--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:54:04 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1560/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -715.84 -719.30
2 -715.83 -720.03
--------------------------------------
TOTAL -715.84 -719.73
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893394 0.088449 0.386569 1.516179 0.862644 1501.00 1501.00 1.000
r(A<->C){all} 0.181146 0.022411 0.000041 0.483854 0.146560 138.78 144.54 1.002
r(A<->G){all} 0.161511 0.019370 0.000034 0.436455 0.124223 105.96 164.74 1.007
r(A<->T){all} 0.179589 0.021844 0.000004 0.482007 0.144309 223.10 253.98 1.002
r(C<->G){all} 0.158166 0.019112 0.000008 0.431719 0.119965 109.79 157.31 1.003
r(C<->T){all} 0.155464 0.019186 0.000041 0.441523 0.116433 304.99 321.97 1.004
r(G<->T){all} 0.164125 0.020480 0.000082 0.451791 0.124246 240.22 243.81 1.004
pi(A){all} 0.171203 0.000256 0.140950 0.203207 0.171003 1215.48 1272.38 1.000
pi(C){all} 0.364912 0.000427 0.323798 0.405559 0.364785 1250.05 1307.88 1.000
pi(G){all} 0.280372 0.000370 0.243153 0.318737 0.280288 851.45 982.57 1.000
pi(T){all} 0.183513 0.000281 0.151863 0.218042 0.183092 1228.78 1234.07 1.000
alpha{1,2} 0.418172 0.220739 0.000130 1.350798 0.258519 1171.83 1207.76 1.001
alpha{3} 0.453314 0.232650 0.000342 1.378326 0.288352 1424.16 1430.06 1.000
pinvar{all} 0.997063 0.000012 0.990334 0.999999 0.998182 1159.69 1237.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -694.738133
Model 2: PositiveSelection -694.738136
Model 0: one-ratio -694.738141
Model 7: beta -694.738135
Model 8: beta&w>1 -694.738136
Model 0 vs 1 1.600000018697756E-5
Model 2 vs 1 6.000000212225132E-6
Model 8 vs 7 1.9999999949504854E-6
>C1
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C2
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C3
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C4
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C5
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C6
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=178
C1 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C2 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C3 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C4 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C5 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C6 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
**************************************************
C1 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C2 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C3 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C4 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C5 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C6 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
**************************************************
C1 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C2 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C3 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C4 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C5 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C6 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
**************************************************
C1 YRAGLLASIAASCTASYTVALVSGGPSI
C2 YRAGLLASIAASCTASYTVALVSGGPSI
C3 YRAGLLASIAASCTASYTVALVSGGPSI
C4 YRAGLLASIAASCTASYTVALVSGGPSI
C5 YRAGLLASIAASCTASYTVALVSGGPSI
C6 YRAGLLASIAASCTASYTVALVSGGPSI
****************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5340]--->[5340]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.474 Mb, Max= 30.717 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C2 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C3 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C4 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C5 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C6 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
**************************************************
C1 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C2 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C3 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C4 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C5 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C6 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
**************************************************
C1 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C2 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C3 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C4 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C5 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C6 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
**************************************************
C1 YRAGLLASIAASCTASYTVALVSGGPSI
C2 YRAGLLASIAASCTASYTVALVSGGPSI
C3 YRAGLLASIAASCTASYTVALVSGGPSI
C4 YRAGLLASIAASCTASYTVALVSGGPSI
C5 YRAGLLASIAASCTASYTVALVSGGPSI
C6 YRAGLLASIAASCTASYTVALVSGGPSI
****************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
C2 ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
C3 ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
C4 ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
C5 ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
C6 ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
**************************************************
C1 CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
C2 CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
C3 CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
C4 CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
C5 CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
C6 CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
**************************************************
C1 GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
C2 GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
C3 GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
C4 GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
C5 GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
C6 GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
**************************************************
C1 GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
C2 GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
C3 GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
C4 GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
C5 GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
C6 GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
**************************************************
C1 CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
C2 CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
C3 CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
C4 CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
C5 CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
C6 CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
**************************************************
C1 GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
C2 GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
C3 GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
C4 GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
C5 GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
C6 GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
**************************************************
C1 AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
C2 AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
C3 AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
C4 AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
C5 AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
C6 AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
**************************************************
C1 TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
C2 TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
C3 TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
C4 TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
C5 TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
C6 TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
**************************************************
C1 TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
C2 TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
C3 TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
C4 TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
C5 TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
C6 TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
**************************************************
C1 TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
C2 TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
C3 TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
C4 TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
C5 TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
C6 TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
**************************************************
C1 CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
C2 CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
C3 CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
C4 CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
C5 CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
C6 CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
**********************************
>C1
ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
>C2
ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
>C3
ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
>C4
ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
>C5
ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
>C6
ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
>C1
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C2
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C3
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C4
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C5
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C6
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 534 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855968
Setting output file names to "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 87511073
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5671526488
Seed = 1198084536
Swapseed = 1579855968
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1195.117604 -- -24.965149
Chain 2 -- -1195.117421 -- -24.965149
Chain 3 -- -1195.117604 -- -24.965149
Chain 4 -- -1195.117535 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1195.117604 -- -24.965149
Chain 2 -- -1195.117604 -- -24.965149
Chain 3 -- -1195.117421 -- -24.965149
Chain 4 -- -1195.117604 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1195.118] (-1195.117) (-1195.118) (-1195.118) * [-1195.118] (-1195.118) (-1195.117) (-1195.118)
500 -- [-726.682] (-731.064) (-735.275) (-724.999) * [-719.405] (-739.856) (-726.592) (-739.584) -- 0:00:00
1000 -- [-725.391] (-724.000) (-738.277) (-725.578) * (-727.591) (-723.561) (-725.595) [-721.978] -- 0:00:00
1500 -- (-720.932) (-722.781) [-724.896] (-724.999) * (-720.707) (-725.652) (-727.467) [-728.757] -- 0:00:00
2000 -- (-723.598) [-727.161] (-720.572) (-723.151) * (-726.464) [-730.690] (-732.839) (-722.856) -- 0:00:00
2500 -- (-721.877) (-729.948) (-721.760) [-726.917] * (-719.984) (-728.561) (-729.550) [-727.208] -- 0:00:00
3000 -- (-727.218) (-731.171) [-724.879] (-726.077) * (-727.155) [-722.132] (-723.337) (-722.804) -- 0:05:32
3500 -- (-730.650) [-725.426] (-730.213) (-728.406) * (-729.902) (-718.826) [-723.192] (-722.802) -- 0:04:44
4000 -- (-728.969) (-727.037) [-724.281] (-728.158) * (-725.556) (-725.838) (-725.479) [-723.332] -- 0:04:09
4500 -- (-727.303) (-723.455) (-729.375) [-723.621] * (-730.510) [-725.880] (-734.272) (-724.806) -- 0:03:41
5000 -- (-731.783) (-724.844) (-735.891) [-720.396] * (-733.743) [-723.616] (-726.951) (-729.804) -- 0:03:19
Average standard deviation of split frequencies: 0.102479
5500 -- (-720.356) (-723.616) (-718.167) [-725.978] * (-733.428) (-723.563) [-727.891] (-731.647) -- 0:03:00
6000 -- (-726.334) (-733.203) (-716.059) [-719.470] * (-724.382) (-734.081) (-726.795) [-724.184] -- 0:02:45
6500 -- (-727.614) (-733.508) [-714.622] (-729.342) * (-720.986) [-724.840] (-730.753) (-723.730) -- 0:02:32
7000 -- (-726.128) [-725.161] (-716.534) (-724.161) * (-725.101) (-726.088) (-727.051) [-726.024] -- 0:02:21
7500 -- (-722.647) (-727.170) [-717.826] (-725.362) * (-723.303) [-726.671] (-727.356) (-728.922) -- 0:02:12
8000 -- [-725.866] (-729.989) (-718.608) (-723.724) * (-727.748) (-742.818) (-726.075) [-720.424] -- 0:02:04
8500 -- (-728.647) [-723.241] (-716.287) (-725.997) * (-725.468) (-737.395) (-721.825) [-726.414] -- 0:01:56
9000 -- [-729.638] (-731.148) (-718.256) (-723.065) * (-722.591) [-727.170] (-726.525) (-722.720) -- 0:01:50
9500 -- [-722.021] (-729.922) (-719.240) (-731.588) * [-724.239] (-738.415) (-721.853) (-733.264) -- 0:01:44
10000 -- (-727.787) (-728.712) (-723.415) [-728.857] * [-721.766] (-725.815) (-727.586) (-728.942) -- 0:01:39
Average standard deviation of split frequencies: 0.081023
10500 -- (-727.490) [-723.193] (-723.177) (-728.204) * [-722.114] (-726.139) (-728.742) (-721.492) -- 0:01:34
11000 -- (-727.650) [-719.824] (-717.174) (-724.272) * (-726.592) (-721.312) (-732.142) [-724.764] -- 0:01:29
11500 -- [-722.463] (-721.159) (-716.276) (-724.125) * [-722.550] (-721.626) (-725.045) (-727.144) -- 0:01:25
12000 -- (-723.646) [-725.803] (-716.920) (-726.167) * (-729.101) (-728.333) [-721.491] (-719.894) -- 0:01:22
12500 -- (-732.885) (-727.001) [-716.337] (-722.028) * (-726.919) (-726.485) [-721.763] (-726.902) -- 0:01:19
13000 -- (-722.361) [-734.211] (-717.056) (-729.720) * (-720.441) (-723.237) (-732.627) [-730.583] -- 0:01:15
13500 -- (-727.039) (-724.612) (-714.949) [-723.867] * (-724.658) (-725.643) [-719.701] (-723.217) -- 0:01:13
14000 -- (-729.922) [-727.667] (-716.384) (-724.530) * (-723.300) (-730.286) (-727.809) [-727.585] -- 0:01:10
14500 -- [-727.116] (-722.765) (-715.443) (-726.169) * (-726.888) [-725.704] (-723.351) (-728.900) -- 0:01:07
15000 -- (-720.099) [-724.929] (-715.254) (-724.248) * [-720.072] (-724.383) (-729.905) (-721.594) -- 0:01:05
Average standard deviation of split frequencies: 0.090025
15500 -- (-720.536) (-721.379) [-714.954] (-723.644) * (-723.281) (-725.659) [-726.069] (-729.324) -- 0:01:03
16000 -- [-720.922] (-722.370) (-716.415) (-722.215) * [-720.481] (-720.719) (-731.464) (-719.816) -- 0:01:01
16500 -- [-719.240] (-727.848) (-715.175) (-724.940) * [-725.862] (-720.860) (-722.044) (-727.012) -- 0:00:59
17000 -- (-716.341) [-732.479] (-715.189) (-732.748) * [-721.220] (-725.867) (-726.793) (-731.926) -- 0:00:57
17500 -- (-720.261) (-719.658) (-720.055) [-720.544] * [-725.695] (-723.761) (-735.167) (-726.050) -- 0:00:56
18000 -- (-716.042) (-722.915) [-717.171] (-730.463) * [-720.192] (-722.963) (-724.230) (-718.464) -- 0:00:54
18500 -- (-716.166) (-725.512) [-715.681] (-735.266) * (-728.155) (-725.560) (-735.162) [-724.597] -- 0:00:53
19000 -- (-714.461) [-723.898] (-716.285) (-727.387) * [-725.565] (-733.637) (-731.943) (-725.865) -- 0:00:51
19500 -- (-715.334) (-721.162) [-717.266] (-723.943) * (-727.095) (-729.184) [-724.747] (-726.608) -- 0:01:40
20000 -- (-718.192) [-728.058] (-715.564) (-721.204) * [-734.864] (-727.678) (-728.880) (-736.128) -- 0:01:38
Average standard deviation of split frequencies: 0.072992
20500 -- (-714.539) (-736.805) [-715.869] (-723.871) * (-730.204) (-739.452) [-723.916] (-722.815) -- 0:01:35
21000 -- (-714.596) (-722.433) [-716.757] (-729.595) * (-727.153) (-719.620) [-722.860] (-737.659) -- 0:01:33
21500 -- [-717.741] (-723.480) (-718.918) (-722.523) * (-730.841) (-715.776) (-720.914) [-719.598] -- 0:01:31
22000 -- (-717.942) [-721.658] (-720.101) (-723.464) * [-728.354] (-718.182) (-722.123) (-720.852) -- 0:01:28
22500 -- (-717.740) (-722.359) (-721.442) [-725.411] * [-722.628] (-717.100) (-728.105) (-718.077) -- 0:01:26
23000 -- (-719.784) (-725.274) [-719.778] (-722.270) * [-721.257] (-716.119) (-723.613) (-719.006) -- 0:01:24
23500 -- (-716.912) (-729.996) [-714.579] (-729.464) * [-722.968] (-717.023) (-726.450) (-717.351) -- 0:01:23
24000 -- [-717.472] (-721.217) (-718.040) (-732.297) * (-727.910) (-718.851) (-726.521) [-718.009] -- 0:01:21
24500 -- (-718.258) (-722.357) (-717.365) [-725.508] * (-724.346) (-719.210) [-720.074] (-715.674) -- 0:01:19
25000 -- (-716.613) (-727.971) (-716.785) [-727.905] * (-726.263) (-717.603) [-721.117] (-718.417) -- 0:01:18
Average standard deviation of split frequencies: 0.062552
25500 -- (-717.015) (-725.826) (-715.094) [-722.243] * [-722.323] (-716.490) (-723.393) (-714.981) -- 0:01:16
26000 -- [-718.157] (-732.366) (-715.187) (-726.317) * [-726.943] (-716.707) (-722.499) (-717.729) -- 0:01:14
26500 -- (-716.848) (-725.996) [-716.848] (-718.494) * (-728.312) [-716.149] (-732.735) (-720.775) -- 0:01:13
27000 -- (-719.146) [-723.234] (-717.774) (-725.293) * [-725.429] (-715.807) (-731.803) (-715.633) -- 0:01:12
27500 -- (-716.187) (-724.814) (-715.383) [-723.083] * (-727.647) [-717.279] (-724.485) (-716.655) -- 0:01:10
28000 -- (-718.918) (-730.210) [-715.839] (-728.973) * (-724.884) [-714.337] (-728.303) (-715.743) -- 0:01:09
28500 -- (-717.509) (-730.860) (-715.403) [-721.889] * (-730.225) (-716.928) [-726.316] (-715.320) -- 0:01:08
29000 -- (-717.923) (-727.560) (-714.513) [-723.530] * (-724.321) (-717.305) [-725.936] (-715.311) -- 0:01:06
29500 -- (-716.422) (-723.457) [-716.511] (-720.345) * (-744.379) (-717.090) (-723.393) [-715.302] -- 0:01:05
