (-639.427) (-642.018) [-640.345] (-640.872) * (-643.570) (-640.032) (-639.802) [-640.793] -- 0:00:03
451000 -- (-641.464) (-639.712) [-641.791] (-638.659) * (-641.247) [-641.231] (-639.982) (-639.766) -- 0:00:03
451500 -- (-641.470) (-639.392) [-642.598] (-640.540) * (-642.520) [-640.027] (-640.975) (-640.894) -- 0:00:03
452000 -- (-640.859) (-645.020) (-640.185) [-640.130] * (-640.513) (-640.093) (-641.207) [-643.698] -- 0:00:03
452500 -- (-642.634) [-639.039] (-641.061) (-639.809) * [-638.564] (-639.269) (-640.881) (-640.761) -- 0:00:03
453000 -- (-642.067) [-639.610] (-639.148) (-642.272) * (-641.772) (-640.612) (-643.809) [-641.234] -- 0:00:03
453500 -- (-640.232) [-640.151] (-640.931) (-642.522) * (-643.928) [-639.635] (-644.828) (-641.959) -- 0:00:03
454000 -- (-643.998) (-640.772) (-641.128) [-641.208] * (-645.694) (-640.615) [-640.572] (-642.149) -- 0:00:03
454500 -- (-639.221) (-641.274) (-641.125) [-639.692] * (-641.312) (-646.262) (-644.049) [-638.678] -- 0:00:03
455000 -- (-639.368) (-641.504) (-641.960) [-639.684] * (-641.490) [-642.739] (-639.762) (-638.894) -- 0:00:03
Average standard deviation of split frequencies: 0.010015
455500 -- [-640.871] (-642.753) (-643.210) (-639.695) * (-642.447) (-641.184) [-639.547] (-639.647) -- 0:00:03
456000 -- (-639.854) (-638.562) (-640.796) [-643.090] * (-640.747) [-639.518] (-640.323) (-638.361) -- 0:00:02
456500 -- (-641.625) (-639.003) [-640.262] (-641.861) * (-638.804) (-638.919) [-641.445] (-639.573) -- 0:00:02
457000 -- (-640.747) [-638.761] (-640.209) (-641.903) * (-639.149) (-641.312) (-638.818) [-638.624] -- 0:00:02
457500 -- (-643.815) (-644.413) [-640.254] (-641.398) * [-639.628] (-642.212) (-638.556) (-643.716) -- 0:00:02
458000 -- (-642.172) (-639.311) [-639.559] (-643.459) * (-640.959) (-642.074) [-639.248] (-638.653) -- 0:00:02
458500 -- (-643.745) (-641.686) [-640.253] (-641.224) * (-640.558) [-640.927] (-643.825) (-641.092) -- 0:00:02
459000 -- (-642.577) (-640.806) (-644.094) [-641.134] * (-638.879) [-643.885] (-641.550) (-639.393) -- 0:00:02
459500 -- (-641.831) (-639.701) (-641.675) [-641.450] * [-639.462] (-639.160) (-638.973) (-640.227) -- 0:00:02
460000 -- [-640.516] (-639.822) (-644.137) (-639.607) * (-643.030) (-640.452) (-642.350) [-644.147] -- 0:00:02
Average standard deviation of split frequencies: 0.010105
460500 -- (-641.098) [-641.676] (-648.738) (-639.604) * (-646.022) [-639.394] (-639.125) (-642.518) -- 0:00:02
461000 -- (-645.189) (-644.693) [-640.105] (-643.745) * (-643.654) [-639.866] (-640.062) (-641.109) -- 0:00:02
461500 -- (-643.269) [-641.628] (-640.519) (-639.241) * (-642.625) (-640.639) (-641.245) [-641.846] -- 0:00:02
462000 -- (-640.308) [-645.306] (-642.997) (-639.827) * (-639.725) (-640.346) [-641.646] (-642.780) -- 0:00:02
462500 -- (-638.451) (-643.072) [-641.159] (-642.386) * [-639.365] (-640.102) (-638.998) (-640.686) -- 0:00:02
463000 -- (-642.888) [-644.028] (-639.254) (-639.534) * [-641.810] (-640.047) (-639.233) (-641.872) -- 0:00:02
463500 -- (-638.935) [-639.158] (-640.430) (-640.566) * (-640.538) [-640.837] (-643.401) (-641.788) -- 0:00:02
464000 -- (-639.410) (-638.495) (-640.869) [-640.347] * (-639.203) (-644.288) [-638.727] (-647.020) -- 0:00:02
464500 -- [-641.616] (-638.525) (-640.813) (-642.226) * (-643.262) (-639.905) (-639.566) [-640.435] -- 0:00:02
465000 -- [-642.568] (-638.525) (-640.331) (-640.563) * (-640.771) (-642.920) [-639.518] (-640.154) -- 0:00:02
Average standard deviation of split frequencies: 0.009421
465500 -- (-640.743) [-640.359] (-640.660) (-643.157) * [-641.164] (-641.956) (-640.361) (-639.886) -- 0:00:02
466000 -- (-642.601) (-639.832) [-640.263] (-639.934) * (-640.365) (-641.217) [-639.881] (-641.047) -- 0:00:02
466500 -- (-639.245) (-642.822) (-639.523) [-641.599] * [-640.051] (-644.325) (-641.154) (-639.239) -- 0:00:02
467000 -- (-641.401) (-640.023) [-639.943] (-639.235) * [-641.646] (-639.652) (-639.765) (-642.453) -- 0:00:02
467500 -- (-639.555) [-639.597] (-641.520) (-642.893) * (-640.329) (-641.222) (-639.577) [-645.233] -- 0:00:02
468000 -- [-640.307] (-641.308) (-641.595) (-642.436) * (-640.431) [-640.379] (-639.514) (-644.206) -- 0:00:02
468500 -- [-643.576] (-639.623) (-647.625) (-642.807) * (-643.085) [-641.324] (-640.706) (-642.864) -- 0:00:02
469000 -- (-641.204) (-640.706) (-641.118) [-641.245] * (-650.577) (-641.338) (-640.610) [-640.786] -- 0:00:02
469500 -- (-640.279) [-642.055] (-639.743) (-639.506) * [-644.794] (-641.948) (-642.232) (-639.644) -- 0:00:02
470000 -- [-640.885] (-643.064) (-640.244) (-643.476) * (-642.207) [-642.442] (-640.528) (-639.337) -- 0:00:02
Average standard deviation of split frequencies: 0.010454
470500 -- (-639.459) (-641.426) (-645.195) [-641.581] * [-643.540] (-643.342) (-643.968) (-642.515) -- 0:00:02
471000 -- (-639.365) (-639.574) [-640.005] (-639.422) * (-641.879) (-646.519) [-640.429] (-643.404) -- 0:00:01
471500 -- (-639.817) (-649.173) [-643.091] (-638.533) * (-643.513) (-641.916) [-639.732] (-644.197) -- 0:00:01
472000 -- (-638.785) (-641.483) [-642.985] (-640.285) * (-640.351) (-639.411) [-640.533] (-641.587) -- 0:00:01