30000 -- [-716.766] (-718.717) (-714.417) (-724.839) * (-717.625) [-718.948] (-715.720) (-715.345) -- 0:01:04
Average standard deviation of split frequencies: 0.047653
30500 -- [-716.351] (-716.066) (-717.343) (-731.782) * (-719.996) (-718.343) [-716.562] (-717.656) -- 0:01:03
31000 -- (-718.436) (-716.431) (-715.605) [-724.063] * (-721.753) (-719.094) (-715.787) [-715.619] -- 0:01:02
31500 -- (-716.926) (-717.783) [-717.604] (-725.789) * [-715.644] (-718.807) (-720.278) (-716.774) -- 0:01:01
32000 -- [-716.061] (-715.037) (-719.481) (-725.684) * (-719.914) [-721.664] (-718.039) (-716.877) -- 0:01:00
32500 -- [-716.320] (-717.448) (-715.775) (-721.498) * [-717.823] (-718.522) (-717.422) (-715.555) -- 0:00:59
33000 -- [-717.642] (-716.979) (-715.943) (-728.697) * [-716.198] (-716.581) (-716.789) (-715.102) -- 0:00:58
33500 -- (-722.315) [-716.968] (-716.674) (-731.270) * (-724.902) [-716.145] (-719.011) (-717.900) -- 0:00:57
34000 -- [-715.272] (-717.829) (-718.442) (-728.158) * [-718.977] (-715.456) (-716.461) (-715.083) -- 0:00:56
34500 -- (-715.574) (-716.002) [-716.555] (-721.671) * [-716.419] (-717.250) (-716.393) (-719.913) -- 0:00:55
35000 -- (-715.655) (-716.045) (-718.469) [-725.429] * (-716.923) (-716.731) (-715.481) [-715.579] -- 0:00:55
Average standard deviation of split frequencies: 0.026878
35500 -- (-715.252) [-716.575] (-716.490) (-721.446) * (-719.997) (-717.321) [-715.878] (-714.963) -- 0:00:54
36000 -- (-714.562) (-715.878) [-716.608] (-721.413) * (-721.128) (-717.520) (-716.237) [-715.111] -- 0:01:20
36500 -- [-716.027] (-714.680) (-714.741) (-721.169) * [-715.863] (-716.390) (-715.271) (-714.436) -- 0:01:19
37000 -- (-716.573) (-714.640) [-718.620] (-729.252) * (-722.426) (-721.646) [-718.406] (-716.706) -- 0:01:18
37500 -- (-717.530) (-714.954) (-717.907) [-720.378] * [-715.567] (-720.844) (-717.854) (-718.682) -- 0:01:17
38000 -- (-719.833) (-717.196) [-717.078] (-727.443) * (-715.964) (-714.924) (-717.856) [-717.697] -- 0:01:15
38500 -- (-720.873) (-718.563) (-717.365) [-720.970] * (-718.608) [-715.845] (-716.425) (-715.964) -- 0:01:14
39000 -- (-715.726) [-716.099] (-721.441) (-730.464) * (-716.833) (-717.376) (-719.494) [-715.798] -- 0:01:13
39500 -- [-717.722] (-714.644) (-717.962) (-723.763) * (-715.446) (-716.896) (-715.822) [-715.141] -- 0:01:12
40000 -- [-714.891] (-714.874) (-716.129) (-724.223) * (-716.170) (-720.487) [-714.671] (-715.385) -- 0:01:12
Average standard deviation of split frequencies: 0.029895
40500 -- [-715.682] (-715.841) (-716.310) (-732.578) * (-716.900) (-717.918) (-714.843) [-715.777] -- 0:01:11
41000 -- [-715.016] (-716.446) (-716.064) (-723.199) * (-717.454) (-723.717) [-715.983] (-714.527) -- 0:01:10
41500 -- (-715.737) [-716.612] (-717.791) (-731.319) * (-715.011) (-716.980) [-716.225] (-715.184) -- 0:01:09
42000 -- (-716.766) (-719.059) [-716.609] (-733.132) * (-717.641) (-716.960) (-716.749) [-714.760] -- 0:01:08
42500 -- [-715.832] (-717.640) (-718.468) (-735.240) * [-718.808] (-715.957) (-715.186) (-716.181) -- 0:01:07
43000 -- (-716.932) (-716.941) [-716.657] (-716.201) * (-718.270) (-717.544) [-716.292] (-715.283) -- 0:01:06
43500 -- (-716.466) (-715.895) [-723.523] (-717.271) * [-715.823] (-715.820) (-715.684) (-715.661) -- 0:01:05
44000 -- (-721.444) [-714.869] (-722.234) (-719.911) * (-715.375) (-715.309) (-717.304) [-714.995] -- 0:01:05
44500 -- (-719.884) (-719.406) [-717.555] (-717.452) * [-716.180] (-715.082) (-722.377) (-715.090) -- 0:01:04
45000 -- (-715.402) (-714.490) (-717.063) [-717.176] * (-717.229) (-717.808) (-719.602) [-715.425] -- 0:01:03
Average standard deviation of split frequencies: 0.030256
45500 -- (-715.777) (-716.145) [-718.594] (-720.371) * (-715.711) [-716.612] (-717.844) (-717.761) -- 0:01:02
46000 -- (-714.545) [-719.574] (-716.908) (-715.118) * [-717.275] (-718.604) (-714.343) (-718.448) -- 0:01:02
46500 -- [-715.979] (-718.898) (-715.335) (-715.360) * (-716.873) (-718.384) [-716.302] (-715.962) -- 0:01:01
47000 -- (-716.022) [-715.859] (-716.590) (-715.705) * (-715.411) (-715.869) (-715.599) [-717.274] -- 0:01:00
47500 -- (-725.049) (-716.916) [-718.265] (-714.730) * [-716.155] (-714.783) (-719.948) (-718.490) -- 0:01:00
48000 -- (-722.195) (-716.497) [-717.136] (-715.646) * (-717.283) [-716.208] (-719.506) (-717.098) -- 0:00:59
48500 -- (-718.624) (-720.568) [-716.785] (-716.112) * (-717.271) (-716.550) (-715.150) [-715.602] -- 0:00:58
49000 -- (-715.831) (-721.099) [-718.498] (-720.923) * (-717.425) [-716.548] (-718.019) (-715.864) -- 0:00:58
49500 -- (-715.494) (-717.102) [-720.273] (-722.704) * (-716.114) [-717.991] (-721.476) (-718.097) -- 0:00:57
50000 -- (-715.985) [-720.927] (-716.346) (-720.286) * [-715.291] (-715.540) (-718.700) (-718.246) -- 0:00:57
Average standard deviation of split frequencies: 0.032809
50500 -- [-716.520] (-716.051) (-718.105) (-722.327) * (-715.628) [-716.713] (-716.479) (-716.346) -- 0:00:56
51000 -- (-716.274) (-716.594) [-714.998] (-720.674) * (-716.203) (-715.666) [-715.578] (-716.575) -- 0:00:55
51500 -- (-717.848) (-722.059) [-716.708] (-717.455) * (-717.272) (-715.668) [-715.606] (-716.860) -- 0:00:55
52000 -- [-716.917] (-721.494) (-717.226) (-720.701) * (-715.765) (-716.096) (-714.715) [-714.823] -- 0:00:54
52500 -- (-715.418) (-716.430) (-715.044) [-718.167] * (-718.147) [-716.265] (-714.410) (-715.384) -- 0:00:54
53000 -- (-721.618) (-716.289) (-721.360) [-714.823] * (-715.966) [-714.697] (-714.930) (-715.892) -- 0:01:11
53500 -- [-715.304] (-715.921) (-715.422) (-718.901) * [-716.192] (-716.881) (-715.535) (-717.460) -- 0:01:10
54000 -- [-719.725] (-715.489) (-715.292) (-718.611) * (-718.013) (-717.194) [-715.509] (-716.316) -- 0:01:10
54500 -- (-717.176) (-714.738) [-714.359] (-714.942) * (-714.805) [-716.912] (-715.296) (-718.213) -- 0:01:09
55000 -- (-716.335) (-716.587) [-714.777] (-718.674) * (-715.165) [-715.706] (-715.806) (-715.833) -- 0:01:08
Average standard deviation of split frequencies: 0.027358
55500 -- (-716.550) [-718.152] (-718.910) (-715.945) * (-720.994) (-715.996) (-715.675) [-715.363] -- 0:01:08
56000 -- (-714.674) (-715.644) (-715.585) [-715.200] * (-721.088) (-719.978) (-714.804) [-716.867] -- 0:01:07
56500 -- (-714.841) [-715.396] (-716.499) (-715.830) * (-718.920) (-719.536) (-715.289) [-717.036] -- 0:01:06
57000 -- (-723.875) [-720.456] (-714.667) (-715.949) * (-716.264) [-715.366] (-715.380) (-717.121) -- 0:01:06
57500 -- (-718.480) (-716.661) (-715.132) [-716.346] * (-715.803) [-717.723] (-717.222) (-716.973) -- 0:01:05
58000 -- (-719.565) (-715.578) [-714.358] (-720.344) * [-716.801] (-716.322) (-715.028) (-716.217) -- 0:01:04
58500 -- (-720.991) (-716.186) [-715.681] (-719.550) * (-714.876) [-717.093] (-715.077) (-717.474) -- 0:01:04
59000 -- [-717.111] (-717.264) (-715.048) (-718.464) * (-724.422) (-716.110) [-715.438] (-715.892) -- 0:01:03
59500 -- (-714.984) (-718.963) [-717.755] (-720.214) * (-717.943) [-715.065] (-715.390) (-715.199) -- 0:01:03
60000 -- [-714.950] (-722.346) (-721.458) (-714.229) * (-717.591) [-715.058] (-716.843) (-716.659) -- 0:01:02
Average standard deviation of split frequencies: 0.030693
60500 -- (-716.478) [-717.361] (-716.504) (-714.624) * [-715.362] (-716.421) (-717.091) (-717.483) -- 0:01:02
61000 -- (-716.157) (-716.898) (-714.552) [-716.001] * (-715.996) (-715.689) [-715.370] (-715.157) -- 0:01:01
61500 -- [-717.404] (-715.481) (-716.132) (-715.728) * (-715.093) (-715.824) (-718.837) [-715.142] -- 0:01:01
62000 -- (-714.822) [-716.962] (-715.029) (-717.224) * (-717.146) (-714.718) (-721.935) [-715.764] -- 0:01:00
62500 -- [-715.952] (-719.628) (-716.552) (-717.197) * [-719.184] (-715.414) (-722.211) (-716.276) -- 0:01:00
63000 -- (-715.230) (-717.693) (-717.792) [-717.545] * (-716.452) (-717.765) (-721.443) [-717.007] -- 0:00:59
63500 -- (-716.892) (-716.455) (-717.957) [-717.318] * (-715.552) [-715.781] (-720.216) (-718.115) -- 0:00:58
64000 -- (-715.541) [-716.050] (-717.362) (-716.858) * (-715.772) (-717.679) [-714.601] (-715.584) -- 0:00:58
64500 -- (-715.365) (-714.672) [-715.305] (-717.467) * (-717.739) (-717.836) [-716.457] (-715.780) -- 0:00:58
65000 -- (-716.199) (-714.676) (-717.108) [-716.499] * (-718.337) (-716.369) [-715.959] (-716.303) -- 0:00:57
Average standard deviation of split frequencies: 0.029698
65500 -- (-715.677) [-715.750] (-715.927) (-716.819) * (-716.691) [-717.332] (-714.615) (-716.816) -- 0:00:57
66000 -- (-715.300) (-718.398) [-715.847] (-717.215) * (-714.519) (-715.178) (-716.185) [-714.382] -- 0:00:56
66500 -- (-715.814) [-715.430] (-716.547) (-715.197) * (-715.740) (-714.748) [-720.566] (-714.658) -- 0:00:56
67000 -- [-714.753] (-717.968) (-717.951) (-717.367) * (-715.614) (-715.741) (-714.518) [-717.683] -- 0:00:55
67500 -- (-715.895) (-720.199) (-716.774) [-714.625] * (-715.160) (-714.459) (-716.260) [-718.280] -- 0:00:55
68000 -- (-717.115) (-718.110) (-715.340) [-716.311] * (-715.665) [-714.259] (-715.649) (-720.798) -- 0:00:54
68500 -- [-715.174] (-715.190) (-717.208) (-715.750) * (-718.369) [-716.103] (-715.826) (-717.090) -- 0:00:54
69000 -- (-714.909) (-716.712) (-717.548) [-714.447] * (-715.144) (-715.853) (-714.737) [-715.972] -- 0:00:53
69500 -- (-715.611) (-716.526) (-715.857) [-715.590] * [-714.739] (-719.668) (-716.319) (-715.555) -- 0:01:06
70000 -- (-715.150) (-715.598) (-716.383) [-716.725] * (-714.677) [-715.585] (-716.446) (-716.083) -- 0:01:06
Average standard deviation of split frequencies: 0.028907
70500 -- (-721.187) [-719.642] (-716.062) (-718.907) * (-714.994) (-718.034) [-714.755] (-717.913) -- 0:01:05
71000 -- (-715.949) [-715.374] (-718.237) (-714.871) * (-715.342) (-717.942) [-715.364] (-716.611) -- 0:01:05
71500 -- (-715.565) (-714.998) (-715.696) [-715.051] * (-717.587) (-715.842) [-714.454] (-715.496) -- 0:01:04
72000 -- (-715.953) (-718.952) [-717.422] (-715.541) * [-717.218] (-715.025) (-715.529) (-717.815) -- 0:01:04
72500 -- (-717.470) (-716.695) (-714.930) [-715.060] * [-716.910] (-716.079) (-717.253) (-715.926) -- 0:01:03
73000 -- (-717.800) (-717.291) (-716.440) [-714.564] * [-717.870] (-718.312) (-715.981) (-717.374) -- 0:01:03
73500 -- (-718.832) (-716.120) (-716.012) [-715.248] * (-717.725) (-717.841) [-717.019] (-724.460) -- 0:01:03
74000 -- [-717.865] (-716.994) (-716.298) (-715.625) * (-717.582) (-717.055) [-717.967] (-716.364) -- 0:01:02
74500 -- (-717.891) (-717.814) [-715.934] (-717.994) * (-716.068) [-714.572] (-716.072) (-718.208) -- 0:01:02
75000 -- (-719.530) [-717.667] (-719.585) (-714.842) * (-724.531) (-714.461) [-715.839] (-714.783) -- 0:01:01
Average standard deviation of split frequencies: 0.028946
75500 -- (-716.268) [-716.870] (-716.385) (-715.330) * (-716.585) (-715.260) (-722.146) [-714.989] -- 0:01:01
76000 -- (-716.218) [-720.060] (-717.424) (-718.352) * (-718.891) (-714.121) (-714.910) [-715.072] -- 0:01:00
76500 -- (-716.406) (-718.122) (-716.541) [-716.232] * (-718.315) (-714.290) (-715.176) [-715.471] -- 0:01:00
77000 -- [-717.251] (-716.246) (-717.049) (-717.778) * (-719.536) (-714.822) (-715.430) [-717.798] -- 0:00:59
77500 -- [-716.016] (-716.922) (-716.586) (-717.193) * (-720.073) (-715.167) [-715.791] (-718.291) -- 0:00:59
78000 -- (-714.600) [-714.949] (-714.523) (-715.608) * (-718.035) [-714.536] (-715.727) (-716.182) -- 0:00:59
78500 -- (-715.762) (-716.443) [-715.381] (-715.708) * (-718.215) (-714.332) [-719.149] (-716.694) -- 0:00:58
79000 -- (-715.903) [-717.384] (-716.925) (-716.755) * (-717.447) (-715.072) (-719.531) [-715.003] -- 0:00:58
79500 -- (-715.706) (-716.890) [-714.636] (-717.412) * (-716.586) (-719.669) [-717.478] (-715.129) -- 0:00:57
80000 -- (-715.267) (-715.315) [-718.664] (-719.769) * (-717.438) [-716.141] (-715.240) (-717.056) -- 0:00:57
Average standard deviation of split frequencies: 0.028927
80500 -- (-716.940) [-714.980] (-718.792) (-717.697) * (-714.861) (-716.035) [-716.555] (-716.492) -- 0:00:57
81000 -- (-718.483) (-715.475) (-714.876) [-714.980] * (-715.106) [-716.152] (-718.098) (-727.920) -- 0:00:56
81500 -- (-715.571) (-726.064) [-717.020] (-715.672) * (-716.426) (-716.310) (-719.279) [-721.789] -- 0:00:56
82000 -- [-720.444] (-716.818) (-717.286) (-714.726) * (-716.210) (-717.448) [-717.488] (-719.743) -- 0:00:55
82500 -- (-718.953) (-716.545) (-717.553) [-715.509] * (-714.928) (-718.089) (-720.930) [-716.981] -- 0:00:55
83000 -- [-718.062] (-716.675) (-716.260) (-716.426) * (-715.560) (-715.087) (-716.317) [-715.088] -- 0:00:55
83500 -- (-717.680) (-721.977) (-721.181) [-715.171] * (-715.918) (-717.567) [-716.382] (-715.516) -- 0:00:54
84000 -- (-716.773) [-717.613] (-715.868) (-718.104) * [-716.055] (-716.662) (-716.071) (-716.622) -- 0:00:54
84500 -- (-721.455) [-716.182] (-715.235) (-717.738) * (-718.058) (-717.275) [-714.730] (-714.700) -- 0:00:54
85000 -- (-723.587) [-716.184] (-715.030) (-716.033) * [-716.073] (-719.005) (-715.940) (-714.829) -- 0:00:53
Average standard deviation of split frequencies: 0.028778
85500 -- [-716.512] (-717.192) (-717.167) (-715.970) * (-715.242) (-717.908) (-717.931) [-716.996] -- 0:00:53
86000 -- (-715.140) (-715.730) (-719.011) [-717.279] * (-724.188) (-717.730) [-715.929] (-716.985) -- 0:01:03
86500 -- (-716.981) [-716.123] (-717.174) (-716.266) * [-719.676] (-723.457) (-722.135) (-716.375) -- 0:01:03
87000 -- (-717.310) (-715.513) [-715.570] (-715.903) * (-717.409) [-717.624] (-717.562) (-715.088) -- 0:01:02
87500 -- (-716.883) [-716.539] (-716.365) (-715.224) * (-716.235) (-717.860) [-716.352] (-714.882) -- 0:01:02
88000 -- (-715.857) [-716.170] (-717.838) (-716.541) * (-715.794) [-715.040] (-718.026) (-719.036) -- 0:01:02
88500 -- [-717.647] (-718.406) (-718.693) (-717.745) * (-715.721) (-716.271) [-714.735] (-716.665) -- 0:01:01
89000 -- (-718.753) [-716.666] (-716.933) (-724.797) * [-717.961] (-716.596) (-717.934) (-716.214) -- 0:01:01
89500 -- [-718.104] (-717.833) (-719.680) (-716.452) * [-715.222] (-717.897) (-721.479) (-716.619) -- 0:01:01
90000 -- (-717.512) [-715.646] (-718.367) (-716.473) * (-717.186) [-714.804] (-715.574) (-718.294) -- 0:01:00
Average standard deviation of split frequencies: 0.023273
90500 -- (-717.107) (-719.690) [-717.789] (-718.457) * (-720.002) (-715.247) (-716.408) [-715.036] -- 0:01:00
91000 -- (-715.654) [-716.366] (-717.529) (-717.737) * (-724.176) (-716.358) (-716.630) [-715.540] -- 0:00:59
91500 -- (-721.836) [-720.163] (-717.678) (-719.398) * (-718.161) (-716.181) (-716.341) [-716.016] -- 0:00:59
92000 -- (-718.362) [-715.778] (-715.385) (-715.730) * (-714.877) (-716.947) [-716.998] (-715.456) -- 0:00:59
92500 -- (-717.167) (-714.822) [-717.879] (-716.535) * (-716.346) [-716.572] (-716.409) (-716.242) -- 0:00:58
93000 -- (-721.000) [-714.470] (-719.477) (-721.661) * [-716.016] (-719.512) (-717.563) (-715.079) -- 0:00:58
93500 -- (-715.077) [-715.501] (-718.904) (-715.243) * (-717.998) (-716.700) (-716.933) [-715.619] -- 0:00:58
94000 -- [-716.237] (-716.405) (-717.406) (-718.090) * (-714.961) (-718.239) [-716.399] (-717.906) -- 0:00:57
94500 -- (-716.246) (-717.390) (-714.673) [-715.586] * (-719.294) (-715.858) (-716.144) [-718.035] -- 0:00:57
95000 -- (-719.052) (-715.640) (-722.679) [-715.736] * (-721.648) (-719.832) (-716.454) [-721.351] -- 0:00:57
Average standard deviation of split frequencies: 0.026271
95500 -- (-715.164) (-715.844) (-716.092) [-721.202] * (-716.553) (-718.506) [-716.537] (-714.956) -- 0:00:56
96000 -- (-726.329) [-715.917] (-717.009) (-715.817) * (-721.381) [-717.682] (-716.817) (-717.739) -- 0:00:56
96500 -- (-724.490) (-719.164) [-716.609] (-717.673) * (-720.062) (-717.282) [-715.134] (-720.311) -- 0:00:56
97000 -- (-716.242) (-716.519) [-715.834] (-718.061) * (-715.268) (-716.296) [-714.827] (-717.724) -- 0:00:55
97500 -- (-717.745) (-716.885) (-717.129) [-718.621] * (-714.762) [-717.800] (-716.212) (-718.801) -- 0:00:55
98000 -- (-719.953) [-716.175] (-717.003) (-716.852) * [-718.500] (-718.912) (-717.042) (-717.696) -- 0:00:55
98500 -- (-717.559) [-715.921] (-717.080) (-717.106) * (-714.573) (-716.309) (-718.377) [-718.406] -- 0:00:54
99000 -- (-715.014) (-717.098) (-721.720) [-716.062] * [-714.230] (-715.743) (-721.203) (-719.940) -- 0:00:54
99500 -- (-715.069) [-715.609] (-715.208) (-716.957) * [-714.879] (-715.321) (-717.092) (-717.180) -- 0:00:54
100000 -- (-717.094) (-718.529) [-714.373] (-716.923) * (-715.785) (-715.571) (-716.898) [-714.906] -- 0:00:54
Average standard deviation of split frequencies: 0.026372
100500 -- [-716.607] (-720.792) (-716.900) (-716.957) * (-716.209) [-715.014] (-717.323) (-715.249) -- 0:00:53
101000 -- [-717.662] (-717.459) (-716.274) (-717.417) * (-717.203) [-715.338] (-715.584) (-716.541) -- 0:00:53
101500 -- (-716.619) (-718.630) [-718.028] (-716.521) * (-716.659) (-719.904) [-714.655] (-717.119) -- 0:00:53
102000 -- (-716.617) (-717.689) [-717.730] (-715.900) * (-717.626) (-716.227) [-716.317] (-714.607) -- 0:00:52
102500 -- (-718.630) (-718.374) (-718.811) [-715.410] * (-719.547) (-716.399) (-721.449) [-714.479] -- 0:00:52
103000 -- (-718.265) [-721.294] (-719.964) (-717.960) * [-718.384] (-720.564) (-720.138) (-715.722) -- 0:01:00
103500 -- [-716.591] (-715.699) (-721.979) (-715.238) * (-718.437) [-719.530] (-717.101) (-715.667) -- 0:01:00
104000 -- [-717.157] (-716.394) (-718.247) (-715.369) * (-715.250) (-717.596) [-717.084] (-714.368) -- 0:01:00
104500 -- (-721.116) (-714.734) (-716.632) [-716.158] * (-715.140) (-717.196) [-715.931] (-715.120) -- 0:00:59
105000 -- (-717.368) [-714.822] (-714.864) (-716.320) * (-718.802) (-716.702) (-714.797) [-715.284] -- 0:00:59
Average standard deviation of split frequencies: 0.025045
105500 -- (-714.983) (-715.750) (-724.282) [-716.711] * (-717.391) (-717.041) (-714.574) [-716.523] -- 0:00:59
106000 -- (-715.414) [-714.807] (-716.206) (-715.591) * (-716.631) (-719.720) (-720.782) [-716.177] -- 0:00:59
106500 -- [-714.932] (-716.199) (-717.305) (-717.290) * (-715.291) [-715.085] (-717.577) (-716.738) -- 0:00:58
107000 -- (-716.301) (-716.135) (-718.354) [-716.998] * (-720.074) (-718.095) [-715.018] (-717.073) -- 0:00:58
107500 -- (-714.598) [-719.983] (-718.430) (-715.477) * (-717.834) (-715.694) [-717.038] (-715.401) -- 0:00:58
108000 -- (-720.394) (-715.574) [-717.570] (-715.276) * (-716.478) (-716.414) (-719.058) [-714.328] -- 0:00:57
108500 -- (-716.360) [-717.942] (-717.213) (-716.951) * (-716.403) (-717.589) (-716.633) [-714.558] -- 0:00:57
109000 -- [-715.523] (-716.277) (-718.781) (-715.084) * (-716.537) [-715.886] (-721.144) (-716.339) -- 0:00:57
109500 -- (-718.622) (-716.990) (-715.312) [-715.876] * [-714.609] (-715.824) (-719.783) (-716.774) -- 0:00:56
110000 -- [-715.029] (-717.594) (-714.687) (-716.887) * (-715.596) (-716.301) [-715.929] (-715.911) -- 0:00:56
Average standard deviation of split frequencies: 0.026231
110500 -- [-715.589] (-719.509) (-717.851) (-715.780) * (-717.085) (-715.658) (-715.323) [-715.611] -- 0:00:56
111000 -- (-715.961) (-718.311) [-718.938] (-714.624) * (-715.902) [-717.166] (-715.482) (-714.335) -- 0:00:56
111500 -- (-715.696) (-718.937) (-716.180) [-716.294] * [-716.634] (-715.180) (-717.456) (-714.994) -- 0:00:55
112000 -- (-717.153) (-715.166) [-714.529] (-715.332) * (-717.146) (-715.781) (-716.107) [-715.589] -- 0:00:55
112500 -- (-718.059) [-716.279] (-714.740) (-714.313) * (-714.906) (-715.996) [-718.105] (-717.955) -- 0:00:55
113000 -- (-721.103) [-715.963] (-715.693) (-715.270) * [-715.586] (-719.052) (-721.891) (-715.480) -- 0:00:54
113500 -- (-717.108) (-716.410) [-717.189] (-716.043) * (-718.902) (-715.714) [-714.838] (-715.115) -- 0:00:54
114000 -- (-718.509) (-717.920) (-716.910) [-715.266] * (-724.598) [-714.842] (-722.391) (-715.078) -- 0:00:54
114500 -- [-719.118] (-717.205) (-724.425) (-716.090) * (-717.300) [-716.721] (-720.053) (-716.379) -- 0:00:54
115000 -- (-716.187) (-716.454) (-717.217) [-715.901] * [-716.547] (-715.451) (-715.190) (-715.704) -- 0:00:53
Average standard deviation of split frequencies: 0.022577
115500 -- [-716.782] (-724.467) (-715.219) (-716.094) * (-718.180) [-718.756] (-715.702) (-715.552) -- 0:00:53
116000 -- (-715.032) (-717.452) [-716.715] (-715.788) * (-721.459) (-716.076) (-716.526) [-715.704] -- 0:00:53
116500 -- (-716.104) (-716.550) (-716.173) [-717.055] * (-716.634) [-716.026] (-715.592) (-715.358) -- 0:00:53
117000 -- [-715.530] (-716.510) (-719.128) (-716.694) * (-715.299) [-718.206] (-717.006) (-716.711) -- 0:00:52
117500 -- (-716.114) (-718.561) (-721.648) [-716.913] * (-716.099) (-716.721) (-715.577) [-717.128] -- 0:00:52
118000 -- (-715.613) (-720.959) (-716.241) [-717.298] * (-717.187) (-716.035) (-715.871) [-721.471] -- 0:00:52
118500 -- (-716.013) [-715.573] (-721.616) (-715.223) * (-717.869) [-717.675] (-715.729) (-721.593) -- 0:00:52
119000 -- (-716.877) [-717.986] (-715.997) (-715.848) * (-716.817) (-718.050) [-715.899] (-718.103) -- 0:00:51
119500 -- (-718.470) (-716.654) (-717.060) [-716.486] * (-719.183) (-719.132) [-715.233] (-718.723) -- 0:00:58
120000 -- (-718.543) (-716.602) (-716.205) [-715.273] * (-715.940) (-718.913) [-718.958] (-718.682) -- 0:00:58
Average standard deviation of split frequencies: 0.021487
120500 -- [-718.756] (-715.022) (-721.584) (-714.621) * (-719.022) (-715.239) [-718.478] (-714.913) -- 0:00:58
121000 -- (-719.012) (-716.060) (-716.824) [-718.722] * (-715.766) [-717.109] (-719.432) (-717.403) -- 0:00:58
121500 -- [-716.798] (-716.693) (-721.762) (-715.120) * (-717.222) [-718.366] (-719.389) (-722.353) -- 0:00:57
122000 -- [-715.361] (-715.854) (-716.841) (-716.383) * (-715.587) (-716.638) [-718.941] (-721.861) -- 0:00:57
122500 -- [-716.441] (-716.729) (-716.872) (-715.416) * (-715.624) (-717.872) [-716.915] (-716.816) -- 0:00:57
123000 -- (-720.818) (-720.418) (-717.252) [-715.955] * [-715.294] (-715.207) (-717.527) (-715.808) -- 0:00:57
123500 -- (-718.453) (-717.003) (-718.954) [-718.954] * (-716.102) (-716.635) (-719.237) [-714.652] -- 0:00:56
124000 -- (-720.018) (-715.110) (-716.275) [-720.679] * (-715.310) (-717.616) [-718.993] (-717.566) -- 0:00:56
124500 -- (-718.805) [-714.821] (-714.931) (-715.615) * (-717.352) [-717.337] (-715.148) (-716.731) -- 0:00:56
125000 -- [-717.193] (-721.280) (-715.246) (-719.000) * (-715.352) [-718.179] (-718.165) (-716.855) -- 0:00:56
Average standard deviation of split frequencies: 0.016934
125500 -- [-718.967] (-720.787) (-715.515) (-719.876) * (-715.342) (-715.559) [-718.657] (-717.782) -- 0:00:55
126000 -- (-715.532) (-715.933) [-717.124] (-716.847) * [-717.393] (-717.234) (-716.154) (-719.054) -- 0:00:55
126500 -- (-714.704) [-715.918] (-721.034) (-715.339) * (-714.467) (-723.719) (-716.841) [-716.944] -- 0:00:55
127000 -- (-716.737) (-719.221) (-718.586) [-718.245] * (-715.483) (-718.529) (-716.712) [-715.347] -- 0:00:54
127500 -- [-716.249] (-716.068) (-718.026) (-719.430) * (-716.541) [-717.351] (-722.597) (-715.597) -- 0:00:54
128000 -- (-717.829) (-717.112) [-717.134] (-715.499) * (-716.222) (-715.794) [-717.610] (-714.614) -- 0:00:54
128500 -- (-720.401) (-721.040) (-715.697) [-714.757] * (-717.143) (-716.827) (-715.888) [-715.344] -- 0:00:54
129000 -- (-716.721) (-716.033) [-715.849] (-715.363) * (-717.214) (-718.917) [-715.305] (-715.514) -- 0:00:54
129500 -- (-715.663) (-715.379) (-716.227) [-716.211] * (-715.368) (-715.533) [-716.762] (-716.954) -- 0:00:53
130000 -- (-716.358) [-716.334] (-719.892) (-717.991) * (-715.384) [-714.725] (-718.089) (-719.816) -- 0:00:53
Average standard deviation of split frequencies: 0.019241
130500 -- [-717.150] (-718.223) (-717.043) (-719.351) * (-723.090) [-716.967] (-718.694) (-723.364) -- 0:00:53
131000 -- [-715.468] (-718.685) (-724.872) (-715.626) * [-715.530] (-715.952) (-718.998) (-716.173) -- 0:00:53
131500 -- (-716.845) (-718.601) (-715.207) [-721.911] * [-716.172] (-715.806) (-718.273) (-718.958) -- 0:00:52
132000 -- (-718.495) (-715.110) [-716.259] (-716.270) * (-715.249) (-716.016) (-716.783) [-720.744] -- 0:00:52
132500 -- (-715.801) (-717.719) (-715.905) [-714.871] * (-716.722) (-715.689) [-715.926] (-716.381) -- 0:00:52
133000 -- (-715.644) (-718.588) [-716.225] (-715.579) * (-719.431) [-717.975] (-716.032) (-719.473) -- 0:00:52
133500 -- (-717.705) [-716.073] (-716.624) (-716.733) * (-719.261) (-717.689) [-716.496] (-715.910) -- 0:00:51
134000 -- (-716.099) [-718.211] (-715.470) (-715.479) * (-715.852) (-718.315) (-718.070) [-715.576] -- 0:00:51
134500 -- (-715.467) (-722.824) (-717.064) [-716.436] * [-718.281] (-721.928) (-714.402) (-715.871) -- 0:00:51
135000 -- (-716.802) (-717.488) [-717.224] (-716.213) * [-716.395] (-715.006) (-716.205) (-716.284) -- 0:00:51
Average standard deviation of split frequencies: 0.017909
135500 -- (-714.995) (-717.691) [-717.368] (-717.978) * (-717.556) (-714.817) (-715.106) [-716.962] -- 0:00:57
136000 -- (-716.450) [-716.198] (-718.348) (-715.364) * (-716.790) (-719.635) [-718.781] (-724.195) -- 0:00:57
136500 -- (-714.685) (-717.740) (-716.573) [-716.281] * [-716.380] (-715.534) (-716.436) (-717.455) -- 0:00:56
137000 -- (-715.232) [-715.946] (-725.056) (-716.353) * [-716.383] (-720.768) (-718.302) (-715.826) -- 0:00:56
137500 -- [-719.528] (-717.848) (-717.317) (-718.373) * (-714.226) (-717.142) (-716.932) [-716.583] -- 0:00:56
138000 -- (-714.967) [-718.762] (-717.443) (-718.337) * (-714.859) [-718.324] (-715.789) (-716.156) -- 0:00:56
138500 -- (-718.422) (-715.716) (-717.570) [-719.110] * [-715.075] (-717.505) (-721.228) (-718.326) -- 0:00:55
139000 -- (-722.276) (-717.622) (-715.328) [-717.118] * (-714.443) [-719.742] (-716.061) (-717.798) -- 0:00:55
139500 -- (-721.879) [-714.932] (-718.309) (-717.505) * (-716.594) (-715.423) (-716.591) [-716.019] -- 0:00:55
140000 -- (-719.976) (-715.387) [-717.239] (-714.937) * (-715.232) (-716.110) [-716.989] (-715.891) -- 0:00:55
Average standard deviation of split frequencies: 0.018618
140500 -- (-717.468) (-714.743) (-716.804) [-715.447] * [-716.805] (-716.051) (-717.230) (-715.034) -- 0:00:55
141000 -- (-716.348) (-716.864) (-718.032) [-715.081] * [-718.727] (-716.828) (-716.393) (-715.679) -- 0:00:54
141500 -- (-716.282) [-717.096] (-716.336) (-716.195) * (-718.960) [-715.076] (-715.342) (-715.413) -- 0:00:54
142000 -- (-717.380) (-716.540) (-716.220) [-715.318] * (-719.351) (-717.429) [-718.077] (-715.038) -- 0:00:54
142500 -- (-714.856) [-715.617] (-718.690) (-715.180) * (-721.830) (-717.922) [-715.999] (-716.522) -- 0:00:54
143000 -- (-718.713) [-715.560] (-715.771) (-716.580) * (-718.144) [-716.070] (-716.171) (-714.713) -- 0:00:53
143500 -- (-716.025) (-716.123) [-716.822] (-718.914) * (-717.935) (-718.407) (-717.269) [-716.104] -- 0:00:53
144000 -- (-717.720) [-715.850] (-715.978) (-716.528) * [-715.228] (-715.868) (-718.303) (-717.059) -- 0:00:53
144500 -- (-716.787) [-715.726] (-715.916) (-718.743) * [-715.536] (-716.403) (-715.068) (-717.639) -- 0:00:53
145000 -- (-716.391) [-715.050] (-716.208) (-717.161) * [-719.170] (-718.487) (-715.053) (-717.535) -- 0:00:53
Average standard deviation of split frequencies: 0.018476
145500 -- [-717.277] (-718.078) (-715.533) (-715.582) * (-716.706) (-715.509) [-715.134] (-719.981) -- 0:00:52
146000 -- (-716.656) (-717.458) [-720.771] (-716.234) * [-718.029] (-716.756) (-721.840) (-717.554) -- 0:00:52
146500 -- (-716.226) (-716.815) (-722.909) [-716.485] * (-716.675) [-716.642] (-720.266) (-715.261) -- 0:00:52
147000 -- (-718.055) [-719.721] (-715.820) (-715.062) * (-716.202) (-717.744) (-717.441) [-717.440] -- 0:00:52
147500 -- (-719.086) (-717.728) (-716.692) [-717.232] * (-715.018) (-716.862) [-718.819] (-714.715) -- 0:00:52
148000 -- (-716.654) [-715.794] (-717.483) (-716.766) * [-715.360] (-718.014) (-716.111) (-717.863) -- 0:00:51
148500 -- (-717.529) (-716.083) [-717.855] (-715.085) * (-716.553) (-717.187) (-718.113) [-715.867] -- 0:00:51
149000 -- (-717.210) (-717.161) [-715.713] (-715.179) * (-715.792) (-716.269) [-716.002] (-721.330) -- 0:00:51
149500 -- (-717.206) [-716.704] (-716.413) (-715.902) * (-715.614) (-716.936) [-717.976] (-716.245) -- 0:00:51
150000 -- (-716.641) (-717.455) [-715.799] (-715.499) * (-719.185) [-715.022] (-719.768) (-716.652) -- 0:00:51
Average standard deviation of split frequencies: 0.016687
150500 -- (-715.626) [-716.077] (-716.982) (-716.191) * [-716.554] (-715.348) (-715.935) (-718.766) -- 0:00:50
151000 -- (-715.789) (-716.733) [-715.653] (-720.974) * (-718.376) (-719.264) (-721.090) [-715.009] -- 0:00:50
151500 -- [-715.299] (-716.543) (-716.992) (-721.132) * [-718.537] (-717.828) (-722.605) (-716.392) -- 0:00:56
152000 -- (-715.938) [-716.552] (-716.398) (-714.939) * (-718.831) [-716.637] (-716.473) (-717.934) -- 0:00:55
152500 -- (-716.583) (-716.751) (-715.328) [-718.554] * [-719.861] (-715.408) (-721.080) (-715.779) -- 0:00:55
153000 -- [-716.053] (-714.703) (-715.283) (-718.322) * [-717.593] (-718.424) (-720.609) (-715.422) -- 0:00:55
153500 -- (-716.635) (-717.039) [-715.709] (-717.558) * [-716.383] (-722.795) (-716.084) (-721.667) -- 0:00:55
154000 -- (-714.797) (-714.956) [-717.711] (-716.458) * (-719.990) (-717.575) [-716.445] (-714.674) -- 0:00:54
154500 -- [-714.885] (-717.154) (-716.995) (-716.277) * [-716.545] (-715.737) (-716.322) (-715.388) -- 0:00:54
155000 -- [-716.062] (-717.774) (-720.159) (-716.766) * (-719.796) (-715.775) [-716.395] (-715.675) -- 0:00:54
Average standard deviation of split frequencies: 0.017813
155500 -- (-715.699) (-716.983) [-717.729] (-716.234) * (-724.734) [-715.414] (-715.954) (-716.199) -- 0:00:54
156000 -- [-717.168] (-719.603) (-715.670) (-716.850) * [-718.445] (-714.823) (-720.917) (-715.403) -- 0:00:54
156500 -- (-724.340) [-717.479] (-715.744) (-721.051) * (-718.490) (-719.355) [-716.957] (-717.618) -- 0:00:53
157000 -- (-716.292) (-717.874) [-716.723] (-715.588) * (-715.174) (-719.944) (-718.121) [-716.430] -- 0:00:53
157500 -- (-714.235) (-720.762) (-715.728) [-714.865] * (-716.065) (-714.534) [-716.003] (-722.964) -- 0:00:53
158000 -- (-714.263) [-718.231] (-720.733) (-716.240) * [-717.438] (-715.544) (-717.771) (-715.857) -- 0:00:53
158500 -- (-714.421) (-716.724) (-719.397) [-716.097] * (-717.705) (-715.303) (-716.592) [-715.705] -- 0:00:53
159000 -- (-715.443) (-714.963) [-718.060] (-719.382) * [-715.270] (-715.997) (-719.342) (-718.570) -- 0:00:52
159500 -- (-715.217) (-715.980) (-715.463) [-715.948] * [-715.759] (-714.795) (-721.215) (-715.894) -- 0:00:52
160000 -- (-715.051) (-716.063) [-721.051] (-716.447) * (-715.293) (-717.341) [-721.523] (-714.286) -- 0:00:52
Average standard deviation of split frequencies: 0.014498
160500 -- (-716.346) (-716.320) [-715.568] (-715.457) * (-715.736) (-717.223) [-714.799] (-718.616) -- 0:00:52
161000 -- (-719.380) (-714.891) (-715.381) [-714.682] * [-716.411] (-717.372) (-715.270) (-719.972) -- 0:00:52
161500 -- (-714.861) [-715.684] (-718.446) (-715.972) * (-714.973) (-719.076) [-717.343] (-715.627) -- 0:00:51
162000 -- (-718.995) [-714.347] (-717.011) (-714.851) * (-719.426) (-717.863) [-716.467] (-715.024) -- 0:00:51
162500 -- (-718.830) (-715.316) [-715.052] (-716.637) * [-716.489] (-716.273) (-715.396) (-717.796) -- 0:00:51
163000 -- [-718.196] (-717.291) (-715.134) (-717.219) * [-718.426] (-719.979) (-720.660) (-716.378) -- 0:00:51
163500 -- (-717.971) (-720.305) (-715.670) [-716.323] * (-716.882) [-715.727] (-719.018) (-715.760) -- 0:00:51
164000 -- (-717.762) [-715.727] (-717.161) (-717.998) * [-716.935] (-716.632) (-715.272) (-715.306) -- 0:00:50
164500 -- (-719.553) (-718.191) (-719.459) [-715.721] * [-719.412] (-715.630) (-723.152) (-717.380) -- 0:00:50
165000 -- (-716.444) (-720.291) (-716.386) [-715.406] * (-716.353) (-715.970) [-715.681] (-715.800) -- 0:00:50
Average standard deviation of split frequencies: 0.014700
165500 -- (-717.389) [-716.021] (-716.687) (-715.638) * (-715.645) (-717.215) [-717.982] (-716.463) -- 0:00:50
166000 -- (-714.728) (-715.959) (-722.653) [-715.417] * (-715.697) (-718.911) [-716.292] (-718.647) -- 0:00:50
166500 -- (-719.484) (-715.960) (-716.566) [-715.011] * [-717.925] (-718.262) (-715.393) (-717.335) -- 0:00:50
167000 -- (-716.159) (-717.596) (-715.294) [-717.178] * (-717.575) (-716.781) [-716.474] (-720.311) -- 0:00:49
167500 -- [-717.479] (-715.981) (-716.860) (-720.315) * (-716.877) (-715.494) (-715.303) [-718.379] -- 0:00:54
168000 -- (-716.261) (-715.762) (-715.873) [-716.371] * (-715.955) (-717.680) [-717.327] (-718.937) -- 0:00:54
168500 -- (-719.626) (-717.191) (-717.096) [-720.150] * [-717.448] (-716.713) (-718.883) (-718.133) -- 0:00:54
169000 -- (-718.923) (-718.196) [-715.628] (-720.177) * (-718.643) [-716.103] (-715.893) (-718.023) -- 0:00:54
169500 -- (-718.980) [-714.557] (-716.053) (-718.436) * [-714.505] (-714.694) (-714.508) (-715.634) -- 0:00:53
170000 -- [-716.242] (-718.758) (-715.242) (-716.644) * [-715.840] (-716.002) (-714.617) (-716.352) -- 0:00:53
Average standard deviation of split frequencies: 0.015652
170500 -- (-716.128) (-714.898) [-715.208] (-715.529) * (-721.792) (-717.985) [-715.898] (-716.478) -- 0:00:53
171000 -- [-715.964] (-714.902) (-718.493) (-716.960) * (-719.201) [-715.858] (-721.078) (-716.232) -- 0:00:53
171500 -- (-715.615) [-715.853] (-715.724) (-718.001) * [-718.197] (-717.694) (-718.484) (-717.280) -- 0:00:53
172000 -- (-720.654) (-715.266) (-717.999) [-716.376] * [-718.244] (-716.978) (-717.523) (-720.569) -- 0:00:52
172500 -- (-718.857) (-718.954) [-715.398] (-716.894) * [-715.221] (-716.551) (-721.459) (-717.469) -- 0:00:52
173000 -- (-717.528) (-715.944) [-714.646] (-714.657) * (-716.730) (-716.282) (-720.599) [-715.288] -- 0:00:52
173500 -- (-715.343) (-717.550) [-715.577] (-715.873) * (-716.663) [-717.126] (-715.540) (-715.300) -- 0:00:52
174000 -- [-715.532] (-717.983) (-715.319) (-717.412) * (-715.501) (-716.468) [-715.253] (-717.874) -- 0:00:52
174500 -- (-716.842) [-718.499] (-716.315) (-715.724) * [-715.315] (-715.781) (-715.714) (-718.072) -- 0:00:52
175000 -- (-717.039) (-715.965) (-719.667) [-714.686] * (-718.473) (-715.971) [-715.107] (-714.859) -- 0:00:51
Average standard deviation of split frequencies: 0.016858
175500 -- (-715.712) (-714.938) (-715.778) [-716.194] * [-717.466] (-716.439) (-715.122) (-717.225) -- 0:00:51
176000 -- (-715.917) [-715.193] (-716.231) (-716.308) * (-717.465) [-716.762] (-720.269) (-716.796) -- 0:00:51
176500 -- (-714.911) (-719.033) (-717.144) [-717.041] * (-716.639) (-715.081) [-715.789] (-723.984) -- 0:00:51
177000 -- (-718.460) [-716.886] (-716.499) (-716.533) * (-715.367) (-715.675) (-715.117) [-717.695] -- 0:00:51
177500 -- [-715.100] (-715.843) (-715.815) (-715.242) * (-717.844) (-715.243) [-715.761] (-716.331) -- 0:00:50
178000 -- [-715.558] (-715.828) (-718.111) (-716.544) * (-718.184) (-717.121) (-715.175) [-716.381] -- 0:00:50
178500 -- (-718.811) (-715.260) [-714.823] (-716.878) * (-714.328) (-718.905) (-720.214) [-717.755] -- 0:00:50
179000 -- [-716.680] (-716.020) (-717.156) (-715.470) * (-715.597) [-716.883] (-722.021) (-717.581) -- 0:00:50
179500 -- (-716.350) [-715.734] (-719.060) (-715.076) * (-718.584) [-718.263] (-721.730) (-717.186) -- 0:00:50
180000 -- (-720.311) (-722.882) [-718.202] (-716.187) * (-717.913) [-716.387] (-717.609) (-716.655) -- 0:00:50
Average standard deviation of split frequencies: 0.018591