472500 -- (-640.050) [-639.341] (-639.405) (-645.446) * (-639.311) (-639.624) (-640.112) [-640.260] -- 0:00:01
473000 -- (-638.943) (-645.744) [-642.929] (-639.841) * (-641.915) (-638.436) (-643.029) [-642.060] -- 0:00:01
473500 -- [-643.431] (-641.485) (-641.839) (-639.170) * (-641.922) (-639.223) (-643.744) [-640.279] -- 0:00:01
474000 -- [-638.459] (-644.597) (-643.197) (-639.036) * (-641.670) [-641.158] (-639.840) (-641.073) -- 0:00:01
474500 -- (-646.157) (-640.132) (-639.462) [-639.020] * (-639.680) [-640.570] (-639.334) (-644.332) -- 0:00:01
475000 -- (-642.301) (-640.571) [-638.855] (-641.215) * [-642.073] (-641.971) (-641.502) (-640.475) -- 0:00:01
Average standard deviation of split frequencies: 0.010461
475500 -- (-638.565) [-641.675] (-642.654) (-640.739) * (-639.587) (-643.241) [-640.654] (-640.021) -- 0:00:01
476000 -- (-638.741) (-642.511) (-642.436) [-638.907] * [-639.873] (-646.011) (-640.131) (-644.600) -- 0:00:01
476500 -- (-643.496) (-641.306) (-640.395) [-638.937] * (-640.073) (-644.562) [-640.438] (-641.160) -- 0:00:01
477000 -- (-642.906) [-639.643] (-639.714) (-639.459) * [-639.013] (-642.475) (-641.840) (-642.392) -- 0:00:01
477500 -- (-641.208) [-639.327] (-645.262) (-640.852) * (-639.043) (-641.542) [-639.324] (-640.284) -- 0:00:01
478000 -- (-639.912) (-638.792) (-642.335) [-641.356] * (-639.218) (-642.587) [-640.583] (-640.061) -- 0:00:01
478500 -- (-642.706) [-639.158] (-641.736) (-647.355) * (-638.647) [-638.512] (-639.049) (-639.872) -- 0:00:01
479000 -- (-645.688) (-642.384) (-641.309) [-639.835] * (-639.129) (-641.483) (-638.682) [-639.326] -- 0:00:01
479500 -- [-640.468] (-640.906) (-642.887) (-643.380) * [-639.553] (-639.737) (-644.368) (-643.806) -- 0:00:01
480000 -- (-643.649) [-641.234] (-639.875) (-641.840) * [-639.164] (-644.257) (-639.501) (-642.924) -- 0:00:01
Average standard deviation of split frequencies: 0.010236
480500 -- (-644.918) (-644.278) (-641.964) [-645.250] * (-641.810) (-643.370) [-640.219] (-640.765) -- 0:00:01
481000 -- (-641.047) [-640.082] (-644.546) (-641.542) * (-644.731) (-642.993) [-640.037] (-640.380) -- 0:00:01
481500 -- (-645.610) [-639.672] (-641.274) (-641.239) * [-644.217] (-641.487) (-639.480) (-640.221) -- 0:00:01
482000 -- (-643.096) (-640.256) [-639.940] (-640.275) * [-639.879] (-639.955) (-640.678) (-641.394) -- 0:00:01
482500 -- [-644.810] (-641.427) (-639.129) (-642.888) * (-644.922) [-638.769] (-640.949) (-644.151) -- 0:00:01
483000 -- (-640.748) (-643.293) [-641.514] (-644.268) * (-642.487) (-639.759) (-640.920) [-645.582] -- 0:00:01
483500 -- (-642.757) [-641.633] (-642.960) (-642.197) * (-640.650) (-641.559) (-639.770) [-640.164] -- 0:00:01
484000 -- [-638.760] (-643.662) (-639.846) (-641.182) * (-641.005) (-641.127) [-640.464] (-640.347) -- 0:00:01
484500 -- [-639.370] (-639.169) (-642.016) (-641.305) * [-639.193] (-638.796) (-641.263) (-639.677) -- 0:00:01
485000 -- [-639.806] (-640.138) (-647.068) (-642.094) * [-639.391] (-642.961) (-641.424) (-641.921) -- 0:00:01
Average standard deviation of split frequencies: 0.010973
485500 -- (-639.688) (-641.046) [-646.460] (-642.575) * (-641.115) (-642.250) [-639.744] (-640.563) -- 0:00:00
486000 -- (-640.250) (-640.904) (-640.130) [-640.054] * (-642.069) [-639.444] (-640.998) (-641.656) -- 0:00:00
486500 -- [-641.827] (-640.305) (-643.676) (-639.488) * (-643.970) (-641.530) [-640.539] (-641.379) -- 0:00:00
487000 -- (-639.494) (-638.604) (-642.369) [-642.295] * (-640.187) (-640.104) [-639.286] (-641.659) -- 0:00:00
487500 -- (-641.010) (-641.375) [-640.529] (-640.449) * [-639.311] (-640.219) (-641.059) (-639.711) -- 0:00:00
488000 -- (-639.559) [-640.000] (-641.022) (-643.701) * (-640.344) (-641.198) (-644.013) [-639.855] -- 0:00:00
488500 -- (-641.534) (-640.226) [-639.975] (-640.590) * [-642.293] (-641.677) (-640.547) (-644.738) -- 0:00:00
489000 -- [-640.943] (-641.684) (-640.358) (-639.533) * (-645.987) [-638.961] (-640.040) (-640.353) -- 0:00:00
489500 -- [-641.137] (-639.006) (-640.959) (-639.671) * [-640.193] (-639.547) (-641.990) (-638.461) -- 0:00:00
490000 -- (-640.086) (-640.076) [-644.547] (-644.037) * (-640.378) (-642.289) (-640.293) [-639.662] -- 0:00:00
Average standard deviation of split frequencies: 0.010568
490500 -- (-639.453) (-639.983) (-641.154) [-641.659] * (-643.118) (-640.708) (-641.924) [-640.720] -- 0:00:00
491000 -- (-642.292) (-641.561) [-640.422] (-640.505) * (-638.609) (-641.025) (-639.538) [-642.787] -- 0:00:00
491500 -- (-642.261) (-639.919) (-641.531) [-641.742] * (-638.466) (-641.752) (-639.256) [-641.418] -- 0:00:00
492000 -- (-644.648) [-639.549] (-639.837) (-646.524) * (-639.402) [-640.088] (-641.240) (-641.103) -- 0:00:00
492500 -- (-642.468) [-643.884] (-641.052) (-641.388) * (-639.566) (-641.544) (-642.835) [-643.713] -- 0:00:00
493000 -- [-639.718] (-639.637) (-642.863) (-641.246) * [-639.649] (-641.002) (-643.640) (-641.842) -- 0:00:00
493500 -- (-641.396) (-647.377) [-641.548] (-640.456) * (-642.026) (-639.285) (-639.147) [-641.887] -- 0:00:00
494000 -- (-643.992) (-644.622) [-641.054] (-638.624) * (-640.672) (-641.801) (-641.061) [-640.482] -- 0:00:00