180500 -- (-714.635) (-714.994) (-716.412) [-717.761] * (-718.247) (-719.162) (-716.215) [-717.290] -- 0:00:49
181000 -- [-715.569] (-721.117) (-715.449) (-717.048) * [-715.715] (-715.215) (-717.094) (-715.240) -- 0:00:49
181500 -- (-719.476) (-723.673) [-718.033] (-717.906) * [-715.660] (-715.904) (-718.010) (-714.985) -- 0:00:49
182000 -- (-720.519) [-719.103] (-723.688) (-715.818) * (-715.358) [-716.193] (-716.450) (-715.716) -- 0:00:49
182500 -- (-718.020) (-717.517) (-714.672) [-716.689] * (-714.772) (-715.859) [-718.743] (-716.679) -- 0:00:49
183000 -- (-718.510) (-719.120) (-715.225) [-714.777] * (-715.374) (-715.257) [-718.075] (-717.411) -- 0:00:49
183500 -- (-714.208) (-715.923) (-716.308) [-714.681] * [-715.030] (-717.275) (-718.541) (-716.258) -- 0:00:48
184000 -- (-716.344) (-715.006) (-717.314) [-715.494] * (-716.399) [-714.488] (-719.217) (-719.498) -- 0:00:48
184500 -- (-716.519) [-716.383] (-714.859) (-716.258) * (-716.318) (-717.120) (-720.688) [-717.489] -- 0:00:53
185000 -- (-719.971) [-716.498] (-715.033) (-715.153) * (-716.031) (-716.016) (-716.862) [-715.778] -- 0:00:52
Average standard deviation of split frequencies: 0.018039
185500 -- (-716.451) (-716.555) (-717.118) [-716.491] * (-716.107) (-715.994) (-717.080) [-716.365] -- 0:00:52
186000 -- (-719.592) (-717.059) [-715.615] (-717.323) * (-719.254) (-721.383) [-716.379] (-715.524) -- 0:00:52
186500 -- (-719.625) (-721.361) (-716.291) [-716.523] * (-719.490) (-718.995) (-715.779) [-714.560] -- 0:00:52
187000 -- [-716.025] (-714.908) (-718.784) (-716.951) * (-716.888) (-714.958) (-716.924) [-714.937] -- 0:00:52
187500 -- (-718.641) (-715.117) (-722.081) [-715.285] * (-716.361) (-719.189) (-715.502) [-715.822] -- 0:00:52
188000 -- (-716.367) [-716.596] (-723.892) (-716.004) * (-716.233) [-716.184] (-716.153) (-715.308) -- 0:00:51
188500 -- (-718.314) (-717.525) (-716.532) [-718.359] * [-716.470] (-716.536) (-715.406) (-714.526) -- 0:00:51
189000 -- (-720.088) (-714.569) [-715.577] (-715.421) * (-717.022) (-717.514) (-718.676) [-715.827] -- 0:00:51
189500 -- (-716.439) (-714.760) [-714.936] (-715.590) * [-715.855] (-714.587) (-721.325) (-716.993) -- 0:00:51
190000 -- (-716.823) (-715.259) [-716.930] (-720.293) * [-715.892] (-715.980) (-718.978) (-717.369) -- 0:00:51
Average standard deviation of split frequencies: 0.017161
190500 -- [-716.509] (-715.562) (-718.004) (-715.560) * (-717.292) [-717.259] (-719.222) (-716.333) -- 0:00:50
191000 -- (-716.504) [-718.124] (-715.745) (-719.742) * [-717.126] (-718.159) (-714.770) (-717.507) -- 0:00:50
191500 -- (-718.799) (-716.306) (-717.364) [-715.763] * (-715.142) (-716.107) [-716.903] (-716.347) -- 0:00:50
192000 -- (-718.622) [-715.496] (-716.689) (-715.227) * [-718.000] (-717.995) (-718.970) (-716.460) -- 0:00:50
192500 -- (-717.985) (-715.462) [-715.917] (-716.487) * [-715.362] (-715.635) (-715.497) (-717.160) -- 0:00:50
193000 -- (-716.196) (-720.591) (-720.136) [-715.721] * (-714.818) (-717.029) [-717.601] (-715.922) -- 0:00:50
193500 -- [-716.407] (-716.835) (-717.804) (-715.430) * (-717.722) (-715.808) (-717.332) [-715.572] -- 0:00:50
194000 -- (-716.043) (-719.353) (-716.035) [-716.246] * (-714.562) [-715.868] (-715.980) (-716.606) -- 0:00:49
194500 -- (-719.869) [-717.677] (-720.778) (-716.215) * (-719.490) [-716.267] (-719.441) (-720.962) -- 0:00:49
195000 -- (-718.324) [-716.086] (-716.172) (-715.484) * (-719.733) (-715.554) [-714.284] (-715.327) -- 0:00:49
Average standard deviation of split frequencies: 0.018392
195500 -- (-718.952) (-721.283) (-715.117) [-714.600] * (-720.697) (-719.286) [-714.365] (-719.428) -- 0:00:49
196000 -- (-715.664) (-721.345) (-715.662) [-716.145] * (-715.378) (-718.766) [-714.388] (-716.844) -- 0:00:49
196500 -- (-715.740) (-717.344) (-716.435) [-717.053] * (-717.955) [-715.709] (-716.976) (-725.821) -- 0:00:49
197000 -- (-717.476) [-715.070] (-720.190) (-716.672) * [-720.315] (-715.006) (-718.808) (-715.248) -- 0:00:48
197500 -- [-716.818] (-715.968) (-720.705) (-714.977) * [-717.208] (-715.374) (-720.240) (-715.717) -- 0:00:48
198000 -- (-715.626) (-715.837) (-722.158) [-715.839] * [-716.775] (-714.628) (-720.135) (-718.683) -- 0:00:48
198500 -- [-715.684] (-717.977) (-718.423) (-722.064) * [-714.724] (-716.474) (-714.962) (-717.831) -- 0:00:48
199000 -- (-716.971) (-720.325) (-718.987) [-715.876] * (-714.805) [-715.204] (-715.463) (-716.406) -- 0:00:48
199500 -- [-717.151] (-719.262) (-715.675) (-716.080) * (-717.665) (-716.861) [-716.668] (-714.671) -- 0:00:48
200000 -- (-718.166) (-723.157) (-721.891) [-716.245] * (-716.913) (-715.928) (-716.676) [-718.910] -- 0:00:48
Average standard deviation of split frequencies: 0.017688
200500 -- (-716.688) (-719.270) (-721.659) [-715.220] * (-721.160) (-719.996) (-716.052) [-715.238] -- 0:00:47
201000 -- [-715.355] (-715.487) (-717.126) (-717.751) * [-719.351] (-718.642) (-717.228) (-718.107) -- 0:00:51
201500 -- (-716.682) (-716.413) [-716.386] (-720.384) * (-714.896) (-719.227) [-716.660] (-717.920) -- 0:00:51
202000 -- (-718.632) (-714.386) (-724.683) [-716.740] * [-718.438] (-717.611) (-719.122) (-717.744) -- 0:00:51
202500 -- (-714.394) (-715.499) [-717.650] (-718.433) * (-717.617) [-717.903] (-719.101) (-716.072) -- 0:00:51
203000 -- [-715.388] (-716.374) (-718.481) (-715.548) * (-719.156) (-717.166) [-715.795] (-715.942) -- 0:00:51
203500 -- (-720.515) (-716.627) [-716.440] (-719.600) * (-717.776) [-717.292] (-715.041) (-715.690) -- 0:00:50
204000 -- (-715.828) (-715.452) (-721.621) [-714.484] * (-717.932) (-716.617) (-716.132) [-718.859] -- 0:00:50
204500 -- (-715.578) [-714.135] (-715.742) (-719.846) * (-716.451) (-720.007) [-715.844] (-715.940) -- 0:00:50
205000 -- [-716.108] (-715.862) (-718.637) (-718.196) * (-720.697) (-720.984) [-716.426] (-716.838) -- 0:00:50
Average standard deviation of split frequencies: 0.017163
205500 -- (-719.045) [-714.756] (-714.819) (-717.439) * (-719.533) (-715.238) [-716.089] (-724.328) -- 0:00:50
206000 -- [-714.805] (-718.306) (-716.757) (-718.364) * [-717.693] (-717.206) (-716.593) (-717.882) -- 0:00:50
206500 -- (-715.009) (-714.576) [-714.426] (-718.231) * (-716.368) [-715.664] (-716.053) (-718.625) -- 0:00:49
207000 -- [-717.055] (-714.393) (-714.395) (-718.067) * [-716.750] (-715.137) (-715.629) (-716.197) -- 0:00:49
207500 -- [-715.880] (-716.433) (-717.438) (-718.800) * (-716.951) (-718.673) [-716.358] (-716.408) -- 0:00:49
208000 -- [-716.088] (-722.503) (-714.972) (-716.323) * (-716.711) (-716.385) [-717.004] (-716.048) -- 0:00:49
208500 -- [-716.853] (-717.640) (-718.353) (-722.300) * (-716.347) [-716.402] (-716.767) (-715.819) -- 0:00:49
209000 -- [-717.370] (-720.546) (-718.980) (-716.218) * (-715.627) (-717.564) [-716.069] (-714.431) -- 0:00:49
209500 -- (-718.580) (-717.221) [-718.575] (-716.137) * (-720.021) [-715.630] (-718.710) (-715.163) -- 0:00:49
210000 -- (-715.072) (-715.582) (-722.525) [-715.184] * [-715.477] (-715.380) (-716.227) (-714.491) -- 0:00:48
Average standard deviation of split frequencies: 0.016783
210500 -- (-718.195) (-715.728) [-715.370] (-721.433) * (-716.641) (-714.709) [-715.341] (-714.780) -- 0:00:48
211000 -- (-715.929) [-715.095] (-718.778) (-716.024) * [-715.355] (-715.328) (-716.837) (-716.069) -- 0:00:48
211500 -- (-717.472) (-719.962) [-715.802] (-716.171) * (-718.202) [-715.887] (-714.768) (-716.293) -- 0:00:48
212000 -- (-718.722) [-716.767] (-716.223) (-716.116) * (-717.793) (-718.404) [-714.948] (-716.383) -- 0:00:48
212500 -- [-716.215] (-721.417) (-716.540) (-719.648) * (-721.601) (-717.334) [-718.755] (-715.613) -- 0:00:48
213000 -- (-718.572) [-719.045] (-714.498) (-714.973) * (-716.680) [-717.562] (-722.478) (-717.984) -- 0:00:48
213500 -- (-717.820) (-718.853) [-714.215] (-716.920) * [-718.283] (-716.264) (-718.152) (-719.776) -- 0:00:47
214000 -- (-718.627) (-716.991) (-714.732) [-718.244] * (-718.594) (-715.692) (-714.683) [-717.348] -- 0:00:47
214500 -- (-717.272) (-717.182) [-714.879] (-717.891) * (-718.487) [-716.605] (-716.738) (-717.133) -- 0:00:47
215000 -- [-715.690] (-718.132) (-714.483) (-718.672) * (-717.456) (-715.559) [-715.625] (-717.207) -- 0:00:47
Average standard deviation of split frequencies: 0.015791
215500 -- (-715.970) (-715.215) (-716.546) [-720.431] * (-718.442) [-716.558] (-718.170) (-714.357) -- 0:00:47
216000 -- (-721.524) (-720.692) (-716.391) [-717.328] * (-719.092) [-718.455] (-716.438) (-715.834) -- 0:00:47
216500 -- (-717.457) (-715.817) [-717.666] (-716.417) * (-726.241) [-718.816] (-720.017) (-715.744) -- 0:00:47
217000 -- (-716.448) (-716.386) [-715.439] (-714.426) * (-716.462) (-717.297) (-717.970) [-715.162] -- 0:00:46
217500 -- (-718.699) (-715.948) [-714.704] (-719.434) * (-714.985) (-718.748) [-716.083] (-717.130) -- 0:00:50
218000 -- (-717.534) (-714.964) [-715.739] (-715.402) * [-719.055] (-718.351) (-715.131) (-715.386) -- 0:00:50
218500 -- [-715.512] (-714.749) (-716.486) (-715.905) * (-717.539) (-721.001) [-715.999] (-716.255) -- 0:00:50
219000 -- (-715.116) (-716.824) (-717.287) [-715.240] * (-717.478) (-716.982) (-715.240) [-716.769] -- 0:00:49
219500 -- (-715.425) (-717.719) [-717.180] (-718.197) * [-717.339] (-715.212) (-717.523) (-718.023) -- 0:00:49
220000 -- [-714.257] (-718.539) (-716.777) (-715.816) * [-716.248] (-716.299) (-718.624) (-717.180) -- 0:00:49
Average standard deviation of split frequencies: 0.016690
220500 -- (-715.542) [-718.635] (-717.396) (-716.335) * (-715.184) [-716.128] (-714.821) (-718.217) -- 0:00:49
221000 -- (-719.120) (-716.677) (-716.403) [-715.336] * [-716.171] (-716.291) (-717.199) (-717.538) -- 0:00:49
221500 -- (-717.166) (-714.726) [-716.109] (-715.859) * (-714.569) [-717.432] (-716.318) (-716.853) -- 0:00:49
222000 -- (-715.675) (-714.547) [-716.157] (-716.962) * (-714.315) (-716.452) (-718.501) [-716.443] -- 0:00:49
222500 -- (-718.234) (-715.404) [-716.398] (-715.595) * (-715.065) [-714.599] (-715.668) (-714.971) -- 0:00:48
223000 -- [-714.920] (-719.392) (-716.301) (-715.704) * [-716.061] (-715.698) (-715.490) (-715.697) -- 0:00:48
223500 -- (-715.116) (-721.686) (-715.293) [-714.969] * (-716.216) [-715.711] (-715.049) (-716.645) -- 0:00:48
224000 -- (-717.760) (-719.557) (-719.646) [-714.767] * (-718.076) (-715.728) (-715.532) [-714.924] -- 0:00:48
224500 -- (-716.035) (-718.832) [-716.571] (-725.392) * (-716.484) [-717.477] (-715.354) (-715.222) -- 0:00:48
225000 -- [-715.240] (-715.294) (-719.501) (-720.514) * (-719.020) (-716.067) [-714.474] (-715.024) -- 0:00:48
Average standard deviation of split frequencies: 0.016319
225500 -- (-715.944) [-715.395] (-717.860) (-717.501) * (-718.007) (-717.422) (-718.238) [-714.483] -- 0:00:48
226000 -- (-714.556) [-715.721] (-716.231) (-714.984) * (-720.162) (-718.305) (-717.028) [-715.216] -- 0:00:47
226500 -- (-715.405) (-715.993) [-719.729] (-717.325) * [-715.370] (-718.972) (-715.508) (-715.656) -- 0:00:47
227000 -- (-715.614) [-714.534] (-716.058) (-717.956) * (-717.777) (-716.167) [-715.938] (-716.188) -- 0:00:47
227500 -- (-715.258) (-716.854) [-716.697] (-715.361) * (-716.304) (-716.174) (-715.562) [-715.729] -- 0:00:47
228000 -- (-715.239) [-715.063] (-715.701) (-715.853) * (-724.254) (-717.894) [-714.907] (-717.578) -- 0:00:47
228500 -- (-715.815) [-715.232] (-714.886) (-717.195) * (-716.954) (-716.804) [-715.489] (-719.068) -- 0:00:47
229000 -- (-714.963) [-716.044] (-715.260) (-720.731) * (-716.680) [-714.588] (-717.730) (-715.135) -- 0:00:47
229500 -- [-714.964] (-715.112) (-716.851) (-717.440) * (-718.954) [-716.134] (-717.694) (-716.200) -- 0:00:47
230000 -- [-715.590] (-715.730) (-714.380) (-715.273) * (-720.700) [-715.754] (-721.192) (-719.550) -- 0:00:46
Average standard deviation of split frequencies: 0.016109
230500 -- [-715.664] (-716.945) (-714.679) (-715.768) * (-718.211) (-715.658) [-717.553] (-720.679) -- 0:00:46
231000 -- (-717.426) [-716.789] (-719.810) (-719.822) * [-716.418] (-716.057) (-715.292) (-716.749) -- 0:00:46
231500 -- (-715.784) (-721.428) (-722.380) [-717.168] * [-715.578] (-715.968) (-715.474) (-716.474) -- 0:00:46
232000 -- [-717.103] (-718.689) (-715.226) (-717.090) * [-720.397] (-718.207) (-719.354) (-714.714) -- 0:00:46
232500 -- [-718.164] (-718.437) (-716.880) (-719.094) * (-718.149) (-716.228) (-720.024) [-718.511] -- 0:00:46
233000 -- (-717.818) (-716.693) (-718.829) [-715.962] * (-715.531) [-715.256] (-716.549) (-717.077) -- 0:00:46
233500 -- [-715.998] (-714.780) (-719.647) (-717.865) * (-715.225) (-715.550) (-716.256) [-721.456] -- 0:00:45
234000 -- (-715.697) (-715.983) [-716.228] (-717.003) * (-715.887) (-716.463) (-718.747) [-714.859] -- 0:00:49
234500 -- (-717.650) (-715.319) [-715.106] (-716.678) * (-718.266) [-715.613] (-717.713) (-716.852) -- 0:00:48
235000 -- (-716.093) (-716.534) [-719.464] (-716.319) * [-716.144] (-715.031) (-716.223) (-715.630) -- 0:00:48
Average standard deviation of split frequencies: 0.015480
235500 -- (-719.395) (-716.004) (-723.442) [-714.977] * [-722.783] (-718.909) (-716.356) (-719.287) -- 0:00:48
236000 -- (-717.792) (-716.110) (-715.597) [-717.192] * (-718.346) (-717.631) [-717.257] (-718.830) -- 0:00:48
236500 -- [-715.912] (-715.974) (-714.353) (-715.720) * [-721.333] (-717.326) (-715.823) (-717.489) -- 0:00:48
237000 -- [-716.695] (-715.673) (-717.299) (-717.543) * (-716.291) (-715.633) (-716.180) [-720.418] -- 0:00:48
237500 -- (-716.003) (-715.560) [-720.408] (-720.953) * (-719.742) (-715.659) (-719.236) [-717.657] -- 0:00:48
238000 -- (-716.532) (-715.799) [-716.305] (-715.918) * [-719.383] (-716.018) (-724.266) (-715.727) -- 0:00:48
238500 -- [-717.283] (-714.898) (-715.845) (-718.515) * (-721.814) (-716.308) (-721.914) [-715.776] -- 0:00:47
239000 -- (-719.075) [-714.464] (-716.741) (-719.364) * (-724.548) [-716.609] (-716.183) (-719.478) -- 0:00:47
239500 -- (-721.084) (-716.251) (-719.957) [-716.155] * [-716.845] (-716.136) (-721.518) (-718.348) -- 0:00:47
240000 -- (-719.717) (-716.876) (-718.443) [-715.300] * (-717.171) (-722.528) (-716.194) [-717.815] -- 0:00:47
Average standard deviation of split frequencies: 0.015555
240500 -- (-715.647) (-721.154) [-716.030] (-715.780) * [-715.191] (-722.381) (-719.507) (-717.696) -- 0:00:47
241000 -- (-718.906) (-720.723) [-720.361] (-716.717) * (-717.509) (-715.391) (-718.580) [-717.434] -- 0:00:47
241500 -- [-717.154] (-717.861) (-715.846) (-717.906) * (-717.916) [-715.137] (-715.119) (-722.684) -- 0:00:47
242000 -- (-719.034) (-716.250) [-715.121] (-715.656) * (-716.221) [-714.992] (-715.217) (-721.347) -- 0:00:46
242500 -- (-718.530) (-720.259) (-718.149) [-716.335] * (-715.287) [-715.570] (-714.838) (-719.622) -- 0:00:46
243000 -- [-715.922] (-719.545) (-717.652) (-718.720) * (-715.960) (-718.666) [-716.408] (-715.134) -- 0:00:46
243500 -- (-716.806) [-719.936] (-720.630) (-716.106) * (-719.959) (-717.048) [-716.471] (-714.751) -- 0:00:46
244000 -- [-716.341] (-714.403) (-721.422) (-715.534) * (-718.496) (-716.108) [-715.589] (-718.802) -- 0:00:46
244500 -- [-715.374] (-715.856) (-714.895) (-715.492) * (-715.202) (-716.283) [-714.920] (-719.798) -- 0:00:46
245000 -- (-719.841) (-718.265) (-715.866) [-716.308] * (-718.109) (-717.722) [-715.232] (-716.354) -- 0:00:46
Average standard deviation of split frequencies: 0.015330
245500 -- (-717.569) (-722.468) [-716.092] (-715.298) * (-714.982) [-714.982] (-714.875) (-716.925) -- 0:00:46
246000 -- (-719.069) (-718.252) (-715.943) [-714.773] * (-716.074) (-716.291) (-714.424) [-715.312] -- 0:00:45
246500 -- (-718.916) (-722.388) [-714.817] (-715.429) * (-715.641) (-715.094) [-717.293] (-718.451) -- 0:00:45
247000 -- (-716.770) (-715.335) [-715.083] (-714.976) * [-715.777] (-715.949) (-719.349) (-715.583) -- 0:00:45
247500 -- (-716.239) [-714.748] (-717.102) (-715.689) * [-715.738] (-718.026) (-716.078) (-715.764) -- 0:00:45
248000 -- [-718.845] (-718.496) (-714.669) (-716.699) * (-717.240) (-717.106) [-715.536] (-717.512) -- 0:00:45
248500 -- (-720.550) (-715.764) [-716.509] (-714.940) * (-715.212) [-716.852] (-715.829) (-716.574) -- 0:00:45
249000 -- (-714.695) (-714.898) (-716.519) [-714.818] * [-716.935] (-714.497) (-715.469) (-716.824) -- 0:00:45
249500 -- [-715.778] (-721.878) (-716.469) (-716.075) * (-715.034) (-718.774) (-720.818) [-715.658] -- 0:00:45
250000 -- (-717.300) (-721.255) [-716.315] (-714.249) * [-715.731] (-714.611) (-721.508) (-715.383) -- 0:00:45
Average standard deviation of split frequencies: 0.014602
250500 -- (-717.624) (-714.674) (-716.151) [-714.264] * (-715.857) [-715.983] (-717.635) (-715.295) -- 0:00:47
251000 -- (-721.051) (-718.691) (-716.290) [-715.319] * (-718.914) (-716.153) [-715.409] (-715.765) -- 0:00:47
251500 -- (-719.136) (-716.295) (-718.480) [-715.011] * (-718.598) (-715.812) (-721.148) [-717.288] -- 0:00:47
252000 -- (-714.763) (-719.017) [-718.434] (-715.555) * [-719.365] (-716.576) (-721.427) (-719.815) -- 0:00:47
252500 -- [-715.394] (-722.323) (-718.398) (-715.545) * (-717.393) (-715.356) (-718.443) [-715.616] -- 0:00:47
253000 -- [-715.904] (-717.245) (-717.477) (-716.703) * (-723.241) [-715.269] (-721.253) (-714.885) -- 0:00:47
253500 -- [-715.742] (-718.292) (-720.388) (-716.143) * (-719.811) (-714.986) (-719.770) [-716.032] -- 0:00:47
254000 -- (-716.677) [-716.529] (-717.848) (-714.966) * (-718.088) [-717.296] (-715.692) (-716.344) -- 0:00:46
254500 -- [-719.009] (-719.167) (-715.078) (-717.839) * [-715.789] (-716.741) (-716.969) (-714.765) -- 0:00:46
255000 -- (-718.759) (-715.687) [-714.875] (-717.141) * (-715.812) (-716.556) (-715.327) [-715.821] -- 0:00:46