494500 -- (-641.137) [-640.781] (-639.159) (-641.000) * (-639.422) (-640.757) (-645.718) [-638.883] -- 0:00:00
495000 -- (-638.478) (-640.914) (-639.741) [-639.590] * (-641.046) (-639.115) (-640.440) [-641.820] -- 0:00:00
Average standard deviation of split frequencies: 0.010158
495500 -- (-642.477) (-642.350) [-642.825] (-640.601) * [-641.406] (-638.930) (-639.708) (-641.587) -- 0:00:00
496000 -- (-639.625) (-640.948) (-643.012) [-638.927] * [-639.127] (-642.624) (-639.577) (-642.184) -- 0:00:00
496500 -- [-640.497] (-641.802) (-643.258) (-640.306) * (-642.007) (-639.888) (-641.173) [-639.813] -- 0:00:00
497000 -- (-639.979) (-640.866) (-641.634) [-639.111] * [-642.079] (-639.214) (-640.278) (-639.917) -- 0:00:00
497500 -- (-642.757) [-640.138] (-640.208) (-642.302) * [-642.387] (-641.141) (-639.892) (-640.493) -- 0:00:00
498000 -- (-640.880) (-639.786) [-645.245] (-638.712) * (-639.434) [-641.817] (-640.165) (-639.084) -- 0:00:00
498500 -- (-639.769) [-640.696] (-640.763) (-639.781) * (-639.461) (-640.627) [-642.531] (-638.672) -- 0:00:00
499000 -- (-641.333) (-639.330) (-645.327) [-640.127] * (-638.648) (-640.513) (-642.323) [-643.017] -- 0:00:00
499500 -- (-642.591) (-638.624) [-642.661] (-639.707) * [-639.037] (-641.655) (-639.080) (-640.671) -- 0:00:00
500000 -- (-639.383) (-640.343) (-639.957) [-639.900] * [-641.315] (-647.880) (-641.065) (-642.610) -- 0:00:00
Average standard deviation of split frequencies: 0.010416
Analysis completed in 34 seconds
Analysis used 32.83 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -638.25
Likelihood of best state for "cold" chain of run 2 was -638.25
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
78.6 % ( 83 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
36.1 % ( 31 %) Dirichlet(Pi{all})
39.8 % ( 28 %) Slider(Pi{all})
88.4 % ( 92 %) Multiplier(Alpha{1,2})
88.2 % ( 76 %) Multiplier(Alpha{3})
21.5 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 90 %) ParsSPR(Tau{all},V{all})
30.5 % ( 22 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
35.3 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
77.6 % ( 72 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
36.8 % ( 40 %) Dirichlet(Pi{all})
38.7 % ( 20 %) Slider(Pi{all})
88.5 % ( 79 %) Multiplier(Alpha{1,2})
88.2 % ( 84 %) Multiplier(Alpha{3})
22.5 % ( 30 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
69.9 % ( 64 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 92 %) ParsSPR(Tau{all},V{all})
30.6 % ( 21 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
35.0 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
------------------------------
1 | 0.80 0.64 0.50
2 | 83210 0.82 0.66
3 | 83075 82695 0.83
4 | 83451 83852 83717
Chain swap information for run 2:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83279 0.82 0.66
3 | 83578 83524 0.84
4 | 83273 82931 83415
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 1250
Summarizing parameters in files /data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -639.80
| 11 1 2 2 2 |
| 1 1 11 |
| * 1 1 1 1 1 |
| 122 22 2 1 1 1 21 2 2 1 1 2 1 |
|1 12 1 2 1 1 2 * 2 |
|2 2 1 2 * 1 ** 221* 2 222 1 1122 2 |
| 1 1 2 12 * 1 *1 2 2 1 1|
| 2 2 2 2 2 2 2 1 1 2 1 12|
| 1 11 2 2* 2 1 * 1 |
| 2 2 |
| 2 1 |
| 2 2 |
| 1 |
| 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -642.49
^ ^
125000 500000
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -639.99 -643.78
2 -640.00 -643.76
--------------------------------------
TOTAL -640.00 -643.77
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898694 0.086082 0.361689 1.467920 0.870915 615.49 683.25 0.999
r(A<->C){all} 0.180770 0.021373 0.000075 0.472030 0.144800 103.76 104.55 1.012
r(A<->G){all} 0.142226 0.015735 0.000028 0.400863 0.103128 63.94 101.00 1.004
r(A<->T){all} 0.167270 0.019844 0.000029 0.449791 0.128177 51.89 67.80 1.010
r(C<->G){all} 0.174144 0.019011 0.000215 0.417438 0.145043 80.67 92.92 1.000
r(C<->T){all} 0.184752 0.021445 0.000120 0.474172 0.146481 65.42 95.40 1.026
r(G<->T){all} 0.150838 0.016860 0.000084 0.414844 0.114339 80.62 81.00 1.024
pi(A){all} 0.226269 0.000378 0.189796 0.265247 0.225448 662.48 706.74 0.999
pi(C){all} 0.253388 0.000403 0.215324 0.294003 0.252887 409.97 509.07 1.000
pi(G){all} 0.316322 0.000439 0.277179 0.360987 0.316030 516.77 633.88 0.999
pi(T){all} 0.204021 0.000342 0.172215 0.244315 0.203332 563.69 657.35 1.000
alpha{1,2} 0.415560 0.225606 0.000313 1.347253 0.247452 502.40 513.96 1.000
alpha{3} 0.502742 0.279839 0.000188 1.558430 0.322222 506.81 589.38 1.002
pinvar{all} 0.996416 0.000020 0.988722 0.999997 0.997785 594.39 659.25 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 1250
Summarizing trees in files "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 2002 trees in 2 files (sampling 1502 of them)
(Each file contained 1001 trees of which 751 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ....**
8 -- .*..*.
9 -- .***.*
10 -- .**.**
11 -- .**...
12 -- .*.*..
13 -- .****.
14 -- ..*.*.
15 -- ..**..
16 -- .*...*
17 -- ...*.*
18 -- ..*..*
19 -- .*.***
20 -- ..****
21 -- ...**.