Average standard deviation of split frequencies: 0.014623
255500 -- (-714.565) [-716.666] (-716.284) (-716.797) * (-715.010) [-717.413] (-715.328) (-715.553) -- 0:00:46
256000 -- (-715.472) (-715.391) [-716.717] (-719.531) * (-716.369) [-716.381] (-717.167) (-723.013) -- 0:00:46
256500 -- (-718.456) [-716.333] (-716.536) (-717.596) * (-716.743) (-716.455) (-715.312) [-717.528] -- 0:00:46
257000 -- (-718.249) (-715.057) [-717.970] (-716.034) * (-717.167) [-717.519] (-714.497) (-717.597) -- 0:00:46
257500 -- (-717.140) (-715.225) (-715.833) [-718.338] * (-715.848) (-719.057) [-715.677] (-715.139) -- 0:00:46
258000 -- [-719.110] (-715.571) (-716.378) (-721.800) * (-715.765) (-717.029) [-721.471] (-714.869) -- 0:00:46
258500 -- (-716.560) (-715.389) (-716.668) [-715.391] * (-715.177) (-721.148) (-719.603) [-718.775] -- 0:00:45
259000 -- (-715.356) (-716.955) (-715.758) [-716.154] * (-715.369) (-716.131) (-715.112) [-716.273] -- 0:00:45
259500 -- [-715.361] (-719.830) (-717.364) (-715.186) * (-715.385) [-715.463] (-716.286) (-715.948) -- 0:00:45
260000 -- (-716.781) [-719.700] (-716.661) (-716.670) * (-715.251) (-716.747) (-716.780) [-716.017] -- 0:00:45
Average standard deviation of split frequencies: 0.012961
260500 -- [-716.146] (-717.315) (-717.875) (-717.562) * (-714.575) (-717.124) (-719.073) [-714.884] -- 0:00:45
261000 -- (-715.328) (-720.172) [-716.784] (-715.600) * (-717.933) (-718.529) [-718.680] (-720.146) -- 0:00:45
261500 -- (-715.191) [-716.639] (-720.135) (-717.103) * (-715.363) [-717.027] (-716.757) (-716.751) -- 0:00:45
262000 -- (-719.189) (-715.669) (-718.140) [-716.861] * (-715.202) (-718.819) (-717.044) [-722.093] -- 0:00:45
262500 -- (-721.093) (-715.896) [-720.439] (-716.276) * (-717.112) [-715.549] (-716.267) (-716.727) -- 0:00:44
263000 -- (-718.477) [-715.251] (-714.815) (-718.718) * (-718.279) [-719.680] (-715.434) (-715.240) -- 0:00:44
263500 -- (-717.663) (-714.992) [-716.417] (-717.863) * (-717.065) [-716.237] (-716.973) (-717.414) -- 0:00:44
264000 -- (-718.455) (-714.993) [-715.528] (-720.081) * (-717.692) (-714.853) (-715.849) [-715.147] -- 0:00:44
264500 -- [-715.496] (-715.697) (-714.684) (-717.529) * (-726.769) (-715.473) (-715.560) [-717.563] -- 0:00:44
265000 -- (-718.726) (-715.827) [-717.876] (-716.807) * (-717.083) (-715.772) (-721.246) [-716.053] -- 0:00:44
Average standard deviation of split frequencies: 0.011846
265500 -- (-715.172) (-722.040) (-716.597) [-717.494] * (-715.617) (-714.901) (-716.974) [-715.054] -- 0:00:44
266000 -- (-715.227) [-716.973] (-715.882) (-718.017) * (-718.865) (-716.140) (-718.433) [-716.681] -- 0:00:44
266500 -- [-715.150] (-722.321) (-716.921) (-718.257) * (-715.860) (-716.182) [-715.525] (-719.559) -- 0:00:44
267000 -- (-715.581) [-717.704] (-715.545) (-721.225) * (-715.749) [-715.479] (-715.775) (-716.605) -- 0:00:43
267500 -- (-714.663) (-717.829) (-718.463) [-714.346] * (-715.171) [-716.968] (-718.250) (-716.335) -- 0:00:46
268000 -- (-715.245) (-718.441) [-716.230] (-715.896) * (-714.572) (-717.143) (-716.909) [-716.396] -- 0:00:46
268500 -- (-715.377) [-715.256] (-719.220) (-715.323) * (-716.409) (-717.816) [-716.390] (-717.165) -- 0:00:46
269000 -- [-718.421] (-721.182) (-715.736) (-717.046) * [-717.826] (-719.596) (-715.476) (-716.618) -- 0:00:46
269500 -- (-718.696) [-719.605] (-716.330) (-721.039) * (-719.613) [-715.466] (-715.240) (-716.266) -- 0:00:46
270000 -- (-715.833) [-715.858] (-716.930) (-715.904) * (-717.706) (-715.427) [-714.599] (-716.291) -- 0:00:45
Average standard deviation of split frequencies: 0.012191
270500 -- (-721.545) [-716.615] (-716.409) (-719.125) * (-716.369) [-719.027] (-715.629) (-720.466) -- 0:00:45
271000 -- (-716.910) [-715.660] (-715.813) (-719.463) * (-717.368) (-717.712) (-717.882) [-714.780] -- 0:00:45
271500 -- (-719.201) (-718.174) (-715.626) [-718.514] * (-715.883) (-722.458) [-716.321] (-716.216) -- 0:00:45
272000 -- (-715.954) (-715.319) (-715.548) [-715.909] * (-715.380) [-718.136] (-715.257) (-719.626) -- 0:00:45
272500 -- (-716.749) (-720.038) [-715.514] (-719.522) * (-718.095) (-716.650) (-716.130) [-716.573] -- 0:00:45
273000 -- (-718.168) [-718.105] (-718.066) (-716.842) * (-718.780) [-716.654] (-724.157) (-718.434) -- 0:00:45
273500 -- (-717.500) (-715.481) [-718.293] (-715.701) * (-716.869) (-717.324) (-717.924) [-715.854] -- 0:00:45
274000 -- (-718.949) [-715.154] (-714.546) (-714.869) * (-715.344) (-719.123) [-715.493] (-716.771) -- 0:00:45
274500 -- [-715.128] (-715.090) (-716.741) (-715.253) * (-716.070) [-716.510] (-715.546) (-718.706) -- 0:00:44
275000 -- (-717.605) (-716.335) (-715.331) [-716.042] * (-716.112) (-716.052) (-715.917) [-716.544] -- 0:00:44
Average standard deviation of split frequencies: 0.011529
275500 -- [-716.703] (-722.026) (-717.262) (-720.845) * [-715.227] (-720.903) (-720.531) (-717.025) -- 0:00:44
276000 -- (-718.458) (-717.406) (-716.707) [-715.426] * (-714.498) (-718.048) (-716.679) [-718.100] -- 0:00:44
276500 -- (-716.726) (-715.518) [-716.665] (-715.791) * [-715.167] (-719.293) (-717.044) (-718.601) -- 0:00:44
277000 -- [-714.583] (-719.085) (-717.938) (-720.397) * [-717.433] (-716.850) (-715.459) (-716.625) -- 0:00:44
277500 -- (-716.630) (-717.134) (-716.575) [-715.358] * (-715.964) (-717.757) [-715.945] (-717.159) -- 0:00:44
278000 -- (-714.680) (-718.000) (-716.204) [-715.163] * [-716.170] (-718.070) (-715.094) (-719.061) -- 0:00:44
278500 -- (-716.039) (-717.414) (-716.103) [-716.125] * (-717.099) (-716.996) (-717.656) [-718.958] -- 0:00:44
279000 -- (-715.461) (-718.817) (-716.039) [-717.981] * (-719.138) (-720.330) (-715.301) [-714.476] -- 0:00:43
279500 -- (-715.763) (-722.480) [-717.809] (-715.737) * (-718.164) [-716.247] (-716.087) (-715.325) -- 0:00:43
280000 -- (-719.554) [-716.950] (-720.317) (-714.933) * [-720.019] (-717.228) (-720.908) (-717.733) -- 0:00:43
Average standard deviation of split frequencies: 0.012317
280500 -- (-721.268) (-719.256) (-714.900) [-716.714] * (-717.598) (-716.724) (-715.726) [-717.982] -- 0:00:43
281000 -- [-716.159] (-720.926) (-714.729) (-718.188) * (-717.132) (-718.348) [-715.250] (-715.230) -- 0:00:43
281500 -- (-719.114) [-716.910] (-714.661) (-718.240) * (-718.383) (-714.996) [-716.426] (-716.284) -- 0:00:43
282000 -- (-718.886) (-719.129) [-715.593] (-714.670) * (-716.200) [-715.009] (-715.267) (-715.259) -- 0:00:43
282500 -- (-716.162) [-719.477] (-716.724) (-714.613) * [-718.200] (-716.069) (-715.956) (-718.277) -- 0:00:43
283000 -- (-718.806) (-720.390) (-717.157) [-719.751] * (-719.951) [-716.086] (-717.527) (-720.495) -- 0:00:43
283500 -- (-721.077) [-714.973] (-724.216) (-722.333) * (-721.719) [-716.565] (-715.373) (-718.780) -- 0:00:42
284000 -- [-714.328] (-718.649) (-721.954) (-722.297) * (-716.005) (-718.084) [-717.700] (-716.873) -- 0:00:45
284500 -- (-714.222) (-722.424) (-714.977) [-720.562] * (-715.551) (-719.973) (-715.665) [-715.397] -- 0:00:45
285000 -- [-717.546] (-721.613) (-715.729) (-715.835) * (-715.245) (-717.069) [-714.489] (-716.214) -- 0:00:45
Average standard deviation of split frequencies: 0.011435
285500 -- (-718.837) (-722.862) [-715.003] (-715.675) * [-718.116] (-714.896) (-716.544) (-718.278) -- 0:00:45
286000 -- (-717.367) (-716.513) (-718.020) [-716.599] * (-716.012) [-715.191] (-714.581) (-718.077) -- 0:00:44
286500 -- [-716.688] (-715.751) (-715.543) (-715.183) * (-717.685) [-717.725] (-714.591) (-716.677) -- 0:00:44
287000 -- (-715.189) (-719.842) [-715.299] (-718.119) * (-719.259) (-716.991) [-715.160] (-717.752) -- 0:00:44
287500 -- (-716.511) (-721.444) [-715.793] (-716.982) * (-720.048) [-714.988] (-716.293) (-716.257) -- 0:00:44
288000 -- [-716.270] (-715.031) (-715.959) (-716.984) * (-714.648) [-714.520] (-717.084) (-714.311) -- 0:00:44
288500 -- (-717.473) (-715.936) (-715.610) [-715.734] * (-721.748) (-717.167) (-718.569) [-714.674] -- 0:00:44
289000 -- (-718.547) [-715.832] (-717.394) (-719.981) * [-715.137] (-715.624) (-715.707) (-716.727) -- 0:00:44
289500 -- [-718.081] (-716.259) (-718.821) (-720.699) * (-716.757) (-722.328) (-717.934) [-716.880] -- 0:00:44
290000 -- [-719.130] (-714.780) (-716.014) (-720.479) * [-716.208] (-718.644) (-715.948) (-714.886) -- 0:00:44
Average standard deviation of split frequencies: 0.011543
290500 -- (-718.981) [-714.849] (-716.124) (-718.663) * [-715.042] (-717.293) (-717.878) (-719.834) -- 0:00:43
291000 -- [-714.790] (-716.999) (-716.623) (-716.967) * (-718.512) [-716.368] (-714.887) (-720.034) -- 0:00:43
291500 -- [-714.467] (-714.242) (-716.468) (-716.601) * (-716.543) (-717.521) (-717.739) [-716.106] -- 0:00:43
292000 -- [-718.381] (-720.901) (-714.476) (-714.599) * (-716.537) [-716.439] (-721.746) (-718.117) -- 0:00:43
292500 -- [-716.559] (-716.703) (-714.676) (-719.495) * (-715.850) [-716.388] (-717.793) (-716.213) -- 0:00:43
293000 -- (-715.497) [-717.920] (-720.900) (-724.243) * (-715.155) (-718.312) [-718.516] (-716.383) -- 0:00:43
293500 -- (-716.337) [-717.417] (-717.173) (-718.119) * (-718.269) (-716.148) (-714.833) [-715.162] -- 0:00:43
294000 -- (-716.099) (-717.327) (-717.247) [-714.872] * [-717.263] (-718.237) (-715.687) (-715.496) -- 0:00:43
294500 -- (-715.380) (-717.688) [-717.122] (-717.211) * (-715.099) (-717.734) [-715.576] (-716.751) -- 0:00:43
295000 -- [-719.474] (-714.759) (-719.941) (-716.195) * (-716.155) (-722.429) [-715.924] (-715.857) -- 0:00:43
Average standard deviation of split frequencies: 0.011523
295500 -- [-721.296] (-720.130) (-719.237) (-716.662) * [-715.479] (-720.252) (-714.851) (-716.870) -- 0:00:42
296000 -- [-715.577] (-720.354) (-716.029) (-716.904) * (-717.628) (-716.022) (-716.242) [-714.910] -- 0:00:42
296500 -- (-714.624) (-718.000) (-718.903) [-719.600] * [-717.570] (-715.309) (-717.676) (-718.419) -- 0:00:42
297000 -- (-714.501) (-717.667) [-716.699] (-718.874) * (-718.761) [-716.785] (-721.621) (-724.283) -- 0:00:42
297500 -- (-715.078) (-718.825) [-716.833] (-720.459) * (-716.675) [-715.943] (-718.536) (-717.402) -- 0:00:42
298000 -- (-715.416) [-717.810] (-718.831) (-716.563) * (-715.049) (-717.194) [-716.984] (-717.659) -- 0:00:42
298500 -- (-716.824) (-716.726) [-716.852] (-715.161) * [-715.871] (-716.939) (-716.015) (-719.935) -- 0:00:42
299000 -- (-716.476) (-714.994) (-716.103) [-716.246] * (-714.639) (-714.922) [-720.082] (-717.474) -- 0:00:42
299500 -- (-715.634) (-717.666) [-715.508] (-717.679) * [-716.344] (-715.561) (-720.392) (-716.935) -- 0:00:42
300000 -- (-715.772) (-715.169) (-715.319) [-717.791] * (-716.124) (-716.345) [-716.240] (-718.172) -- 0:00:44
Average standard deviation of split frequencies: 0.010053
300500 -- (-716.449) [-715.007] (-714.804) (-718.001) * (-720.094) (-721.422) (-716.198) [-716.626] -- 0:00:44
301000 -- [-715.634] (-716.976) (-717.774) (-716.218) * (-717.286) (-714.652) (-718.298) [-714.185] -- 0:00:44
301500 -- (-717.157) [-717.866] (-717.061) (-715.491) * (-716.108) (-716.043) (-717.196) [-715.531] -- 0:00:44
302000 -- [-716.017] (-715.869) (-717.151) (-715.530) * [-717.061] (-715.233) (-716.000) (-716.601) -- 0:00:43
302500 -- [-715.213] (-715.942) (-716.373) (-715.700) * (-718.405) [-716.922] (-716.592) (-719.135) -- 0:00:43
303000 -- (-714.863) (-715.879) [-715.866] (-716.768) * (-718.020) (-714.557) [-715.490] (-715.192) -- 0:00:43
303500 -- [-716.557] (-714.575) (-716.971) (-719.513) * [-716.372] (-716.813) (-716.353) (-717.853) -- 0:00:43
304000 -- [-717.459] (-714.503) (-716.465) (-716.855) * (-716.451) (-715.713) (-717.410) [-717.878] -- 0:00:43
304500 -- (-719.056) (-714.367) (-716.071) [-718.721] * (-717.790) [-714.560] (-721.359) (-715.201) -- 0:00:43
305000 -- (-717.737) [-714.572] (-716.870) (-715.710) * (-715.912) (-715.182) (-718.154) [-715.327] -- 0:00:43
Average standard deviation of split frequencies: 0.009787
305500 -- [-714.693] (-714.476) (-716.876) (-716.379) * (-717.808) [-716.130] (-718.082) (-715.079) -- 0:00:43
306000 -- (-717.391) [-715.545] (-718.554) (-714.910) * (-722.263) (-718.163) [-719.687] (-716.465) -- 0:00:43
306500 -- [-718.340] (-715.422) (-715.449) (-715.138) * [-718.595] (-715.752) (-715.379) (-715.308) -- 0:00:42
307000 -- [-716.167] (-718.088) (-715.547) (-718.291) * (-716.561) [-715.581] (-716.072) (-716.041) -- 0:00:42
307500 -- (-714.636) (-716.960) (-716.260) [-714.863] * [-718.469] (-716.091) (-715.001) (-716.920) -- 0:00:42
308000 -- (-716.003) [-717.435] (-716.216) (-717.183) * (-717.064) (-716.621) (-715.940) [-716.522] -- 0:00:42
308500 -- (-715.368) (-718.210) (-717.853) [-716.070] * (-715.136) (-717.141) (-719.133) [-716.027] -- 0:00:42
309000 -- [-716.105] (-717.564) (-717.506) (-714.879) * (-718.376) (-716.582) [-715.817] (-719.279) -- 0:00:42
309500 -- (-719.169) [-715.664] (-717.872) (-717.253) * (-715.978) [-718.624] (-718.757) (-717.986) -- 0:00:42
310000 -- (-717.852) [-714.668] (-715.764) (-716.154) * (-719.234) [-714.440] (-715.434) (-715.221) -- 0:00:42
Average standard deviation of split frequencies: 0.010053
310500 -- (-716.907) (-714.897) (-716.188) [-715.445] * (-718.872) (-715.289) [-715.774] (-718.312) -- 0:00:42
311000 -- (-715.879) [-714.555] (-716.118) (-716.462) * (-714.917) (-716.147) [-715.131] (-715.243) -- 0:00:42
311500 -- [-719.293] (-717.783) (-716.575) (-716.596) * (-715.714) [-717.968] (-719.085) (-716.452) -- 0:00:41
312000 -- (-716.363) [-714.962] (-716.552) (-716.288) * [-718.029] (-716.451) (-717.539) (-716.798) -- 0:00:41
312500 -- [-720.352] (-719.688) (-715.402) (-717.792) * (-717.303) (-718.578) [-715.467] (-716.645) -- 0:00:41
313000 -- (-720.169) [-715.055] (-716.039) (-717.138) * (-714.942) (-715.291) (-717.528) [-716.964] -- 0:00:41
313500 -- (-719.223) [-716.324] (-720.573) (-718.440) * (-715.852) (-715.732) [-717.856] (-716.180) -- 0:00:41
314000 -- [-717.499] (-716.414) (-719.123) (-715.429) * (-717.643) [-718.142] (-716.905) (-715.701) -- 0:00:41
314500 -- (-718.633) (-715.857) [-717.277] (-716.635) * (-715.583) [-716.144] (-716.619) (-715.130) -- 0:00:41
315000 -- (-717.419) (-716.553) (-719.298) [-714.748] * (-716.239) (-715.588) (-718.124) [-715.205] -- 0:00:41
Average standard deviation of split frequencies: 0.009324
315500 -- (-718.680) (-716.019) (-715.558) [-717.107] * (-722.081) (-716.138) (-719.830) [-717.623] -- 0:00:41
316000 -- (-716.191) [-716.150] (-715.585) (-720.157) * (-719.461) (-721.081) [-718.158] (-717.153) -- 0:00:41
316500 -- (-716.712) (-715.888) [-717.106] (-720.637) * (-720.408) [-718.375] (-719.355) (-717.307) -- 0:00:43
317000 -- (-714.921) (-715.417) (-719.472) [-716.242] * (-718.250) (-720.970) (-719.156) [-714.603] -- 0:00:43
317500 -- (-714.583) (-718.504) (-727.711) [-714.907] * (-714.797) (-715.895) (-717.124) [-715.842] -- 0:00:42
318000 -- (-714.945) (-717.078) (-716.512) [-716.122] * (-717.373) (-718.088) (-721.759) [-716.409] -- 0:00:42
318500 -- (-715.793) (-716.568) (-714.745) [-717.126] * (-717.760) [-715.747] (-721.810) (-716.884) -- 0:00:42
319000 -- (-716.242) [-715.423] (-717.746) (-717.354) * (-718.680) (-716.052) [-716.287] (-714.643) -- 0:00:42
319500 -- (-720.628) (-715.603) [-715.264] (-715.184) * [-716.979] (-716.911) (-720.805) (-715.858) -- 0:00:42
320000 -- (-720.370) [-715.612] (-715.283) (-715.057) * [-715.647] (-716.646) (-719.335) (-716.032) -- 0:00:42
Average standard deviation of split frequencies: 0.008637
320500 -- [-718.028] (-714.713) (-718.183) (-716.762) * [-715.278] (-714.448) (-719.017) (-715.598) -- 0:00:42
321000 -- (-715.183) (-716.529) [-716.427] (-716.319) * [-715.791] (-718.030) (-716.025) (-715.849) -- 0:00:42
321500 -- [-715.543] (-715.670) (-716.303) (-715.754) * (-716.850) (-717.869) [-717.933] (-714.904) -- 0:00:42
322000 -- (-714.858) (-717.034) [-715.583] (-715.352) * (-715.088) [-719.459] (-716.365) (-717.764) -- 0:00:42
322500 -- [-718.828] (-714.811) (-714.540) (-715.781) * (-715.826) (-718.364) [-716.494] (-716.262) -- 0:00:42
323000 -- (-718.581) (-721.211) (-718.048) [-718.415] * (-716.837) (-714.363) (-714.858) [-718.366] -- 0:00:41
323500 -- (-716.384) (-716.353) (-719.639) [-715.339] * (-715.741) [-714.402] (-716.418) (-715.200) -- 0:00:41
324000 -- [-714.578] (-718.600) (-717.397) (-716.168) * (-716.825) (-715.309) (-716.478) [-716.137] -- 0:00:41
324500 -- (-717.469) (-715.169) [-718.930] (-718.005) * [-716.539] (-714.999) (-715.906) (-718.205) -- 0:00:41
325000 -- (-714.825) (-714.584) (-721.747) [-717.319] * (-714.397) [-716.171] (-716.346) (-714.389) -- 0:00:41
Average standard deviation of split frequencies: 0.009272
325500 -- (-717.697) [-716.746] (-715.725) (-716.551) * (-714.574) (-717.230) (-716.108) [-714.615] -- 0:00:41
326000 -- (-719.666) [-717.273] (-715.934) (-719.355) * (-714.850) [-714.632] (-716.719) (-716.799) -- 0:00:41
326500 -- [-715.953] (-721.760) (-720.208) (-714.962) * (-715.086) [-716.637] (-715.519) (-716.898) -- 0:00:41
327000 -- [-718.786] (-717.554) (-717.677) (-714.344) * (-716.114) [-715.098] (-716.678) (-720.093) -- 0:00:41
327500 -- (-715.734) [-715.415] (-718.512) (-715.223) * (-714.511) (-715.751) [-716.806] (-719.040) -- 0:00:41
328000 -- (-718.780) (-716.656) (-715.949) [-715.460] * [-714.879] (-717.748) (-717.296) (-716.564) -- 0:00:40
328500 -- [-714.959] (-716.662) (-716.399) (-715.605) * (-721.018) (-722.005) [-716.248] (-720.717) -- 0:00:40
329000 -- [-725.747] (-715.469) (-717.230) (-718.574) * (-720.586) (-725.076) (-716.890) [-716.884] -- 0:00:40
329500 -- (-726.723) (-715.286) [-718.121] (-717.580) * [-718.453] (-722.568) (-716.237) (-717.239) -- 0:00:40
330000 -- (-721.885) (-715.692) (-715.800) [-716.146] * (-719.562) (-717.588) (-716.129) [-715.027] -- 0:00:40