22 -- .*..**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 246 0.163782 0.009416 0.157124 0.170439 2
8 227 0.151132 0.029188 0.130493 0.171771 2
9 227 0.151132 0.000942 0.150466 0.151798 2
10 227 0.151132 0.016006 0.139814 0.162450 2
11 225 0.149800 0.010357 0.142477 0.157124 2
12 220 0.146471 0.001883 0.145140 0.147803 2
13 214 0.142477 0.003766 0.139814 0.145140 2
14 212 0.141145 0.026364 0.122503 0.159787 2
15 208 0.138482 0.013182 0.129161 0.147803 2
16 206 0.137150 0.003766 0.134487 0.139814 2
17 203 0.135153 0.008474 0.129161 0.141145 2
18 202 0.134487 0.005649 0.130493 0.138482 2
19 198 0.131824 0.022597 0.115846 0.147803 2
20 197 0.131158 0.000942 0.130493 0.131824 2
21 191 0.127164 0.000942 0.126498 0.127830 2
22 140 0.093209 0.013182 0.083888 0.102530 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101039 0.010221 0.000081 0.297837 0.069355 1.000 2
length{all}[2] 0.099025 0.010503 0.000259 0.286437 0.068205 1.000 2
length{all}[3] 0.096935 0.009332 0.000020 0.294229 0.065481 0.999 2
length{all}[4] 0.097535 0.009390 0.000017 0.288868 0.067403 1.000 2
length{all}[5] 0.106270 0.011197 0.000231 0.309785 0.077206 1.000 2
length{all}[6] 0.097615 0.010193 0.000007 0.293088 0.066549 0.999 2
length{all}[7] 0.093927 0.008236 0.000037 0.283847 0.064505 0.996 2
length{all}[8] 0.110428 0.012131 0.000008 0.354170 0.075818 1.011 2
length{all}[9] 0.109257 0.012458 0.000279 0.319292 0.068261 0.996 2
length{all}[10] 0.096877 0.009678 0.000250 0.318069 0.067059 1.002 2
length{all}[11] 0.101171 0.011106 0.000248 0.304607 0.077417 0.996 2
length{all}[12] 0.112534 0.010998 0.001271 0.300080 0.076572 0.995 2
length{all}[13] 0.091661 0.009222 0.000400 0.278689 0.059069 0.996 2
length{all}[14] 0.096488 0.009485 0.001394 0.259577 0.066558 0.997 2
length{all}[15] 0.101500 0.009977 0.000581 0.274771 0.069331 1.006 2
length{all}[16] 0.091188 0.006709 0.000654 0.256800 0.062960 0.996 2
length{all}[17] 0.094724 0.009730 0.000344 0.290261 0.060834 1.006 2
length{all}[18] 0.100430 0.010035 0.000121 0.333939 0.065485 0.996 2
length{all}[19] 0.107078 0.009766 0.000176 0.270500 0.073110 0.995 2
length{all}[20] 0.097685 0.008811 0.002489 0.275437 0.067705 0.999 2
length{all}[21] 0.107004 0.013383 0.000298 0.355804 0.061929 0.999 2
length{all}[22] 0.099448 0.008749 0.000335 0.290504 0.077380 0.995 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.010416
Maximum standard deviation of split frequencies = 0.029188
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.011
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\-------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 43 trees
90 % credible set contains 89 trees
95 % credible set contains 96 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 465
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 155 / 155 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 155 / 155 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.049747 0.013941 0.044056 0.053189 0.064210 0.019695 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -666.151449
Iterating by ming2
Initial: fx= 666.151449
x= 0.04975 0.01394 0.04406 0.05319 0.06421 0.01969 0.30000 1.30000
1 h-m-p 0.0000 0.0001 372.0301 ++ 653.489108 m 0.0001 13 | 1/8
2 h-m-p 0.0015 0.0216 20.4168 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 340.0589 ++ 649.120745 m 0.0000 44 | 2/8
4 h-m-p 0.0007 0.0310 16.5276 -----------.. | 2/8
5 h-m-p 0.0000 0.0002 304.1160 +++ 634.250865 m 0.0002 76 | 3/8
6 h-m-p 0.0033 0.0621 12.6319 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 264.2382 ++ 631.629935 m 0.0000 108 | 4/8
8 h-m-p 0.0014 0.6895 9.5099 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 215.8389 ++ 630.571798 m 0.0000 139 | 5/8
10 h-m-p 0.0153 7.6345 6.6926 -------------.. | 5/8
11 h-m-p 0.0000 0.0001 152.5726 ++ 628.875203 m 0.0001 172 | 6/8
12 h-m-p 0.0499 8.0000 0.0000 ++++ 628.875203 m 8.0000 185 | 6/8
13 h-m-p 0.0461 8.0000 0.0003 ------------Y 628.875203 0 0.0000 210
Out..
lnL = -628.875203
211 lfun, 211 eigenQcodon, 1266 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.027602 0.083030 0.104672 0.104047 0.060434 0.068218 0.300004 0.738629 0.449330
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.112681
np = 9
lnL0 = -695.878315
Iterating by ming2
Initial: fx= 695.878315
x= 0.02760 0.08303 0.10467 0.10405 0.06043 0.06822 0.30000 0.73863 0.44933
1 h-m-p 0.0000 0.0002 359.1404 +++ 671.617217 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0005 273.8113 ++ 646.876226 m 0.0005 27 | 2/9
3 h-m-p 0.0000 0.0000 92478.8635 ++ 642.131053 m 0.0000 39 | 3/9
4 h-m-p 0.0001 0.0003 372.6399 ++ 634.956450 m 0.0003 51 | 4/9
5 h-m-p 0.0000 0.0000 195718.6236 ++ 628.956656 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 550.2542 ++ 628.875208 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0006 ------Y 628.875208 0 0.0001 93 | 6/9
8 h-m-p 0.0160 8.0000 0.0052 +++++ 628.875208 m 8.0000 111 | 6/9
9 h-m-p 0.0180 0.3957 2.3202 +++ 628.875204 m 0.3957 127 | 7/9
10 h-m-p 1.6000 8.0000 0.0448 ---------N 628.875204 0 0.0000 148 | 7/9
11 h-m-p 0.0914 8.0000 0.0000 ++++ 628.875204 m 8.0000 164 | 7/9
12 h-m-p 0.0160 8.0000 0.0056 +++++ 628.875204 m 8.0000 181 | 7/9
13 h-m-p 0.0088 0.0441 2.6131 ++ 628.875204 m 0.0441 195 | 7/9
14 h-m-p 0.0000 0.0000 1.6237
h-m-p: 0.00000000e+00 0.00000000e+00 1.62374352e+00 628.875204
.. | 7/9
15 h-m-p 0.0160 8.0000 0.0000 -C 628.875204 0 0.0010 217 | 7/9
16 h-m-p 0.0348 8.0000 0.0000 +C 628.875204 0 0.1391 232
Out..
lnL = -628.875204
233 lfun, 699 eigenQcodon, 2796 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.089447 0.100934 0.055350 0.069375 0.092368 0.092319 0.421766 0.892836 0.157901 0.228751 1.475622
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.347519
np = 11
lnL0 = -699.978794
Iterating by ming2
Initial: fx= 699.978794
x= 0.08945 0.10093 0.05535 0.06938 0.09237 0.09232 0.42177 0.89284 0.15790 0.22875 1.47562
1 h-m-p 0.0000 0.0004 324.8269 +++ 654.108839 m 0.0004 17 | 1/11
2 h-m-p 0.0001 0.0005 160.5640 ++ 643.605855 m 0.0005 31 | 2/11
3 h-m-p 0.0000 0.0002 779.1695 ++ 632.352026 m 0.0002 45 | 3/11
4 h-m-p 0.0094 0.2029 6.3401 -------------.. | 3/11
5 h-m-p 0.0000 0.0000 301.7783 ++ 631.288944 m 0.0000 84 | 4/11
6 h-m-p 0.0160 8.0000 2.3863 -------------.. | 4/11
7 h-m-p 0.0000 0.0000 262.3357 ++ 630.088357 m 0.0000 123 | 5/11
8 h-m-p 0.0160 8.0000 1.5833 -------------.. | 5/11
9 h-m-p 0.0000 0.0000 215.1497 ++ 630.074723 m 0.0000 162 | 6/11
10 h-m-p 0.0160 8.0000 1.1846 -------------.. | 6/11
11 h-m-p 0.0000 0.0001 151.9945 ++ 628.875205 m 0.0001 201 | 7/11
12 h-m-p 0.0217 8.0000 0.0000 +++++ 628.875205 m 8.0000 218 | 7/11
13 h-m-p 0.0160 8.0000 0.0050 +++++ 628.875205 m 8.0000 239 | 7/11
14 h-m-p 0.0443 2.4685 0.9014 +++ 628.875199 m 2.4685 258 | 8/11
15 h-m-p 1.6000 8.0000 0.2704 ++ 628.875198 m 8.0000 276 | 8/11
16 h-m-p 1.6000 8.0000 1.3336 ++ 628.875196 m 8.0000 293 | 8/11
17 h-m-p 0.8761 8.0000 12.1783 ++ 628.875195 m 8.0000 307 | 8/11
18 h-m-p 1.6000 8.0000 1.3524 ----------------.. | 8/11
19 h-m-p 0.0160 8.0000 0.0000 ---N 628.875195 0 0.0001 352 | 8/11
20 h-m-p 1.6000 8.0000 0.0000 --N 628.875195 0 0.0250 371
Out..