Average standard deviation of split frequencies: 0.009392
330500 -- (-719.355) [-717.054] (-716.436) (-715.124) * (-716.874) (-715.411) [-716.514] (-715.388) -- 0:00:40
331000 -- [-717.951] (-718.743) (-716.590) (-716.677) * (-721.282) (-716.790) (-715.734) [-716.667] -- 0:00:40
331500 -- (-716.588) [-718.845] (-718.002) (-717.380) * [-716.325] (-716.255) (-716.443) (-718.427) -- 0:00:40
332000 -- [-718.637] (-715.602) (-717.702) (-716.744) * (-716.135) (-720.129) [-716.983] (-716.761) -- 0:00:40
332500 -- (-715.809) (-714.260) (-717.561) [-718.190] * (-716.652) (-718.055) [-720.935] (-717.383) -- 0:00:40
333000 -- [-715.886] (-715.822) (-717.291) (-718.339) * (-718.700) (-717.790) (-719.973) [-715.315] -- 0:00:42
333500 -- [-715.244] (-714.308) (-717.419) (-717.954) * [-718.672] (-716.590) (-717.287) (-717.131) -- 0:00:41
334000 -- (-715.247) [-714.732] (-719.266) (-715.423) * [-716.053] (-718.305) (-716.168) (-716.399) -- 0:00:41
334500 -- (-717.620) (-716.859) [-718.089] (-715.364) * [-716.163] (-719.465) (-715.121) (-717.896) -- 0:00:41
335000 -- (-717.548) (-716.775) [-717.299] (-716.171) * (-721.846) (-718.135) (-715.615) [-716.896] -- 0:00:41
Average standard deviation of split frequencies: 0.009909
335500 -- [-716.169] (-716.151) (-714.908) (-715.791) * (-718.155) (-720.115) (-717.398) [-719.300] -- 0:00:41
336000 -- (-715.770) (-720.079) [-715.312] (-721.535) * (-715.834) [-718.026] (-717.080) (-716.591) -- 0:00:41
336500 -- (-716.899) (-717.228) (-717.371) [-717.284] * [-715.427] (-715.523) (-715.377) (-715.566) -- 0:00:41
337000 -- [-718.973] (-718.104) (-717.607) (-717.141) * (-721.154) (-716.660) [-715.295] (-715.750) -- 0:00:41
337500 -- [-716.655] (-715.946) (-716.333) (-717.275) * (-718.943) (-719.515) [-721.002] (-716.235) -- 0:00:41
338000 -- (-717.672) (-715.660) [-716.374] (-716.445) * (-718.095) [-720.807] (-715.336) (-715.857) -- 0:00:41
338500 -- (-716.747) [-717.221] (-716.727) (-715.454) * [-719.506] (-715.245) (-716.157) (-714.877) -- 0:00:41
339000 -- (-718.128) [-718.802] (-719.897) (-718.125) * (-715.550) [-716.655] (-716.202) (-715.249) -- 0:00:40
339500 -- (-715.505) (-715.831) (-716.060) [-714.638] * (-717.818) [-716.449] (-722.169) (-716.859) -- 0:00:40
340000 -- [-715.525] (-716.790) (-717.292) (-717.654) * (-714.544) [-717.518] (-715.408) (-719.304) -- 0:00:40
Average standard deviation of split frequencies: 0.009946
340500 -- [-717.754] (-716.235) (-718.444) (-717.421) * [-715.104] (-718.073) (-715.998) (-715.832) -- 0:00:40
341000 -- (-717.130) [-717.680] (-717.247) (-717.783) * (-715.797) [-715.283] (-718.677) (-716.514) -- 0:00:40
341500 -- (-719.570) (-719.263) [-718.754] (-717.818) * (-720.841) (-720.311) [-718.472] (-715.144) -- 0:00:40
342000 -- [-716.148] (-718.680) (-718.387) (-718.331) * (-714.970) (-717.637) (-719.460) [-720.109] -- 0:00:40
342500 -- (-718.314) (-716.360) [-715.816] (-716.752) * [-720.398] (-718.530) (-720.741) (-716.114) -- 0:00:40
343000 -- [-717.707] (-717.057) (-715.874) (-716.351) * (-715.263) (-716.974) (-715.528) [-718.121] -- 0:00:40
343500 -- (-716.133) (-715.736) [-715.659] (-715.554) * [-716.786] (-721.248) (-718.955) (-717.644) -- 0:00:40
344000 -- [-717.922] (-716.351) (-719.037) (-714.630) * (-714.853) [-720.169] (-715.427) (-716.616) -- 0:00:40
344500 -- (-714.829) (-717.864) (-716.564) [-715.169] * (-714.853) (-716.974) [-714.799] (-721.173) -- 0:00:39
345000 -- (-715.799) (-716.709) [-716.986] (-715.565) * (-721.240) (-716.907) (-714.683) [-720.209] -- 0:00:39
Average standard deviation of split frequencies: 0.009537
345500 -- (-717.148) [-715.850] (-715.543) (-716.137) * (-717.371) (-716.446) [-716.955] (-716.154) -- 0:00:39
346000 -- (-720.228) (-715.047) (-719.935) [-720.150] * [-716.015] (-716.436) (-715.900) (-716.730) -- 0:00:39
346500 -- (-716.404) [-715.740] (-715.881) (-718.697) * [-717.610] (-718.163) (-717.600) (-717.211) -- 0:00:39
347000 -- (-718.327) (-717.113) (-719.543) [-719.293] * (-722.147) (-719.082) [-714.813] (-717.554) -- 0:00:39
347500 -- (-717.326) [-716.551] (-715.356) (-716.503) * (-721.609) (-721.494) (-715.024) [-716.385] -- 0:00:39
348000 -- (-718.895) (-715.378) (-715.265) [-719.343] * (-716.636) [-715.683] (-716.300) (-716.847) -- 0:00:39
348500 -- [-719.521] (-715.591) (-716.467) (-717.371) * (-717.691) (-715.701) [-715.928] (-715.297) -- 0:00:39
349000 -- (-715.814) (-716.502) (-716.600) [-718.579] * (-715.869) [-715.751] (-716.704) (-718.088) -- 0:00:41
349500 -- (-717.027) (-716.032) [-717.195] (-717.718) * (-716.488) [-715.760] (-717.204) (-717.732) -- 0:00:40
350000 -- (-718.304) (-716.485) [-719.157] (-718.614) * (-719.886) [-715.131] (-715.608) (-716.852) -- 0:00:40
Average standard deviation of split frequencies: 0.009326
350500 -- [-714.977] (-719.902) (-716.616) (-718.596) * [-718.267] (-717.267) (-717.930) (-715.588) -- 0:00:40
351000 -- (-715.987) [-717.717] (-716.421) (-716.247) * (-718.904) (-718.955) (-718.998) [-716.996] -- 0:00:40
351500 -- (-721.494) (-716.806) [-719.312] (-715.636) * (-716.516) [-716.107] (-715.708) (-714.642) -- 0:00:40
352000 -- (-715.717) [-717.903] (-716.916) (-715.203) * (-716.236) (-719.364) (-715.460) [-714.827] -- 0:00:40
352500 -- [-715.012] (-715.510) (-714.675) (-715.384) * (-720.942) [-722.761] (-716.665) (-715.464) -- 0:00:40
353000 -- (-716.028) (-716.456) [-715.202] (-715.983) * (-717.593) (-714.705) (-716.446) [-714.664] -- 0:00:40
353500 -- (-715.687) [-715.779] (-715.639) (-717.393) * (-723.499) (-714.852) (-715.896) [-717.406] -- 0:00:40
354000 -- [-715.176] (-720.689) (-718.277) (-719.863) * (-716.598) [-716.298] (-716.571) (-718.828) -- 0:00:40
354500 -- [-716.299] (-716.914) (-717.817) (-716.451) * [-716.620] (-717.000) (-715.418) (-717.512) -- 0:00:40
355000 -- (-717.543) [-716.485] (-714.996) (-719.522) * [-716.466] (-717.898) (-715.438) (-721.244) -- 0:00:39
Average standard deviation of split frequencies: 0.009186
355500 -- [-718.899] (-716.712) (-714.826) (-718.863) * (-715.100) [-717.604] (-718.119) (-717.670) -- 0:00:39
356000 -- (-716.290) (-715.029) (-716.700) [-715.387] * [-714.990] (-716.963) (-716.369) (-716.151) -- 0:00:39
356500 -- [-716.508] (-716.324) (-717.980) (-716.947) * (-715.488) (-714.721) [-715.229] (-715.987) -- 0:00:39
357000 -- [-716.009] (-718.882) (-714.950) (-718.751) * (-714.960) (-716.875) [-715.118] (-717.889) -- 0:00:39
357500 -- [-718.459] (-717.470) (-715.900) (-716.505) * (-715.747) (-715.582) [-715.159] (-717.847) -- 0:00:39
358000 -- [-716.677] (-720.527) (-715.109) (-715.507) * (-715.890) (-717.537) [-714.273] (-715.585) -- 0:00:39
358500 -- (-715.874) (-715.591) (-717.665) [-718.271] * (-715.661) [-718.957] (-714.414) (-716.564) -- 0:00:39
359000 -- (-716.600) [-717.780] (-715.692) (-715.944) * (-715.614) (-717.700) (-716.032) [-718.083] -- 0:00:39
359500 -- (-716.633) (-714.653) (-717.211) [-715.186] * (-717.943) (-717.442) (-720.382) [-714.668] -- 0:00:39
360000 -- (-717.170) [-717.181] (-720.507) (-715.926) * [-716.112] (-716.931) (-716.131) (-716.826) -- 0:00:39
Average standard deviation of split frequencies: 0.009231
360500 -- (-719.263) (-718.652) [-716.923] (-716.106) * (-717.028) (-715.836) [-715.109] (-721.090) -- 0:00:39
361000 -- (-716.736) [-717.374] (-716.845) (-715.876) * [-715.092] (-715.760) (-719.115) (-719.040) -- 0:00:38
361500 -- (-714.930) [-714.741] (-716.355) (-725.857) * (-716.201) [-717.498] (-717.979) (-716.120) -- 0:00:38
362000 -- [-715.148] (-715.730) (-716.268) (-724.472) * (-717.068) (-718.189) [-720.259] (-717.239) -- 0:00:38
362500 -- (-719.234) (-716.741) [-716.953] (-725.632) * (-719.088) [-718.937] (-717.298) (-718.633) -- 0:00:38
363000 -- (-716.149) (-716.804) (-717.277) [-719.437] * (-714.526) (-717.940) [-717.294] (-716.182) -- 0:00:38
363500 -- (-715.165) [-717.424] (-714.962) (-716.050) * (-717.834) (-718.691) [-715.963] (-715.044) -- 0:00:38
364000 -- (-716.281) (-716.053) [-716.387] (-716.283) * [-717.684] (-718.818) (-718.101) (-717.137) -- 0:00:38
364500 -- (-716.161) (-720.779) [-716.175] (-716.224) * (-716.622) (-718.244) (-715.010) [-717.034] -- 0:00:38
365000 -- (-718.041) [-716.448] (-716.702) (-717.467) * (-715.879) (-717.805) [-715.018] (-716.490) -- 0:00:38
Average standard deviation of split frequencies: 0.009257
365500 -- (-719.220) (-718.040) [-715.441] (-719.332) * (-718.144) [-715.421] (-714.343) (-717.371) -- 0:00:39
366000 -- (-716.640) (-715.112) [-714.791] (-715.881) * (-715.530) (-715.011) (-718.570) [-715.106] -- 0:00:39
366500 -- (-716.405) (-717.501) (-716.129) [-717.108] * (-715.299) (-715.045) [-717.329] (-715.459) -- 0:00:39
367000 -- (-715.209) (-717.486) (-716.466) [-717.405] * [-718.095] (-716.016) (-715.700) (-715.408) -- 0:00:39
367500 -- [-716.167] (-716.051) (-717.769) (-717.427) * (-717.106) (-716.568) (-715.109) [-715.549] -- 0:00:39
368000 -- (-716.544) (-718.216) [-715.529] (-721.686) * (-715.803) (-717.364) [-715.727] (-717.125) -- 0:00:39
368500 -- (-717.777) (-714.800) (-722.134) [-716.534] * [-716.688] (-716.993) (-714.383) (-718.199) -- 0:00:39
369000 -- (-718.877) (-718.962) (-719.452) [-716.431] * (-723.397) [-714.806] (-716.263) (-719.114) -- 0:00:39
369500 -- [-716.287] (-717.406) (-715.283) (-719.482) * (-717.107) (-717.857) [-716.448] (-716.475) -- 0:00:39
370000 -- (-717.904) (-717.947) [-715.134] (-715.875) * (-715.690) [-717.756] (-717.164) (-717.821) -- 0:00:39
Average standard deviation of split frequencies: 0.009459
370500 -- (-714.614) [-719.271] (-715.190) (-716.092) * [-714.993] (-717.726) (-718.227) (-720.696) -- 0:00:39
371000 -- (-716.074) [-716.322] (-715.931) (-716.343) * (-717.266) (-714.514) (-720.033) [-716.012] -- 0:00:38
371500 -- (-717.970) (-716.745) (-714.316) [-715.579] * (-717.600) (-718.766) [-718.843] (-717.551) -- 0:00:38
372000 -- (-718.293) (-717.479) (-717.952) [-714.839] * (-716.163) (-717.847) (-717.526) [-716.198] -- 0:00:38
372500 -- (-715.268) (-714.498) [-719.956] (-716.809) * (-716.088) (-720.969) (-715.695) [-716.036] -- 0:00:38
373000 -- (-718.032) (-716.829) (-716.175) [-716.162] * [-715.790] (-721.074) (-717.187) (-718.033) -- 0:00:38
373500 -- [-714.879] (-715.190) (-717.268) (-716.964) * (-722.420) (-716.764) (-715.239) [-717.043] -- 0:00:38
374000 -- (-716.008) [-716.080] (-714.335) (-715.209) * (-715.700) [-715.795] (-719.426) (-730.159) -- 0:00:38
374500 -- (-715.694) [-716.075] (-715.130) (-717.700) * (-717.305) (-717.555) (-719.668) [-721.622] -- 0:00:38
375000 -- (-722.484) (-719.836) [-716.723] (-715.328) * (-719.642) (-721.989) [-717.380] (-716.384) -- 0:00:38
Average standard deviation of split frequencies: 0.009168
375500 -- (-714.743) [-715.271] (-716.083) (-717.483) * (-717.601) (-719.745) [-716.862] (-721.596) -- 0:00:38
376000 -- (-716.611) [-717.281] (-714.828) (-715.455) * (-718.841) [-716.276] (-717.156) (-715.057) -- 0:00:38
376500 -- (-717.191) (-721.204) [-719.053] (-719.941) * (-718.891) [-714.745] (-715.936) (-714.929) -- 0:00:38
377000 -- (-716.614) [-716.499] (-718.785) (-723.032) * (-716.437) [-716.092] (-716.338) (-715.051) -- 0:00:38
377500 -- (-719.732) [-715.492] (-716.344) (-715.920) * (-718.205) (-715.032) [-718.051] (-716.011) -- 0:00:37
378000 -- (-718.778) (-717.453) (-718.836) [-715.661] * [-717.911] (-716.495) (-715.769) (-714.381) -- 0:00:37
378500 -- (-716.849) [-716.483] (-717.833) (-716.698) * (-717.304) (-717.982) (-715.438) [-715.803] -- 0:00:37
379000 -- (-716.665) [-715.967] (-714.637) (-716.802) * (-715.527) (-716.201) [-715.403] (-714.439) -- 0:00:37
379500 -- (-719.190) [-715.223] (-715.225) (-720.329) * (-718.280) (-719.495) (-716.051) [-715.487] -- 0:00:37
380000 -- (-719.208) (-715.532) (-719.442) [-715.758] * [-718.853] (-718.105) (-717.698) (-716.273) -- 0:00:37
Average standard deviation of split frequencies: 0.009288
380500 -- (-717.268) (-719.542) (-714.894) [-716.712] * (-714.824) (-714.449) (-719.212) [-716.268] -- 0:00:37
381000 -- [-718.067] (-717.585) (-716.702) (-715.497) * (-715.734) [-716.650] (-716.227) (-715.367) -- 0:00:37
381500 -- [-716.237] (-721.182) (-717.789) (-718.752) * (-717.226) [-714.548] (-715.422) (-719.869) -- 0:00:37
382000 -- [-716.238] (-716.951) (-715.434) (-715.128) * (-715.359) [-716.573] (-716.294) (-715.433) -- 0:00:38
382500 -- (-716.021) [-716.597] (-716.665) (-715.677) * (-717.579) (-715.862) [-716.746] (-714.908) -- 0:00:38
383000 -- (-718.748) [-714.479] (-716.600) (-714.752) * (-715.461) [-714.807] (-717.039) (-714.404) -- 0:00:38
383500 -- (-716.624) (-718.621) [-716.228] (-718.047) * [-714.715] (-717.615) (-715.962) (-716.672) -- 0:00:38
384000 -- (-717.039) (-716.257) [-715.847] (-719.316) * (-715.896) (-718.800) (-719.851) [-715.758] -- 0:00:38
384500 -- [-715.972] (-714.839) (-715.622) (-727.459) * [-717.913] (-719.158) (-719.067) (-720.082) -- 0:00:38
385000 -- (-718.397) [-714.629] (-715.012) (-720.021) * (-718.303) (-715.750) (-715.845) [-714.731] -- 0:00:38
Average standard deviation of split frequencies: 0.009541
385500 -- (-716.858) (-719.349) [-716.365] (-719.046) * [-717.919] (-719.952) (-716.335) (-716.309) -- 0:00:38
386000 -- (-716.350) [-717.800] (-717.362) (-718.709) * (-719.156) (-718.229) [-715.289] (-715.470) -- 0:00:38
386500 -- (-716.956) (-716.588) (-716.660) [-718.996] * (-714.596) [-716.951] (-721.792) (-718.001) -- 0:00:38
387000 -- (-717.031) [-715.051] (-714.818) (-716.694) * (-714.501) (-716.490) [-714.417] (-717.531) -- 0:00:38
387500 -- (-717.720) (-715.192) [-715.518] (-716.292) * (-715.637) [-714.643] (-714.894) (-716.206) -- 0:00:37
388000 -- (-716.751) (-715.172) (-716.573) [-716.456] * (-718.123) (-715.134) (-714.660) [-715.186] -- 0:00:37
388500 -- (-716.199) (-719.007) (-715.393) [-715.656] * (-715.607) (-717.830) [-716.143] (-717.610) -- 0:00:37
389000 -- (-716.008) [-716.899] (-717.484) (-716.190) * (-714.191) (-719.826) (-717.284) [-718.292] -- 0:00:37
389500 -- [-715.019] (-724.309) (-716.532) (-718.452) * (-719.216) (-715.246) (-724.146) [-715.644] -- 0:00:37
390000 -- (-715.966) (-716.322) [-715.156] (-721.214) * (-718.840) (-715.625) (-715.612) [-716.312] -- 0:00:37
Average standard deviation of split frequencies: 0.009276
390500 -- [-716.624] (-715.906) (-722.096) (-715.809) * (-716.054) [-717.454] (-726.117) (-714.782) -- 0:00:37
391000 -- (-716.972) [-717.012] (-716.296) (-719.024) * (-715.710) (-717.344) (-714.566) [-716.384] -- 0:00:37
391500 -- (-715.693) (-718.373) [-716.178] (-716.175) * (-716.010) (-718.949) (-715.220) [-715.046] -- 0:00:37
392000 -- [-715.168] (-717.786) (-720.015) (-720.371) * [-715.924] (-715.283) (-717.753) (-716.102) -- 0:00:37
392500 -- (-717.282) [-716.732] (-714.964) (-718.191) * (-715.883) (-717.017) [-717.106] (-716.845) -- 0:00:37
393000 -- (-717.638) (-717.884) [-717.595] (-720.255) * (-718.784) (-717.381) [-720.683] (-717.193) -- 0:00:37
393500 -- [-717.806] (-714.289) (-715.555) (-718.148) * [-716.790] (-720.784) (-723.608) (-717.647) -- 0:00:36
394000 -- (-718.821) [-716.632] (-720.097) (-717.133) * (-719.194) (-719.065) [-717.078] (-719.898) -- 0:00:36
394500 -- [-715.406] (-718.142) (-719.710) (-716.394) * [-715.540] (-718.097) (-716.802) (-718.797) -- 0:00:36
395000 -- (-715.315) [-715.729] (-720.318) (-718.296) * (-716.085) (-714.549) (-715.368) [-715.721] -- 0:00:36
Average standard deviation of split frequencies: 0.009821
395500 -- (-717.861) [-715.298] (-716.039) (-716.134) * [-716.863] (-716.143) (-716.351) (-716.665) -- 0:00:36
396000 -- (-717.214) [-717.980] (-717.587) (-716.156) * [-722.966] (-718.191) (-715.550) (-719.539) -- 0:00:36
396500 -- (-716.643) (-716.134) [-718.415] (-721.858) * (-715.537) (-715.495) [-715.944] (-715.627) -- 0:00:36
397000 -- (-716.775) [-715.435] (-717.276) (-716.852) * (-715.361) (-717.475) [-716.842] (-715.487) -- 0:00:36
397500 -- [-715.699] (-714.838) (-716.237) (-716.313) * (-718.870) [-717.120] (-715.723) (-717.466) -- 0:00:37
398000 -- (-715.968) (-715.199) (-715.985) [-717.660] * (-720.159) [-719.828] (-715.630) (-718.347) -- 0:00:37
398500 -- [-715.956] (-716.453) (-715.450) (-716.833) * (-718.203) (-720.431) (-715.643) [-715.452] -- 0:00:37
399000 -- (-718.797) [-717.704] (-717.796) (-715.690) * (-714.863) [-720.303] (-717.606) (-715.912) -- 0:00:37
399500 -- (-720.123) (-717.191) [-716.390] (-720.850) * (-715.436) (-715.559) [-716.946] (-716.479) -- 0:00:37
400000 -- [-715.347] (-718.525) (-717.084) (-721.745) * [-715.872] (-717.951) (-715.187) (-719.216) -- 0:00:37
Average standard deviation of split frequencies: 0.009265
400500 -- (-717.060) [-714.934] (-715.172) (-720.316) * [-718.737] (-717.628) (-720.199) (-716.451) -- 0:00:37
401000 -- (-717.427) (-716.485) (-716.230) [-720.679] * (-718.663) [-716.422] (-719.390) (-718.005) -- 0:00:37
401500 -- [-715.650] (-717.816) (-717.862) (-717.997) * (-716.265) [-719.951] (-716.836) (-716.671) -- 0:00:37
402000 -- (-716.449) (-718.552) [-719.894] (-716.913) * (-715.547) (-716.340) [-715.736] (-717.485) -- 0:00:37
402500 -- (-718.517) [-716.454] (-715.143) (-717.547) * (-715.486) (-716.893) (-715.339) [-718.616] -- 0:00:37
403000 -- (-719.921) [-715.385] (-717.140) (-724.062) * (-714.288) (-716.833) (-714.617) [-721.912] -- 0:00:37
403500 -- (-719.188) [-715.511] (-718.237) (-719.625) * (-715.349) (-715.836) [-717.520] (-715.558) -- 0:00:36
404000 -- (-715.913) (-715.754) [-718.433] (-719.372) * (-715.503) (-716.104) (-717.944) [-715.523] -- 0:00:36
404500 -- (-715.750) (-718.206) (-716.704) [-715.877] * (-719.054) (-715.519) [-716.001] (-721.384) -- 0:00:36
405000 -- [-715.454] (-719.486) (-716.251) (-717.659) * (-718.741) (-717.188) (-715.877) [-720.951] -- 0:00:36
Average standard deviation of split frequencies: 0.009652
405500 -- [-716.819] (-718.543) (-716.718) (-720.128) * (-715.858) (-719.822) [-717.170] (-719.288) -- 0:00:36
406000 -- (-714.588) (-716.270) (-716.957) [-716.172] * (-716.984) [-717.490] (-716.178) (-716.078) -- 0:00:36
406500 -- [-716.911] (-715.929) (-718.572) (-718.914) * (-717.752) (-717.194) [-717.361] (-715.861) -- 0:00:36
407000 -- (-721.991) [-715.733] (-716.957) (-715.666) * (-716.971) [-715.557] (-719.163) (-715.410) -- 0:00:36
407500 -- (-718.321) [-715.484] (-719.790) (-716.423) * (-719.637) (-720.855) [-719.380] (-720.699) -- 0:00:36
408000 -- (-715.622) (-718.410) [-716.374] (-717.282) * (-717.038) [-715.757] (-717.603) (-719.177) -- 0:00:36
408500 -- (-718.448) [-719.838] (-718.186) (-715.356) * (-718.588) (-716.955) [-715.004] (-716.664) -- 0:00:36
409000 -- [-719.023] (-716.020) (-715.761) (-715.268) * [-716.435] (-716.985) (-715.515) (-718.330) -- 0:00:36
409500 -- (-717.188) [-715.291] (-715.335) (-718.080) * [-715.929] (-716.568) (-715.798) (-716.547) -- 0:00:36
410000 -- (-718.282) (-715.529) (-716.802) [-716.290] * (-715.943) [-715.496] (-716.873) (-716.939) -- 0:00:35
Average standard deviation of split frequencies: 0.009614
410500 -- (-717.409) (-715.236) [-716.559] (-716.159) * [-715.404] (-716.148) (-717.800) (-720.296) -- 0:00:35
411000 -- [-718.533] (-715.471) (-715.827) (-716.174) * (-721.414) (-718.044) [-717.304] (-714.660) -- 0:00:35
411500 -- (-718.323) [-714.834] (-715.121) (-716.231) * (-716.707) (-718.433) (-714.917) [-719.102] -- 0:00:35
412000 -- (-715.828) (-717.612) [-714.815] (-716.373) * (-718.634) [-719.057] (-718.556) (-721.538) -- 0:00:35
412500 -- [-715.418] (-718.789) (-718.608) (-715.489) * (-715.930) (-715.231) [-717.291] (-717.584) -- 0:00:35
413000 -- (-716.677) (-716.754) [-716.338] (-714.295) * (-716.594) (-714.955) (-717.036) [-715.049] -- 0:00:35
413500 -- (-714.722) [-715.497] (-715.697) (-715.995) * (-716.695) (-716.209) (-717.206) [-715.734] -- 0:00:35
414000 -- [-715.846] (-718.272) (-716.896) (-714.908) * (-717.781) (-722.658) [-717.774] (-715.004) -- 0:00:35
414500 -- (-717.280) [-715.755] (-718.588) (-717.027) * (-718.478) [-722.611] (-715.440) (-714.800) -- 0:00:36
415000 -- (-716.022) [-715.264] (-716.481) (-716.875) * (-716.147) (-715.861) (-715.011) [-718.306] -- 0:00:36
Average standard deviation of split frequencies: 0.009349
415500 -- (-719.620) (-717.090) (-714.811) [-722.751] * [-714.843] (-715.309) (-716.693) (-716.066) -- 0:00:36
416000 -- (-716.621) [-718.737] (-717.414) (-716.772) * (-716.266) [-715.132] (-717.407) (-717.645) -- 0:00:36
416500 -- (-715.819) (-716.103) (-715.755) [-715.195] * [-722.380] (-714.824) (-715.870) (-715.866) -- 0:00:36
417000 -- (-715.132) [-718.482] (-714.929) (-717.954) * (-715.939) (-716.344) [-716.027] (-716.194) -- 0:00:36
417500 -- [-715.734] (-718.109) (-717.469) (-716.641) * (-715.046) [-716.304] (-715.942) (-715.725) -- 0:00:36
418000 -- (-717.734) (-719.529) (-719.402) [-717.278] * (-717.787) (-714.893) (-715.035) [-715.337] -- 0:00:36
418500 -- (-716.147) (-716.535) (-716.336) [-715.315] * (-716.050) (-716.886) (-716.119) [-714.650] -- 0:00:36
419000 -- (-715.923) (-717.892) (-719.242) [-715.005] * (-715.507) (-716.214) (-716.580) [-715.032] -- 0:00:36
419500 -- (-714.890) [-714.696] (-715.816) (-714.897) * (-715.565) (-714.475) [-715.095] (-715.267) -- 0:00:35
420000 -- (-716.642) [-717.226] (-715.469) (-714.892) * (-715.520) [-719.069] (-717.331) (-715.129) -- 0:00:35
Average standard deviation of split frequencies: 0.009385
420500 -- [-715.763] (-717.447) (-720.164) (-716.100) * [-714.494] (-714.668) (-715.869) (-716.086) -- 0:00:35
421000 -- (-714.533) (-715.294) (-718.302) [-715.697] * (-716.870) [-714.908] (-717.661) (-720.354) -- 0:00:35
421500 -- (-716.338) [-716.861] (-720.426) (-715.300) * [-716.602] (-716.250) (-714.670) (-717.363) -- 0:00:35
422000 -- (-717.209) (-715.611) [-715.642] (-719.195) * [-717.474] (-718.495) (-715.364) (-719.535) -- 0:00:35
422500 -- (-717.221) [-715.141] (-717.329) (-716.128) * (-722.079) (-715.741) (-715.477) [-717.896] -- 0:00:35
423000 -- (-716.086) (-721.556) (-717.263) [-716.110] * [-719.313] (-717.022) (-714.548) (-715.707) -- 0:00:35
423500 -- [-716.827] (-719.204) (-716.266) (-714.732) * [-715.139] (-717.146) (-714.999) (-715.682) -- 0:00:35
424000 -- (-716.207) [-718.588] (-717.718) (-718.939) * (-714.917) (-719.828) [-714.988] (-716.638) -- 0:00:35
424500 -- (-718.019) (-719.281) [-718.040] (-714.568) * (-717.671) (-717.110) (-717.414) [-716.445] -- 0:00:35
425000 -- [-715.764] (-721.787) (-715.074) (-717.607) * (-717.105) (-717.450) [-715.523] (-715.245) -- 0:00:35
Average standard deviation of split frequencies: 0.008576
425500 -- (-715.199) (-718.554) (-715.069) [-715.956] * (-721.091) [-717.547] (-715.906) (-714.647) -- 0:00:35
426000 -- [-717.146] (-719.120) (-714.407) (-716.160) * (-718.270) [-714.985] (-715.559) (-716.195) -- 0:00:35
426500 -- (-714.616) (-714.802) [-719.556] (-718.436) * (-718.106) (-717.457) (-715.212) [-716.007] -- 0:00:34
427000 -- (-716.269) (-716.285) (-717.537) [-716.616] * (-717.556) (-719.924) (-717.391) [-716.334] -- 0:00:34
427500 -- (-718.496) (-714.982) (-716.195) [-714.751] * (-717.794) (-716.217) (-717.886) [-719.499] -- 0:00:34
428000 -- (-715.395) (-716.152) [-718.703] (-715.235) * (-716.770) (-715.840) (-721.507) [-720.858] -- 0:00:34
428500 -- (-716.876) [-715.454] (-716.948) (-716.238) * (-715.790) (-717.049) [-715.690] (-717.132) -- 0:00:34
429000 -- (-715.916) (-716.701) (-717.886) [-716.546] * [-717.110] (-716.283) (-716.159) (-714.425) -- 0:00:34
429500 -- (-715.831) (-715.157) (-715.800) [-717.417] * (-714.971) (-716.366) [-715.846] (-716.809) -- 0:00:34
430000 -- [-715.185] (-717.208) (-716.622) (-718.396) * (-717.874) (-714.659) [-715.435] (-715.906) -- 0:00:34
Average standard deviation of split frequencies: 0.008894
430500 -- [-715.333] (-717.715) (-717.076) (-717.094) * [-716.895] (-715.770) (-714.504) (-715.433) -- 0:00:34
431000 -- [-715.719] (-716.598) (-727.667) (-719.843) * [-715.539] (-717.745) (-715.758) (-715.424) -- 0:00:35
431500 -- [-715.263] (-716.779) (-716.771) (-715.681) * (-715.772) (-718.394) [-715.387] (-717.822) -- 0:00:35
432000 -- (-718.439) (-717.153) (-718.981) [-716.460] * (-716.329) [-715.368] (-720.990) (-720.560) -- 0:00:35
432500 -- [-716.631] (-714.764) (-714.683) (-716.679) * (-715.212) [-716.321] (-716.865) (-717.502) -- 0:00:35
433000 -- (-715.585) (-715.487) (-718.567) [-716.383] * (-716.392) (-715.283) (-716.140) [-719.613] -- 0:00:35
433500 -- (-714.722) (-717.198) [-715.563] (-716.493) * [-714.696] (-717.077) (-715.781) (-715.568) -- 0:00:35
434000 -- (-717.815) [-714.385] (-714.935) (-717.373) * (-716.465) (-715.788) (-716.236) [-714.243] -- 0:00:35
434500 -- [-717.100] (-715.816) (-718.447) (-716.743) * (-714.862) (-715.603) (-716.618) [-716.498] -- 0:00:35
435000 -- (-716.020) (-714.357) [-718.639] (-715.782) * [-715.707] (-716.932) (-720.481) (-719.206) -- 0:00:35
Average standard deviation of split frequencies: 0.008785
435500 -- [-718.810] (-716.474) (-718.981) (-716.041) * [-714.734] (-715.803) (-719.145) (-717.199) -- 0:00:34
436000 -- [-716.991] (-714.766) (-718.331) (-716.221) * [-714.690] (-714.673) (-718.728) (-718.458) -- 0:00:34
436500 -- [-718.040] (-718.178) (-716.506) (-714.870) * (-719.005) [-714.667] (-714.647) (-718.200) -- 0:00:34
437000 -- (-717.378) (-714.324) [-714.791] (-715.801) * (-717.386) [-718.693] (-715.349) (-716.071) -- 0:00:34
437500 -- (-717.595) (-715.276) (-715.155) [-714.792] * (-717.357) (-715.317) (-719.587) [-717.007] -- 0:00:34
438000 -- (-720.598) (-715.306) (-717.381) [-716.200] * (-716.960) [-718.528] (-715.653) (-716.378) -- 0:00:34
438500 -- (-718.270) [-715.085] (-717.377) (-716.596) * [-715.397] (-714.373) (-716.915) (-716.622) -- 0:00:34
439000 -- (-719.973) (-715.621) [-716.576] (-715.551) * [-716.441] (-714.896) (-721.350) (-715.858) -- 0:00:34
439500 -- [-718.204] (-716.469) (-714.987) (-724.547) * (-716.813) [-715.484] (-716.262) (-716.765) -- 0:00:34
440000 -- (-718.041) (-716.052) [-715.723] (-718.179) * (-714.577) [-715.879] (-716.520) (-718.956) -- 0:00:34
Average standard deviation of split frequencies: 0.008424
440500 -- [-716.623] (-715.746) (-718.951) (-716.356) * (-714.855) (-717.647) (-717.985) [-718.186] -- 0:00:34
441000 -- (-714.718) (-716.708) (-720.149) [-717.008] * (-716.591) (-717.482) (-717.238) [-722.653] -- 0:00:34
441500 -- [-718.814] (-715.497) (-714.993) (-716.040) * [-717.009] (-718.017) (-715.320) (-719.114) -- 0:00:34
442000 -- (-716.535) (-714.594) (-714.493) [-718.054] * [-717.994] (-719.434) (-714.491) (-719.205) -- 0:00:34
442500 -- [-714.374] (-716.755) (-714.343) (-718.795) * (-716.952) (-718.115) [-715.931] (-719.463) -- 0:00:34
443000 -- (-716.508) (-720.738) (-718.089) [-715.187] * [-717.367] (-715.799) (-718.179) (-723.470) -- 0:00:33
443500 -- (-716.476) [-717.058] (-718.673) (-717.708) * (-723.305) [-721.716] (-717.809) (-721.153) -- 0:00:33
444000 -- (-716.364) (-716.980) [-716.404] (-716.760) * (-720.456) (-714.790) (-714.534) [-717.231] -- 0:00:33
444500 -- [-714.981] (-714.878) (-714.260) (-715.106) * [-716.958] (-714.867) (-714.350) (-715.144) -- 0:00:33
445000 -- (-715.105) (-715.189) (-717.714) [-714.719] * (-716.642) [-716.470] (-717.085) (-715.958) -- 0:00:33
Average standard deviation of split frequencies: 0.008456
445500 -- (-715.588) (-718.199) (-715.158) [-718.618] * [-715.218] (-719.207) (-715.974) (-715.963) -- 0:00:33
446000 -- [-717.385] (-718.648) (-719.777) (-716.168) * [-719.978] (-718.712) (-716.912) (-719.295) -- 0:00:33
446500 -- (-716.984) (-718.457) (-715.977) [-714.954] * [-718.562] (-715.752) (-717.123) (-717.094) -- 0:00:33
447000 -- (-718.224) (-714.452) (-719.008) [-714.912] * (-717.971) [-718.191] (-717.828) (-715.249) -- 0:00:33
447500 -- (-718.247) (-714.543) (-717.651) [-716.674] * (-720.967) [-717.626] (-719.502) (-715.562) -- 0:00:34
448000 -- [-716.942] (-715.901) (-717.017) (-717.738) * (-716.961) (-720.831) (-716.313) [-718.414] -- 0:00:34
448500 -- (-715.353) [-716.100] (-716.104) (-715.694) * (-715.014) (-716.346) [-717.217] (-717.118) -- 0:00:34
449000 -- (-716.205) [-716.453] (-716.339) (-716.189) * [-714.874] (-717.469) (-714.517) (-715.056) -- 0:00:34
449500 -- (-716.419) (-717.231) (-715.612) [-717.959] * [-715.026] (-715.419) (-718.650) (-719.175) -- 0:00:34
450000 -- (-715.708) [-714.667] (-718.558) (-715.368) * (-716.040) [-717.404] (-717.528) (-718.973) -- 0:00:34
Average standard deviation of split frequencies: 0.008826
450500 -- (-715.322) (-715.489) (-716.385) [-718.734] * (-716.176) (-716.842) [-715.213] (-715.437) -- 0:00:34
451000 -- [-715.804] (-717.347) (-717.701) (-716.397) * (-716.010) [-715.886] (-718.593) (-719.415) -- 0:00:34
451500 -- (-717.179) [-715.131] (-719.520) (-718.869) * [-716.354] (-717.773) (-714.898) (-715.711) -- 0:00:34
452000 -- (-717.044) (-714.752) [-723.595] (-718.241) * (-716.050) (-717.593) (-716.739) [-715.414] -- 0:00:33
452500 -- (-717.183) (-720.019) (-716.448) [-716.194] * (-717.048) [-718.091] (-717.711) (-717.728) -- 0:00:33
453000 -- [-714.845] (-720.183) (-718.621) (-716.386) * (-715.558) (-717.812) (-718.862) [-716.447] -- 0:00:33
453500 -- (-714.845) [-717.045] (-722.890) (-716.040) * (-715.932) (-717.205) (-720.400) [-716.118] -- 0:00:33
454000 -- (-715.477) (-717.794) (-716.259) [-717.336] * (-716.287) [-715.861] (-722.792) (-714.982) -- 0:00:33
454500 -- (-719.087) (-715.460) (-721.171) [-715.866] * (-716.857) (-714.885) (-715.875) [-719.537] -- 0:00:33
455000 -- [-714.661] (-719.459) (-720.259) (-719.217) * [-715.508] (-722.166) (-717.394) (-719.879) -- 0:00:33
Average standard deviation of split frequencies: 0.008852
455500 -- (-714.728) (-719.752) (-717.116) [-717.953] * (-716.108) (-715.098) (-716.010) [-716.438] -- 0:00:33
456000 -- (-719.743) (-716.319) (-720.606) [-722.674] * (-718.561) (-717.916) (-717.153) [-716.167] -- 0:00:33
456500 -- (-717.803) (-717.873) (-717.279) [-716.529] * [-716.998] (-715.289) (-720.035) (-716.142) -- 0:00:33
457000 -- (-715.039) [-716.303] (-718.255) (-715.268) * (-715.319) [-716.096] (-721.397) (-715.110) -- 0:00:33
457500 -- (-716.524) (-716.834) (-715.512) [-717.405] * (-714.939) (-714.830) (-718.070) [-715.757] -- 0:00:33
458000 -- (-715.102) (-722.943) [-714.604] (-717.020) * (-718.146) (-714.784) (-715.466) [-716.875] -- 0:00:33
458500 -- (-717.063) [-716.668] (-717.630) (-715.818) * (-718.361) (-717.583) (-719.128) [-716.367] -- 0:00:33
459000 -- [-715.349] (-720.631) (-717.914) (-715.530) * [-716.513] (-716.497) (-718.457) (-714.761) -- 0:00:33
459500 -- [-716.296] (-717.824) (-718.442) (-715.351) * (-717.261) (-720.500) (-716.682) [-715.059] -- 0:00:32
460000 -- (-714.543) (-717.180) (-719.475) [-719.548] * (-720.514) (-717.114) [-717.903] (-716.372) -- 0:00:32
Average standard deviation of split frequencies: 0.009402
460500 -- [-716.278] (-720.367) (-719.876) (-715.569) * (-716.309) (-718.293) (-717.282) [-716.515] -- 0:00:32
461000 -- (-715.169) [-718.943] (-716.739) (-716.656) * [-715.123] (-718.682) (-717.994) (-715.487) -- 0:00:32
461500 -- (-716.381) [-716.663] (-717.489) (-716.818) * [-715.797] (-716.612) (-716.358) (-717.245) -- 0:00:32
462000 -- [-715.452] (-719.841) (-715.731) (-717.443) * (-716.873) (-721.026) (-716.226) [-716.208] -- 0:00:32
462500 -- (-720.021) (-715.542) [-715.972] (-717.896) * (-715.868) (-717.487) [-716.256] (-721.314) -- 0:00:32
463000 -- (-715.442) [-714.312] (-715.550) (-715.103) * (-717.895) (-721.327) (-719.313) [-716.742] -- 0:00:32
463500 -- (-715.507) (-717.064) (-719.754) [-716.314] * (-720.252) (-717.702) (-719.827) [-714.787] -- 0:00:32
464000 -- (-715.210) (-719.015) (-716.175) [-723.022] * (-719.007) (-718.069) [-715.283] (-717.328) -- 0:00:32
464500 -- (-715.935) [-715.607] (-715.226) (-719.430) * (-717.089) (-718.983) [-717.366] (-715.242) -- 0:00:33
465000 -- (-718.729) (-715.352) [-716.046] (-719.081) * (-719.939) (-717.136) [-718.777] (-715.754) -- 0:00:33
Average standard deviation of split frequencies: 0.009357
465500 -- (-714.576) [-716.299] (-717.545) (-718.194) * (-720.407) (-717.218) [-716.666] (-716.898) -- 0:00:33
466000 -- [-714.999] (-719.372) (-716.176) (-715.519) * (-718.820) [-716.779] (-716.183) (-716.307) -- 0:00:33
466500 -- (-714.469) [-716.530] (-719.860) (-716.861) * (-717.879) [-716.353] (-717.862) (-717.331) -- 0:00:33
467000 -- (-714.772) (-715.976) [-717.247] (-716.207) * (-719.030) (-716.118) [-716.684] (-715.660) -- 0:00:33
467500 -- [-717.063] (-714.425) (-717.725) (-719.061) * (-717.274) [-717.142] (-716.433) (-719.666) -- 0:00:33
468000 -- [-717.996] (-715.261) (-715.819) (-715.757) * [-717.609] (-717.948) (-716.690) (-715.785) -- 0:00:32
468500 -- (-716.615) (-718.288) [-715.687] (-715.184) * (-714.707) (-717.832) [-714.261] (-716.468) -- 0:00:32
469000 -- (-716.871) (-716.082) (-715.050) [-714.798] * (-714.683) (-717.668) (-714.836) [-716.163] -- 0:00:32
469500 -- (-716.764) (-716.139) (-715.733) [-714.496] * (-715.007) [-718.617] (-717.842) (-715.577) -- 0:00:32
470000 -- (-716.873) (-720.847) (-716.815) [-717.297] * [-714.968] (-719.782) (-715.451) (-714.407) -- 0:00:32
Average standard deviation of split frequencies: 0.009640
470500 -- (-715.765) (-716.622) [-717.760] (-719.081) * (-716.549) (-714.971) (-715.978) [-719.051] -- 0:00:32
471000 -- (-717.572) (-715.589) [-720.024] (-717.752) * [-717.381] (-722.271) (-722.567) (-720.931) -- 0:00:32
471500 -- (-723.754) (-715.387) [-715.650] (-718.234) * (-720.152) [-717.388] (-720.594) (-716.757) -- 0:00:32
472000 -- (-718.048) (-716.882) (-716.114) [-719.589] * (-717.479) (-717.937) (-716.693) [-717.713] -- 0:00:32
472500 -- [-717.405] (-716.495) (-715.441) (-716.279) * [-720.585] (-716.003) (-722.451) (-716.626) -- 0:00:32
473000 -- (-718.672) (-715.221) (-716.496) [-714.976] * (-715.594) (-717.355) [-715.630] (-715.849) -- 0:00:32
473500 -- (-721.935) (-715.251) [-716.370] (-716.887) * (-720.034) (-717.433) (-715.731) [-716.628] -- 0:00:32
474000 -- (-717.448) (-717.980) [-717.401] (-717.891) * (-715.910) (-718.455) (-716.646) [-716.309] -- 0:00:32
474500 -- (-717.146) (-720.096) (-718.882) [-716.170] * (-717.352) [-715.179] (-716.210) (-718.010) -- 0:00:32
475000 -- (-717.269) [-718.873] (-717.863) (-716.888) * (-716.042) [-715.470] (-717.513) (-715.273) -- 0:00:32
Average standard deviation of split frequencies: 0.010027
475500 -- (-717.981) [-717.020] (-718.808) (-715.908) * (-719.815) [-715.215] (-715.842) (-715.513) -- 0:00:31
476000 -- (-716.510) [-715.359] (-715.343) (-716.238) * [-717.915] (-715.499) (-717.090) (-716.554) -- 0:00:31
476500 -- (-716.103) (-716.633) [-715.667] (-717.856) * (-719.259) [-716.642] (-715.614) (-717.076) -- 0:00:31
477000 -- [-715.590] (-717.135) (-716.810) (-716.684) * (-718.459) [-715.659] (-715.702) (-718.495) -- 0:00:31
477500 -- (-722.411) [-717.094] (-715.562) (-714.818) * (-716.981) [-715.584] (-714.800) (-718.328) -- 0:00:31
478000 -- (-718.287) (-717.076) [-715.460] (-715.921) * (-717.043) (-715.925) (-716.718) [-716.179] -- 0:00:31
478500 -- (-715.533) (-716.023) (-716.521) [-716.255] * (-719.333) (-718.223) (-717.018) [-715.405] -- 0:00:31
479000 -- (-719.408) [-716.835] (-718.916) (-715.285) * (-716.180) (-715.983) (-717.267) [-716.611] -- 0:00:31
479500 -- (-716.751) [-716.093] (-718.958) (-717.473) * (-719.048) (-717.129) [-715.204] (-720.929) -- 0:00:31
480000 -- [-715.501] (-721.066) (-716.420) (-714.896) * [-715.792] (-717.558) (-716.202) (-719.270) -- 0:00:31