lnL = -628.875195
372 lfun, 1488 eigenQcodon, 6696 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -628.878893 S = -628.872848 -0.002310
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:03
did 20 / 56 patterns 0:03
did 30 / 56 patterns 0:03
did 40 / 56 patterns 0:03
did 50 / 56 patterns 0:03
did 56 / 56 patterns 0:03
Time used: 0:03
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.099796 0.035847 0.107805 0.023136 0.070928 0.027567 90.373956 0.481041 0.999649 0.650002 1.471109 2.047948
ntime & nrate & np: 6 4 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 0.168905
np = 12
lnL0 = -682.875199
Iterating by ming2
Initial: fx= 682.875199
x= 0.09980 0.03585 0.10781 0.02314 0.07093 0.02757 90.37396 0.48104 0.99965 0.65000 1.47111 2.04795
1 h-m-p 0.0000 0.0002 353.9552 ++ 662.917940 m 0.0002 17 | 1/12
2 h-m-p 0.0003 0.0017 62.8548 ++ 657.888475 m 0.0017 32 | 2/12
3 h-m-p 0.0001 0.0003 739.0709 ++ 637.124722 m 0.0003 47 | 3/12
4 h-m-p 0.0001 0.0004 42.1514 ++ 636.652589 m 0.0004 62 | 4/12
5 h-m-p 0.0001 0.0003 108.5132 ++ 634.337570 m 0.0003 77 | 5/12
6 h-m-p 0.0002 0.0010 87.3026 ++ 628.875198 m 0.0010 92 | 6/12
7 h-m-p 1.6000 8.0000 0.0000 ++ 628.875198 m 8.0000 107 | 6/12
8 h-m-p 0.0577 8.0000 0.0009 ---Y 628.875198 0 0.0002 131
Out..
lnL = -628.875198
132 lfun, 528 eigenQcodon, 2376 P(t)
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.040383 0.049781 0.036215 0.049043 0.092897 0.093251 90.374006 0.980824 1.706049
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.360583
np = 9
lnL0 = -681.974449
Iterating by ming2
Initial: fx= 681.974449
x= 0.04038 0.04978 0.03621 0.04904 0.09290 0.09325 90.37401 0.98082 1.70605
1 h-m-p 0.0000 0.0003 349.3331 +++ 650.781618 m 0.0003 15 | 1/9
2 h-m-p 0.0045 0.0554 17.6595 ------------.. | 1/9
3 h-m-p 0.0000 0.0000 330.2939 ++ 647.679532 m 0.0000 49 | 2/9
4 h-m-p 0.0008 0.0959 10.3673 -----------.. | 2/9
5 h-m-p 0.0000 0.0001 295.6785 ++ 642.492657 m 0.0001 82 | 3/9
6 h-m-p 0.0018 0.1208 8.3367 ------------.. | 3/9
7 h-m-p 0.0000 0.0000 257.0409 ++ 642.160932 m 0.0000 116 | 4/9
8 h-m-p 0.0003 0.1499 6.8059 ----------.. | 4/9
9 h-m-p 0.0000 0.0003 208.4142 +++ 628.931669 m 0.0003 149 | 5/9
10 h-m-p 0.0115 0.2812 3.8588 -------------.. | 5/9
11 h-m-p 0.0000 0.0000 151.9184 ++ 628.875182 m 0.0000 184 | 6/9
12 h-m-p 0.0160 8.0000 0.0000 Y 628.875182 0 0.0160 196 | 6/9
13 h-m-p 1.2176 8.0000 0.0000 Y 628.875182 0 1.2176 211
Out..
lnL = -628.875182
212 lfun, 2332 eigenQcodon, 12720 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.022845 0.081785 0.038249 0.035758 0.082512 0.060306 90.374007 0.900000 1.160302 1.071190 1.300003
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.282756
np = 11
lnL0 = -676.254528
Iterating by ming2
Initial: fx= 676.254528
x= 0.02284 0.08179 0.03825 0.03576 0.08251 0.06031 90.37401 0.90000 1.16030 1.07119 1.30000
1 h-m-p 0.0000 0.0002 351.2023 ++ 656.623146 m 0.0002 16 | 1/11
2 h-m-p 0.0010 0.0064 51.4455 ++ 644.356699 m 0.0064 30 | 2/11
3 h-m-p 0.0000 0.0000 2411.5363 ++ 642.523205 m 0.0000 44 | 3/11
4 h-m-p 0.0004 0.0019 75.5652 ++ 641.642360 m 0.0019 58 | 4/11
5 h-m-p 0.0000 0.0001 4830.0670 ++ 629.755935 m 0.0001 72 | 5/11
6 h-m-p 0.0012 0.0060 31.7361 -----------.. | 5/11
7 h-m-p 0.0000 0.0000 151.7902 ++ 628.875190 m 0.0000 109 | 6/11
8 h-m-p 0.0539 8.0000 0.0000 ++++ 628.875190 m 8.0000 125 | 6/11
9 h-m-p 0.0412 8.0000 0.0005 ---Y 628.875190 0 0.0002 147
Out..
lnL = -628.875190
148 lfun, 1776 eigenQcodon, 9768 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -628.883630 S = -628.873261 -0.004549
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:10
did 20 / 56 patterns 0:10
did 30 / 56 patterns 0:11
did 40 / 56 patterns 0:11
did 50 / 56 patterns 0:11
did 56 / 56 patterns 0:11
Time used: 0:11
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=155
NC_011896_1_WP_010908656_1_2114_MLBR_RS10045 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
NC_002677_1_NP_302336_1_1208_ML1983 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
NZ_LVXE01000003_1_WP_010908656_1_1301_A3216_RS02210 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
NZ_LYPH01000033_1_WP_010908656_1_1380_A8144_RS06600 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
NZ_CP029543_1_WP_010908656_1_2135_DIJ64_RS10870 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
NZ_AP014567_1_WP_010908656_1_2195_JK2ML_RS11170 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL
**************************************************
NC_011896_1_WP_010908656_1_2114_MLBR_RS10045 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
NC_002677_1_NP_302336_1_1208_ML1983 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
NZ_LVXE01000003_1_WP_010908656_1_1301_A3216_RS02210 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
NZ_LYPH01000033_1_WP_010908656_1_1380_A8144_RS06600 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
NZ_CP029543_1_WP_010908656_1_2135_DIJ64_RS10870 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
NZ_AP014567_1_WP_010908656_1_2195_JK2ML_RS11170 RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL
**************************************************
NC_011896_1_WP_010908656_1_2114_MLBR_RS10045 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
NC_002677_1_NP_302336_1_1208_ML1983 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
NZ_LVXE01000003_1_WP_010908656_1_1301_A3216_RS02210 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
NZ_LYPH01000033_1_WP_010908656_1_1380_A8144_RS06600 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
NZ_CP029543_1_WP_010908656_1_2135_DIJ64_RS10870 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
NZ_AP014567_1_WP_010908656_1_2195_JK2ML_RS11170 LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE
**************************************************
NC_011896_1_WP_010908656_1_2114_MLBR_RS10045 SDGVQ
NC_002677_1_NP_302336_1_1208_ML1983 SDGVQ
NZ_LVXE01000003_1_WP_010908656_1_1301_A3216_RS02210 SDGVQ
NZ_LYPH01000033_1_WP_010908656_1_1380_A8144_RS06600 SDGVQ
NZ_CP029543_1_WP_010908656_1_2135_DIJ64_RS10870 SDGVQ
NZ_AP014567_1_WP_010908656_1_2195_JK2ML_RS11170 SDGVQ
*****
>NC_011896_1_WP_010908656_1_2114_MLBR_RS10045 ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG TCGGACGGTGTTCAG >NC_002677_1_NP_302336_1_1208_ML1983 ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG TCGGACGGTGTTCAG >NZ_LVXE01000003_1_WP_010908656_1_1301_A3216_RS02210 ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG TCGGACGGTGTTCAG >NZ_LYPH01000033_1_WP_010908656_1_1380_A8144_RS06600 ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG TCGGACGGTGTTCAG >NZ_CP029543_1_WP_010908656_1_2135_DIJ64_RS10870 ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG TCGGACGGTGTTCAG >NZ_AP014567_1_WP_010908656_1_2195_JK2ML_RS11170 ATGTCGAATCGGAAATTCTCATTCGAGGTGACCCGTACTAGTAGCGCTTC TGCCGCAGTCTTATTCCGACTTGTGACGGATGGCGCCAACTGGGCGAAGT GGGCCAAGCCGATAGTCCTTCAATCAAGTTGGGCACGCCTTGGTGATCTG AGACCAGGCGGCATCGGAGCAGTCCGCAAGATAGGGATATGGCCCATACT GGTACGCGAGGAGACCGTCGAATACGAGCAGGATCGTCGGCACCTCTACA AGCTGATCGGACCTCCGAACCCAGCCAAGGACTACCTCGGCGAGGTACTT TTAGCGCCGAATGCAGCAGGTGGTACCAACATCCACTGGAGTGGTTCGTT TACCGAGAACATTCCTGGAACAGGGCCGGTGATGCGGGCAGCGCTAAAGG GTGCGGTTCGGTGTTTAACGGTCCGGTTGGTAAAGACGGCTGAACGCGAG TCGGACGGTGTTCAG
>NC_011896_1_WP_010908656_1_2114_MLBR_RS10045 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE SDGVQ >NC_002677_1_NP_302336_1_1208_ML1983 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE SDGVQ >NZ_LVXE01000003_1_WP_010908656_1_1301_A3216_RS02210 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE SDGVQ >NZ_LYPH01000033_1_WP_010908656_1_1380_A8144_RS06600 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE SDGVQ >NZ_CP029543_1_WP_010908656_1_2135_DIJ64_RS10870 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE SDGVQ >NZ_AP014567_1_WP_010908656_1_2195_JK2ML_RS11170 MSNRKFSFEVTRTSSASAAVLFRLVTDGANWAKWAKPIVLQSSWARLGDL RPGGIGAVRKIGIWPILVREETVEYEQDRRHLYKLIGPPNPAKDYLGEVL LAPNAAGGTNIHWSGSFTENIPGTGPVMRAALKGAVRCLTVRLVKTAERE SDGVQ
#NEXUS
[ID: 5487688786]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908656_1_2114_MLBR_RS10045
NC_002677_1_NP_302336_1_1208_ML1983
NZ_LVXE01000003_1_WP_010908656_1_1301_A3216_RS02210
NZ_LYPH01000033_1_WP_010908656_1_1380_A8144_RS06600
NZ_CP029543_1_WP_010908656_1_2135_DIJ64_RS10870
NZ_AP014567_1_WP_010908656_1_2195_JK2ML_RS11170
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908656_1_2114_MLBR_RS10045,
2 NC_002677_1_NP_302336_1_1208_ML1983,
3 NZ_LVXE01000003_1_WP_010908656_1_1301_A3216_RS02210,
4 NZ_LYPH01000033_1_WP_010908656_1_1380_A8144_RS06600,
5 NZ_CP029543_1_WP_010908656_1_2135_DIJ64_RS10870,
6 NZ_AP014567_1_WP_010908656_1_2195_JK2ML_RS11170
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06935527,2:0.0682048,3:0.06548147,4:0.06740348,5:0.07720599,6:0.06654872);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06935527,2:0.0682048,3:0.06548147,4:0.06740348,5:0.07720599,6:0.06654872);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -639.99 -643.78
2 -640.00 -643.76
--------------------------------------
TOTAL -640.00 -643.77
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML1983/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898694 0.086082 0.361689 1.467920 0.870915 615.49 683.25 0.999
r(A<->C){all} 0.180770 0.021373 0.000075 0.472030 0.144800 103.76 104.55 1.012
r(A<->G){all} 0.142226 0.015735 0.000028 0.400863 0.103128 63.94 101.00 1.004
r(A<->T){all} 0.167270 0.019844 0.000029 0.449791 0.128177 51.89 67.80 1.010
r(C<->G){all} 0.174144 0.019011 0.000215 0.417438 0.145043 80.67 92.92 1.000
r(C<->T){all} 0.184752 0.021445 0.000120 0.474172 0.146481 65.42 95.40 1.026
r(G<->T){all} 0.150838 0.016860 0.000084 0.414844 0.114339 80.62 81.00 1.024
pi(A){all} 0.226269 0.000378 0.189796 0.265247 0.225448 662.48 706.74 0.999
pi(C){all} 0.253388 0.000403 0.215324 0.294003 0.252887 409.97 509.07 1.000
pi(G){all} 0.316322 0.000439 0.277179 0.360987 0.316030 516.77 633.88 0.999
pi(T){all} 0.204021 0.000342 0.172215 0.244315 0.203332 563.69 657.35 1.000
alpha{1,2} 0.415560 0.225606 0.000313 1.347253 0.247452 502.40 513.96 1.000
alpha{3} 0.502742 0.279839 0.000188 1.558430 0.322222 506.81 589.38 1.002
pinvar{all} 0.996416 0.000020 0.988722 0.999997 0.997785 594.39 659.25 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML1983/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 155
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 1 1 1 1 1 1
TTC 3 3 3 3 3 3 | TCC 0 0 0 0 0 0 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 3 3 3 3 3 3 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 4 4 4 4 4 4 | Pro CCT 2 2 2 2 2 2 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 2 2
CTC 2 2 2 2 2 2 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 4 4 4 4 4 4
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1
CTG 3 3 3 3 3 3 | CCG 4 4 4 4 4 4 | CAG 2 2 2 2 2 2 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 2 2 2 2 2 2 | Ser AGT 3 3 3 3 3 3
ATC 3 3 3 3 3 3 | ACC 4 4 4 4 4 4 | AAC 4 4 4 4 4 4 | AGC 1 1 1 1 1 1
ATA 4 4 4 4 4 4 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 1 1 1 1 1 1
Met ATG 2 2 2 2 2 2 | ACG 3 3 3 3 3 3 | AAG 7 7 7 7 7 7 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 2 2 2 2 2 2 | Asp GAT 3 3 3 3 3 3 | Gly GGT 6 6 6 6 6 6
GTC 5 5 5 5 5 5 | GCC 4 4 4 4 4 4 | GAC 2 2 2 2 2 2 | GGC 4 4 4 4 4 4
GTA 3 3 3 3 3 3 | GCA 6 6 6 6 6 6 | Glu GAA 2 2 2 2 2 2 | GGA 3 3 3 3 3 3
GTG 3 3 3 3 3 3 | GCG 4 4 4 4 4 4 | GAG 7 7 7 7 7 7 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908656_1_2114_MLBR_RS10045
position 1: T:0.14839 C:0.23226 A:0.24516 G:0.37419
position 2: T:0.26452 C:0.25806 A:0.23226 G:0.24516
position 3: T:0.20000 C:0.27097 A:0.20000 G:0.32903
Average T:0.20430 C:0.25376 A:0.22581 G:0.31613
#2: NC_002677_1_NP_302336_1_1208_ML1983
position 1: T:0.14839 C:0.23226 A:0.24516 G:0.37419
position 2: T:0.26452 C:0.25806 A:0.23226 G:0.24516
position 3: T:0.20000 C:0.27097 A:0.20000 G:0.32903
Average T:0.20430 C:0.25376 A:0.22581 G:0.31613
#3: NZ_LVXE01000003_1_WP_010908656_1_1301_A3216_RS02210
position 1: T:0.14839 C:0.23226 A:0.24516 G:0.37419
position 2: T:0.26452 C:0.25806 A:0.23226 G:0.24516
position 3: T:0.20000 C:0.27097 A:0.20000 G:0.32903
Average T:0.20430 C:0.25376 A:0.22581 G:0.31613
#4: NZ_LYPH01000033_1_WP_010908656_1_1380_A8144_RS06600
position 1: T:0.14839 C:0.23226 A:0.24516 G:0.37419
position 2: T:0.26452 C:0.25806 A:0.23226 G:0.24516
position 3: T:0.20000 C:0.27097 A:0.20000 G:0.32903
Average T:0.20430 C:0.25376 A:0.22581 G:0.31613
#5: NZ_CP029543_1_WP_010908656_1_2135_DIJ64_RS10870
position 1: T:0.14839 C:0.23226 A:0.24516 G:0.37419
position 2: T:0.26452 C:0.25806 A:0.23226 G:0.24516
position 3: T:0.20000 C:0.27097 A:0.20000 G:0.32903
Average T:0.20430 C:0.25376 A:0.22581 G:0.31613
#6: NZ_AP014567_1_WP_010908656_1_2195_JK2ML_RS11170
position 1: T:0.14839 C:0.23226 A:0.24516 G:0.37419
position 2: T:0.26452 C:0.25806 A:0.23226 G:0.24516
position 3: T:0.20000 C:0.27097 A:0.20000 G:0.32903
Average T:0.20430 C:0.25376 A:0.22581 G:0.31613
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 6
TTC 18 | TCC 0 | TAC 18 | TGC 0
Leu L TTA 18 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 18 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 24 | Pro P CCT 12 | His H CAT 0 | Arg R CGT 12
CTC 12 | CCC 6 | CAC 12 | CGC 24
CTA 6 | CCA 12 | Gln Q CAA 6 | CGA 6
CTG 18 | CCG 24 | CAG 12 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 12 | Ser S AGT 18
ATC 18 | ACC 24 | AAC 24 | AGC 6
ATA 24 | ACA 6 | Lys K AAA 6 | Arg R AGA 6
Met M ATG 12 | ACG 18 | AAG 42 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 12 | Asp D GAT 18 | Gly G GGT 36
GTC 30 | GCC 24 | GAC 12 | GGC 24
GTA 18 | GCA 36 | Glu E GAA 12 | GGA 18
GTG 18 | GCG 24 | GAG 42 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14839 C:0.23226 A:0.24516 G:0.37419
position 2: T:0.26452 C:0.25806 A:0.23226 G:0.24516
position 3: T:0.20000 C:0.27097 A:0.20000 G:0.32903
Average T:0.20430 C:0.25376 A:0.22581 G:0.31613
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -628.875203 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300004 1.300003
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908656_1_2114_MLBR_RS10045: 0.000004, NC_002677_1_NP_302336_1_1208_ML1983: 0.000004, NZ_LVXE01000003_1_WP_010908656_1_1301_A3216_RS02210: 0.000004, NZ_LYPH01000033_1_WP_010908656_1_1380_A8144_RS06600: 0.000004, NZ_CP029543_1_WP_010908656_1_2135_DIJ64_RS10870: 0.000004, NZ_AP014567_1_WP_010908656_1_2195_JK2ML_RS11170: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30000
omega (dN/dS) = 1.30000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 347.4 117.6 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 347.4 117.6 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 347.4 117.6 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 347.4 117.6 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 347.4 117.6 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 347.4 117.6 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -628.875204 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.421766 0.999990 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908656_1_2114_MLBR_RS10045: 0.000004, NC_002677_1_NP_302336_1_1208_ML1983: 0.000004, NZ_LVXE01000003_1_WP_010908656_1_1301_A3216_RS02210: 0.000004, NZ_LYPH01000033_1_WP_010908656_1_1380_A8144_RS06600: 0.000004, NZ_CP029543_1_WP_010908656_1_2135_DIJ64_RS10870: 0.000004, NZ_AP014567_1_WP_010908656_1_2195_JK2ML_RS11170: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.42177
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 345.6 119.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 345.6 119.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 345.6 119.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 345.6 119.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 345.6 119.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 345.6 119.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -628.875195 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 90.373956 0.000000 1.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908656_1_2114_MLBR_RS10045: 0.000004, NC_002677_1_NP_302336_1_1208_ML1983: 0.000004, NZ_LVXE01000003_1_WP_010908656_1_1301_A3216_RS02210: 0.000004, NZ_LYPH01000033_1_WP_010908656_1_1380_A8144_RS06600: 0.000004, NZ_CP029543_1_WP_010908656_1_2135_DIJ64_RS10870: 0.000004, NZ_AP014567_1_WP_010908656_1_2195_JK2ML_RS11170: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 90.37396
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 1.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 312.5 152.5 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 312.5 152.5 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 312.5 152.5 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 312.5 152.5 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 312.5 152.5 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 312.5 152.5 1.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908656_1_2114_MLBR_RS10045)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 12): -628.875198 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 90.374006 0.321592 0.488317 0.409091 1.494324 2.148320
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908656_1_2114_MLBR_RS10045: 0.000004, NC_002677_1_NP_302336_1_1208_ML1983: 0.000004, NZ_LVXE01000003_1_WP_010908656_1_1301_A3216_RS02210: 0.000004, NZ_LYPH01000033_1_WP_010908656_1_1380_A8144_RS06600: 0.000004, NZ_CP029543_1_WP_010908656_1_2135_DIJ64_RS10870: 0.000004, NZ_AP014567_1_WP_010908656_1_2195_JK2ML_RS11170: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 90.37401
MLEs of dN/dS (w) for site classes (K=3)
p: 0.32159 0.48832 0.19009
w: 0.40909 1.49432 2.14832
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 312.5 152.5 1.2696 0.0000 0.0000 0.0 0.0
7..2 0.000 312.5 152.5 1.2696 0.0000 0.0000 0.0 0.0
7..3 0.000 312.5 152.5 1.2696 0.0000 0.0000 0.0 0.0
7..4 0.000 312.5 152.5 1.2696 0.0000 0.0000 0.0 0.0
7..5 0.000 312.5 152.5 1.2696 0.0000 0.0000 0.0 0.0
7..6 0.000 312.5 152.5 1.2696 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908656_1_2114_MLBR_RS10045)
Pr(w>1) post mean +- SE for w
1 M 0.678 1.270
2 S 0.678 1.270
3 N 0.678 1.270
4 R 0.678 1.270
5 K 0.678 1.270
6 F 0.678 1.270
7 S 0.678 1.270
8 F 0.678 1.270
9 E 0.678 1.270
10 V 0.678 1.270
11 T 0.678 1.270
12 R 0.678 1.270
13 T 0.678 1.270
14 S 0.678 1.270
15 S 0.678 1.270
16 A 0.678 1.270
17 S 0.678 1.270
18 A 0.678 1.270
19 A 0.678 1.270
20 V 0.678 1.270
21 L 0.678 1.270
22 F 0.678 1.270
23 R 0.678 1.270
24 L 0.678 1.270
25 V 0.678 1.270
26 T 0.678 1.270
27 D 0.678 1.270
28 G 0.678 1.270
29 A 0.678 1.270
30 N 0.678 1.270
31 W 0.678 1.270
32 A 0.678 1.270
33 K 0.678 1.270
34 W 0.678 1.270
35 A 0.678 1.270
36 K 0.678 1.270
37 P 0.678 1.270
38 I 0.678 1.270
39 V 0.678 1.270
40 L 0.678 1.270
41 Q 0.678 1.270
42 S 0.678 1.270
43 S 0.678 1.270
44 W 0.678 1.270
45 A 0.678 1.270
46 R 0.678 1.270
47 L 0.678 1.270
48 G 0.678 1.270
49 D 0.678 1.270
50 L 0.678 1.270
51 R 0.678 1.270
52 P 0.678 1.270
53 G 0.678 1.270
54 G 0.678 1.270
55 I 0.678 1.270
56 G 0.678 1.270
57 A 0.678 1.270
58 V 0.678 1.270
59 R 0.678 1.270
60 K 0.678 1.270
61 I 0.678 1.270
62 G 0.678 1.270
63 I 0.678 1.270
64 W 0.678 1.270
65 P 0.678 1.270
66 I 0.678 1.270
67 L 0.678 1.270
68 V 0.678 1.270
69 R 0.678 1.270
70 E 0.678 1.270
71 E 0.678 1.270
72 T 0.678 1.270
73 V 0.678 1.270
74 E 0.678 1.270
75 Y 0.678 1.270
76 E 0.678 1.270
77 Q 0.678 1.270
78 D 0.678 1.270
79 R 0.678 1.270
80 R 0.678 1.270
81 H 0.678 1.270
82 L 0.678 1.270
83 Y 0.678 1.270
84 K 0.678 1.270
85 L 0.678 1.270
86 I 0.678 1.270
87 G 0.678 1.270
88 P 0.678 1.270
89 P 0.678 1.270
90 N 0.678 1.270
91 P 0.678 1.270
92 A 0.678 1.270
93 K 0.678 1.270
94 D 0.678 1.270
95 Y 0.678 1.270
96 L 0.678 1.270
97 G 0.678 1.270
98 E 0.678 1.270
99 V 0.678 1.270
100 L 0.678 1.270
101 L 0.678 1.270
102 A 0.678 1.270
103 P 0.678 1.270
104 N 0.678 1.270
105 A 0.678 1.270
106 A 0.678 1.270
107 G 0.678 1.270
108 G 0.678 1.270
109 T 0.678 1.270
110 N 0.678 1.270
111 I 0.678 1.270
112 H 0.678 1.270
113 W 0.678 1.270
114 S 0.678 1.270
115 G 0.678 1.270
116 S 0.678 1.270
117 F 0.678 1.270
118 T 0.678 1.270
119 E 0.678 1.270
120 N 0.678 1.270
121 I 0.678 1.270
122 P 0.678 1.270
123 G 0.678 1.270
124 T 0.678 1.270
125 G 0.678 1.270
126 P 0.678 1.270
127 V 0.678 1.270
128 M 0.678 1.270
129 R 0.678 1.270
130 A 0.678 1.270
131 A 0.678 1.270
132 L 0.678 1.270
133 K 0.678 1.270
134 G 0.678 1.270
135 A 0.678 1.270
136 V 0.678 1.270
137 R 0.678 1.270
138 C 0.678 1.270
139 L 0.678 1.270
140 T 0.678 1.270
141 V 0.678 1.270
142 R 0.678 1.270
143 L 0.678 1.270
144 V 0.678 1.270
145 K 0.678 1.270
146 T 0.678 1.270
147 A 0.678 1.270
148 E 0.678 1.270
149 R 0.678 1.270
150 E 0.678 1.270
151 S 0.678 1.270
152 D 0.678 1.270
153 G 0.678 1.270
154 V 0.678 1.270
155 Q 0.678 1.270
Note: more than one w>1. Check rst for details
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -628.875182 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 90.374007 0.980562 1.706076
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908656_1_2114_MLBR_RS10045: 0.000004, NC_002677_1_NP_302336_1_1208_ML1983: 0.000004, NZ_LVXE01000003_1_WP_010908656_1_1301_A3216_RS02210: 0.000004, NZ_LYPH01000033_1_WP_010908656_1_1380_A8144_RS06600: 0.000004, NZ_CP029543_1_WP_010908656_1_2135_DIJ64_RS10870: 0.000004, NZ_AP014567_1_WP_010908656_1_2195_JK2ML_RS11170: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 90.37401
Parameters in M7 (beta):
p = 0.98056 q = 1.70608
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.02781 0.08715 0.15030 0.21755 0.28963 0.36771 0.45370 0.55097 0.66677 0.82473
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 312.5 152.5 0.3636 0.0000 0.0000 0.0 0.0
7..2 0.000 312.5 152.5 0.3636 0.0000 0.0000 0.0 0.0
7..3 0.000 312.5 152.5 0.3636 0.0000 0.0000 0.0 0.0
7..4 0.000 312.5 152.5 0.3636 0.0000 0.0000 0.0 0.0
7..5 0.000 312.5 152.5 0.3636 0.0000 0.0000 0.0 0.0
7..6 0.000 312.5 152.5 0.3636 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -628.875190 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 90.373986 0.849226 1.214338 1.031589 1.222090
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908656_1_2114_MLBR_RS10045: 0.000004, NC_002677_1_NP_302336_1_1208_ML1983: 0.000004, NZ_LVXE01000003_1_WP_010908656_1_1301_A3216_RS02210: 0.000004, NZ_LYPH01000033_1_WP_010908656_1_1380_A8144_RS06600: 0.000004, NZ_CP029543_1_WP_010908656_1_2135_DIJ64_RS10870: 0.000004, NZ_AP014567_1_WP_010908656_1_2195_JK2ML_RS11170: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 90.37399
Parameters in M8 (beta&w>1):
p0 = 0.84923 p = 1.21434 q = 1.03159
(p1 = 0.15077) w = 1.22209
MLEs of dN/dS (w) for site classes (K=11)
p: 0.08492 0.08492 0.08492 0.08492 0.08492 0.08492 0.08492 0.08492 0.08492 0.08492 0.15077
w: 0.08252 0.20432 0.31175 0.41208 0.50786 0.60045 0.69070 0.77929 0.86688 0.95456 1.22209
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 312.5 152.5 0.6437 0.0000 0.0000 0.0 0.0
7..2 0.000 312.5 152.5 0.6437 0.0000 0.0000 0.0 0.0
7..3 0.000 312.5 152.5 0.6437 0.0000 0.0000 0.0 0.0
7..4 0.000 312.5 152.5 0.6437 0.0000 0.0000 0.0 0.0
7..5 0.000 312.5 152.5 0.6437 0.0000 0.0000 0.0 0.0
7..6 0.000 312.5 152.5 0.6437 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908656_1_2114_MLBR_RS10045)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908656_1_2114_MLBR_RS10045)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:11
Model 1: NearlyNeutral -628.875204 Model 2: PositiveSelection -628.875195 Model 0: one-ratio -628.875203 Model 3: discrete -628.875198 Model 7: beta -628.875182 Model 8: beta&w>1 -628.87519 Model 0 vs 1 1.9999999949504854E-6 Model 2 vs 1 1.8000000181928044E-5 Model 8 vs 7 1.5999999959603883E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