Average standard deviation of split frequencies: 0.010114
480500 -- (-716.087) (-714.289) [-716.513] (-719.183) * (-719.132) (-716.510) [-717.090] (-717.183) -- 0:00:31
481000 -- (-717.028) (-715.186) [-715.013] (-714.864) * (-719.970) [-714.686] (-716.475) (-719.192) -- 0:00:32
481500 -- (-717.854) (-716.660) [-716.059] (-717.712) * [-716.573] (-716.823) (-718.451) (-718.706) -- 0:00:32
482000 -- (-715.885) (-716.001) [-715.889] (-717.366) * (-716.047) (-715.645) (-715.685) [-715.963] -- 0:00:32
482500 -- (-716.817) [-717.493] (-719.039) (-717.495) * (-714.962) [-717.488] (-714.396) (-716.343) -- 0:00:32
483000 -- (-715.834) [-715.816] (-716.940) (-715.639) * (-717.269) [-717.966] (-715.550) (-716.777) -- 0:00:32
483500 -- (-716.180) (-715.095) [-714.333] (-718.194) * (-715.123) (-717.233) (-715.323) [-716.646] -- 0:00:32
484000 -- (-716.898) [-715.008] (-718.216) (-715.284) * (-715.725) [-717.760] (-717.126) (-715.551) -- 0:00:31
484500 -- (-715.429) [-715.682] (-719.546) (-715.967) * [-716.316] (-715.551) (-721.017) (-715.606) -- 0:00:31
485000 -- [-717.632] (-716.573) (-724.382) (-715.818) * (-717.802) (-717.091) [-721.596] (-716.462) -- 0:00:31
Average standard deviation of split frequencies: 0.010605
485500 -- (-718.985) (-716.156) [-714.796] (-715.470) * (-715.109) [-715.397] (-720.672) (-714.838) -- 0:00:31
486000 -- (-716.563) [-714.871] (-716.963) (-720.525) * (-715.332) (-720.352) [-718.273] (-717.738) -- 0:00:31
486500 -- [-715.170] (-717.079) (-714.630) (-715.601) * (-716.102) [-716.174] (-717.579) (-718.788) -- 0:00:31
487000 -- (-717.839) (-715.900) [-715.941] (-715.511) * (-721.718) (-716.554) (-717.557) [-718.909] -- 0:00:31
487500 -- [-715.102] (-715.420) (-717.761) (-720.684) * (-720.846) (-716.918) [-717.462] (-716.074) -- 0:00:31
488000 -- (-719.395) (-718.156) (-715.575) [-717.209] * [-715.592] (-717.376) (-717.109) (-714.995) -- 0:00:31
488500 -- (-720.828) [-718.111] (-717.315) (-715.578) * (-717.927) (-717.035) [-717.613] (-719.153) -- 0:00:31
489000 -- (-719.109) (-719.752) [-716.999] (-718.714) * (-717.903) [-715.626] (-718.219) (-718.443) -- 0:00:31
489500 -- (-721.707) (-717.426) [-716.671] (-718.880) * (-716.967) [-715.906] (-722.163) (-717.027) -- 0:00:31
490000 -- (-719.185) (-718.033) (-717.809) [-716.199] * (-715.970) [-716.789] (-718.560) (-716.213) -- 0:00:31
Average standard deviation of split frequencies: 0.010376
490500 -- (-715.572) (-719.335) (-718.593) [-716.282] * (-720.062) [-716.961] (-716.472) (-717.994) -- 0:00:31
491000 -- [-715.663] (-716.899) (-716.249) (-717.720) * (-714.883) (-716.232) (-716.826) [-716.855] -- 0:00:31
491500 -- (-721.387) [-717.761] (-716.723) (-716.519) * (-714.996) (-716.012) [-715.826] (-715.522) -- 0:00:31
492000 -- [-716.745] (-716.221) (-717.119) (-715.561) * (-716.224) (-717.590) (-718.470) [-716.015] -- 0:00:30
492500 -- [-717.269] (-717.313) (-717.265) (-715.559) * (-715.929) (-717.934) [-715.307] (-715.636) -- 0:00:30
493000 -- (-715.192) (-719.127) [-715.971] (-717.077) * [-715.463] (-717.152) (-715.871) (-716.324) -- 0:00:30
493500 -- (-717.114) (-723.051) [-714.529] (-714.839) * (-715.156) (-720.657) [-717.786] (-716.311) -- 0:00:30
494000 -- [-715.438] (-714.960) (-715.248) (-715.761) * [-715.916] (-717.132) (-717.898) (-717.482) -- 0:00:30
494500 -- (-716.146) (-720.867) (-717.287) [-716.333] * (-717.730) (-716.629) (-714.673) [-716.132] -- 0:00:30
495000 -- (-714.625) [-716.149] (-716.894) (-717.205) * (-715.927) (-714.740) [-715.810] (-714.615) -- 0:00:30
Average standard deviation of split frequencies: 0.009504
495500 -- [-716.211] (-717.985) (-717.589) (-716.903) * [-715.283] (-715.276) (-717.355) (-714.907) -- 0:00:30
496000 -- [-718.921] (-715.876) (-715.686) (-716.416) * (-717.898) [-716.823] (-717.253) (-715.257) -- 0:00:30
496500 -- (-714.799) (-715.900) [-716.482] (-717.277) * (-715.841) (-721.430) (-719.883) [-716.003] -- 0:00:30
497000 -- [-715.551] (-718.552) (-716.024) (-718.402) * (-720.887) (-718.710) (-716.138) [-716.170] -- 0:00:30
497500 -- (-717.587) [-715.590] (-717.738) (-716.195) * (-717.883) (-718.957) [-716.166] (-715.653) -- 0:00:31
498000 -- (-717.082) (-722.819) (-719.686) [-716.524] * (-715.410) [-718.806] (-717.269) (-715.774) -- 0:00:31
498500 -- (-716.791) (-715.124) (-719.860) [-717.218] * (-715.994) [-716.202] (-715.490) (-715.663) -- 0:00:31
499000 -- (-716.135) (-714.914) [-716.302] (-715.465) * [-715.992] (-715.633) (-714.532) (-715.906) -- 0:00:31
499500 -- (-716.844) (-718.082) [-716.311] (-715.882) * [-715.571] (-715.308) (-714.944) (-721.069) -- 0:00:31
500000 -- (-716.873) (-718.574) (-719.140) [-716.966] * (-716.551) (-715.494) [-714.950] (-720.003) -- 0:00:31
Average standard deviation of split frequencies: 0.009416
500500 -- (-723.845) [-715.701] (-715.801) (-718.180) * (-716.141) (-716.958) [-717.143] (-716.855) -- 0:00:30
501000 -- [-717.815] (-721.970) (-715.114) (-723.468) * (-714.494) (-718.969) (-718.275) [-715.384] -- 0:00:30
501500 -- [-715.987] (-720.174) (-718.556) (-718.340) * [-719.040] (-715.197) (-716.663) (-715.940) -- 0:00:30
502000 -- (-718.654) [-715.676] (-717.734) (-720.334) * (-722.646) (-717.229) (-715.448) [-715.622] -- 0:00:30
502500 -- [-717.200] (-716.822) (-714.918) (-715.643) * (-718.260) (-715.977) (-719.572) [-717.820] -- 0:00:30
503000 -- [-716.751] (-715.699) (-718.850) (-718.414) * (-717.488) (-716.823) [-718.494] (-720.660) -- 0:00:30
503500 -- [-715.944] (-718.822) (-715.331) (-716.504) * (-715.649) (-715.861) (-717.975) [-716.440] -- 0:00:30
504000 -- (-719.590) [-715.092] (-717.630) (-716.396) * (-717.125) [-715.219] (-720.605) (-714.761) -- 0:00:30
504500 -- (-715.099) (-716.557) (-715.920) [-716.762] * [-718.774] (-717.556) (-719.250) (-715.761) -- 0:00:30
505000 -- (-716.822) [-715.877] (-715.295) (-714.694) * (-717.787) [-716.204] (-717.248) (-716.708) -- 0:00:30
Average standard deviation of split frequencies: 0.008559
505500 -- [-716.649] (-716.969) (-716.159) (-715.926) * (-714.625) (-714.181) [-716.725] (-718.190) -- 0:00:30
506000 -- (-715.764) [-717.364] (-716.295) (-715.910) * (-719.475) (-715.502) [-717.043] (-716.571) -- 0:00:30
506500 -- [-718.271] (-715.940) (-718.939) (-715.262) * (-715.702) (-717.315) [-717.094] (-715.234) -- 0:00:30
507000 -- (-718.879) (-715.274) [-715.772] (-717.955) * (-715.352) [-715.202] (-716.226) (-717.878) -- 0:00:30
507500 -- [-716.892] (-714.523) (-718.458) (-717.512) * [-719.363] (-715.365) (-716.539) (-718.618) -- 0:00:30
508000 -- (-714.433) [-714.528] (-716.877) (-722.982) * (-719.141) (-718.824) (-714.375) [-727.009] -- 0:00:30
508500 -- (-717.001) [-715.512] (-716.319) (-718.283) * (-717.657) (-716.106) [-720.258] (-723.615) -- 0:00:29
509000 -- [-716.195] (-715.010) (-717.919) (-715.899) * [-714.970] (-716.299) (-722.006) (-716.876) -- 0:00:29
509500 -- (-715.685) (-716.141) (-719.187) [-715.810] * [-714.519] (-714.542) (-716.220) (-720.953) -- 0:00:29
510000 -- [-717.153] (-724.623) (-717.558) (-716.805) * (-716.935) (-716.439) [-716.328] (-714.941) -- 0:00:29
Average standard deviation of split frequencies: 0.008885
510500 -- (-715.826) [-716.167] (-715.755) (-718.157) * (-716.858) (-719.099) (-716.047) [-715.993] -- 0:00:29
511000 -- (-716.051) (-715.556) (-716.047) [-716.280] * (-715.892) [-715.166] (-716.829) (-716.279) -- 0:00:29
511500 -- [-715.892] (-716.177) (-717.694) (-718.689) * (-718.716) (-714.976) (-715.859) [-715.517] -- 0:00:29
512000 -- (-718.862) [-717.626] (-716.276) (-717.757) * (-719.099) [-717.040] (-719.892) (-715.650) -- 0:00:29
512500 -- (-719.973) (-716.978) (-722.185) [-715.989] * (-717.029) [-718.040] (-716.634) (-717.628) -- 0:00:29
513000 -- (-715.169) (-718.783) [-715.541] (-721.579) * (-716.703) (-717.985) [-714.993] (-721.855) -- 0:00:29
513500 -- [-716.660] (-718.933) (-714.469) (-717.167) * (-715.613) (-717.762) (-719.275) [-717.737] -- 0:00:29
514000 -- [-717.527] (-717.470) (-717.328) (-715.719) * (-715.022) (-718.782) (-721.953) [-715.526] -- 0:00:30
514500 -- [-717.070] (-714.785) (-714.931) (-717.369) * [-716.872] (-715.065) (-715.406) (-719.503) -- 0:00:30
515000 -- (-716.734) [-714.789] (-717.404) (-718.326) * (-715.965) [-715.913] (-716.917) (-715.662) -- 0:00:30
Average standard deviation of split frequencies: 0.008964
515500 -- (-717.290) (-719.589) (-716.618) [-715.811] * [-716.913] (-714.646) (-717.522) (-716.548) -- 0:00:30
516000 -- (-716.850) (-715.764) [-718.127] (-715.351) * [-718.780] (-716.676) (-716.890) (-714.883) -- 0:00:30
516500 -- [-715.812] (-714.442) (-720.148) (-716.509) * (-715.069) (-715.147) (-714.548) [-719.789] -- 0:00:29
517000 -- (-717.542) (-714.442) (-716.995) [-717.700] * (-717.275) (-714.554) [-715.432] (-715.878) -- 0:00:29
517500 -- (-715.685) [-714.666] (-717.364) (-717.750) * (-717.002) (-715.336) (-716.981) [-716.294] -- 0:00:29
518000 -- (-716.450) (-714.823) [-715.110] (-716.384) * (-715.855) [-714.847] (-717.900) (-715.465) -- 0:00:29
518500 -- (-717.308) (-715.125) [-715.945] (-721.831) * [-716.674] (-718.224) (-716.404) (-718.198) -- 0:00:29
519000 -- (-715.534) [-715.575] (-715.482) (-723.569) * [-717.306] (-717.646) (-718.852) (-717.596) -- 0:00:29
519500 -- [-717.150] (-715.889) (-716.646) (-717.592) * (-715.293) (-718.392) [-720.030] (-719.401) -- 0:00:29
520000 -- [-717.166] (-718.592) (-715.618) (-716.022) * [-717.336] (-719.661) (-718.806) (-715.900) -- 0:00:29
Average standard deviation of split frequencies: 0.008884
520500 -- (-722.615) (-717.142) (-716.190) [-716.069] * (-718.028) (-715.147) (-714.230) [-714.827] -- 0:00:29
521000 -- (-719.631) [-715.614] (-715.470) (-716.710) * (-717.487) (-719.094) [-716.225] (-714.694) -- 0:00:29
521500 -- (-717.207) [-714.336] (-716.432) (-715.452) * (-714.931) (-715.248) (-716.126) [-714.690] -- 0:00:29
522000 -- (-715.817) (-717.715) [-716.697] (-716.258) * [-716.408] (-716.189) (-718.448) (-716.101) -- 0:00:29
522500 -- [-716.503] (-719.950) (-717.460) (-720.106) * (-716.365) [-715.292] (-716.354) (-716.475) -- 0:00:29
523000 -- (-715.436) (-715.142) (-720.417) [-714.777] * (-716.111) [-717.106] (-720.410) (-718.090) -- 0:00:29
523500 -- (-715.773) [-718.746] (-716.330) (-717.447) * (-719.109) (-714.675) (-715.900) [-715.225] -- 0:00:29
524000 -- (-715.689) (-719.558) (-718.007) [-718.269] * (-715.253) (-717.391) [-715.221] (-717.148) -- 0:00:29
524500 -- (-717.163) (-720.206) (-715.302) [-719.314] * (-716.433) (-715.289) (-718.428) [-716.095] -- 0:00:29
525000 -- [-716.795] (-715.070) (-716.551) (-720.163) * (-714.764) [-715.714] (-719.328) (-715.989) -- 0:00:28
Average standard deviation of split frequencies: 0.008794
525500 -- [-717.322] (-718.969) (-718.299) (-714.541) * (-716.159) [-717.305] (-722.993) (-715.508) -- 0:00:28
526000 -- (-718.671) [-715.598] (-720.221) (-717.614) * [-717.172] (-717.287) (-720.605) (-715.498) -- 0:00:28
526500 -- [-716.199] (-718.249) (-718.587) (-715.539) * (-715.814) [-715.381] (-715.366) (-715.891) -- 0:00:28
527000 -- (-715.580) (-716.531) [-715.046] (-717.890) * (-714.907) [-716.169] (-715.769) (-718.774) -- 0:00:28
527500 -- (-718.598) (-717.314) (-717.709) [-715.920] * (-717.426) (-716.162) [-716.786] (-717.134) -- 0:00:28
528000 -- (-718.246) (-715.460) [-715.624] (-718.214) * (-716.582) (-716.066) [-715.807] (-717.721) -- 0:00:28
528500 -- (-717.191) (-716.246) (-715.064) [-720.345] * (-716.399) (-715.622) [-716.875] (-718.006) -- 0:00:28
529000 -- (-718.398) (-717.561) [-718.607] (-717.091) * (-718.710) [-718.260] (-716.082) (-714.956) -- 0:00:29
529500 -- (-715.843) [-717.943] (-716.507) (-720.430) * (-719.576) (-719.667) [-717.722] (-718.871) -- 0:00:29
530000 -- [-718.248] (-717.887) (-715.436) (-724.530) * (-716.250) (-715.850) (-716.199) [-715.615] -- 0:00:29
Average standard deviation of split frequencies: 0.009494
530500 -- [-716.037] (-715.824) (-716.033) (-718.961) * (-716.579) [-720.416] (-717.676) (-715.961) -- 0:00:29
531000 -- (-718.043) [-715.977] (-715.567) (-716.467) * [-715.082] (-722.034) (-715.070) (-715.286) -- 0:00:29
531500 -- [-716.231] (-716.358) (-719.675) (-717.392) * (-716.553) (-715.663) (-717.421) [-715.201] -- 0:00:29
532000 -- (-715.706) (-715.700) (-716.079) [-716.214] * (-716.361) (-716.350) [-714.940] (-717.185) -- 0:00:29
532500 -- (-714.914) (-716.356) [-716.223] (-722.684) * [-718.250] (-717.238) (-715.560) (-717.832) -- 0:00:28
533000 -- [-714.937] (-714.579) (-715.528) (-720.967) * [-716.219] (-717.296) (-718.932) (-720.088) -- 0:00:28
533500 -- [-716.027] (-717.633) (-720.011) (-714.716) * (-716.396) [-722.039] (-716.712) (-720.962) -- 0:00:28
534000 -- [-716.100] (-719.176) (-716.763) (-714.698) * (-716.224) [-714.547] (-717.516) (-715.649) -- 0:00:28
534500 -- (-715.894) [-717.036] (-715.312) (-715.990) * [-715.697] (-714.214) (-715.059) (-714.857) -- 0:00:28
535000 -- (-721.266) (-714.658) (-716.849) [-715.910] * (-716.415) [-715.763] (-716.115) (-715.843) -- 0:00:28
Average standard deviation of split frequencies: 0.009454
535500 -- (-715.161) (-714.718) [-716.742] (-715.778) * (-720.455) [-715.777] (-714.641) (-715.350) -- 0:00:28
536000 -- (-716.606) [-717.672] (-715.798) (-716.474) * (-718.045) (-715.879) [-715.055] (-715.102) -- 0:00:28
536500 -- (-723.599) [-717.119] (-716.312) (-717.914) * (-715.761) (-718.597) [-715.750] (-714.821) -- 0:00:28
537000 -- [-719.692] (-717.574) (-716.514) (-720.196) * (-714.381) (-717.601) (-717.877) [-717.132] -- 0:00:28
537500 -- (-719.851) (-718.726) [-715.341] (-716.298) * (-717.386) (-718.317) (-715.417) [-719.477] -- 0:00:28
538000 -- (-724.372) (-721.797) (-719.081) [-715.063] * (-718.829) (-721.785) (-714.991) [-715.107] -- 0:00:28
538500 -- (-716.448) (-717.367) (-720.108) [-715.917] * (-715.797) [-716.041] (-717.127) (-714.348) -- 0:00:28
539000 -- (-718.408) (-719.930) (-718.332) [-716.781] * (-718.095) (-718.967) [-716.405] (-716.547) -- 0:00:28
539500 -- (-715.689) (-716.969) [-715.145] (-718.946) * (-719.386) (-715.854) [-715.242] (-716.496) -- 0:00:28
540000 -- (-714.271) [-715.397] (-715.827) (-715.762) * (-717.981) (-719.893) [-718.288] (-715.487) -- 0:00:28
Average standard deviation of split frequencies: 0.009645
540500 -- [-716.186] (-718.689) (-716.627) (-716.099) * (-717.270) (-717.539) (-716.802) [-716.309] -- 0:00:28
541000 -- (-716.086) (-715.952) [-715.379] (-715.210) * [-716.078] (-718.479) (-716.548) (-717.599) -- 0:00:27
541500 -- (-716.105) (-714.917) [-715.594] (-717.696) * (-715.451) (-716.586) [-715.945] (-717.194) -- 0:00:27
542000 -- (-718.068) (-715.197) [-716.948] (-716.233) * (-714.947) [-715.964] (-718.577) (-717.880) -- 0:00:27
542500 -- (-715.952) (-716.227) [-715.806] (-715.240) * [-715.154] (-717.677) (-717.826) (-720.173) -- 0:00:27
543000 -- (-717.756) (-715.720) [-715.745] (-715.530) * (-714.778) (-718.117) (-716.558) [-716.509] -- 0:00:27
543500 -- (-714.956) (-718.415) [-715.102] (-715.324) * (-714.767) (-716.320) (-718.399) [-714.703] -- 0:00:27
544000 -- [-716.588] (-716.395) (-716.791) (-720.364) * (-720.456) [-715.285] (-717.664) (-716.767) -- 0:00:27
544500 -- (-721.936) (-715.441) (-716.128) [-717.614] * (-717.098) [-715.839] (-714.942) (-718.433) -- 0:00:27
545000 -- (-717.910) [-715.865] (-715.476) (-726.201) * (-716.759) (-718.056) (-715.459) [-715.265] -- 0:00:27
Average standard deviation of split frequencies: 0.009551
545500 -- (-718.540) (-714.972) (-717.808) [-714.582] * (-718.870) [-715.498] (-715.663) (-714.458) -- 0:00:28
546000 -- (-717.134) (-715.617) [-717.747] (-718.777) * (-714.577) [-716.041] (-715.948) (-714.859) -- 0:00:28
546500 -- (-714.993) [-717.445] (-717.062) (-715.859) * [-718.571] (-715.602) (-716.427) (-722.983) -- 0:00:28
547000 -- (-717.149) [-718.640] (-717.109) (-716.406) * (-717.513) [-714.347] (-721.796) (-719.143) -- 0:00:28
547500 -- [-718.473] (-717.530) (-717.058) (-715.799) * (-715.664) (-715.696) [-717.770] (-717.059) -- 0:00:28
548000 -- [-720.476] (-717.027) (-717.864) (-718.783) * [-714.943] (-715.285) (-718.234) (-717.071) -- 0:00:28
548500 -- (-716.697) (-717.605) [-715.654] (-714.804) * (-716.187) (-717.054) (-719.277) [-715.448] -- 0:00:27
549000 -- (-722.911) (-718.658) (-718.075) [-715.274] * (-716.724) (-718.180) [-716.904] (-715.607) -- 0:00:27
549500 -- (-720.630) (-719.258) (-720.350) [-718.357] * (-714.658) (-716.921) (-718.778) [-716.646] -- 0:00:27
550000 -- (-716.875) (-717.999) (-722.122) [-717.870] * (-714.756) [-715.073] (-717.299) (-714.971) -- 0:00:27
Average standard deviation of split frequencies: 0.008828
550500 -- [-714.689] (-715.208) (-720.627) (-715.430) * (-715.110) [-715.096] (-717.768) (-714.994) -- 0:00:27
551000 -- (-717.637) [-715.127] (-721.606) (-716.377) * (-715.606) (-715.720) [-716.537] (-716.622) -- 0:00:27
551500 -- [-717.849] (-714.899) (-720.146) (-716.173) * [-716.659] (-716.719) (-719.954) (-716.419) -- 0:00:27
552000 -- (-718.055) (-715.126) [-720.945] (-717.204) * [-717.245] (-716.114) (-718.301) (-718.887) -- 0:00:27
552500 -- (-714.832) (-716.104) (-715.149) [-716.967] * (-716.424) [-716.714] (-716.017) (-717.782) -- 0:00:27
553000 -- (-716.531) [-715.575] (-716.355) (-714.611) * [-714.623] (-716.256) (-716.463) (-714.990) -- 0:00:27
553500 -- [-714.450] (-716.715) (-720.887) (-715.960) * (-719.367) (-716.432) (-718.493) [-715.014] -- 0:00:27
554000 -- (-715.444) (-716.513) (-716.221) [-717.447] * (-720.622) [-716.287] (-721.992) (-721.513) -- 0:00:27
554500 -- (-714.685) (-715.974) [-715.247] (-716.191) * [-717.162] (-716.530) (-716.072) (-717.257) -- 0:00:27
555000 -- (-715.878) [-715.434] (-715.623) (-715.512) * (-719.274) (-716.230) (-715.691) [-715.664] -- 0:00:27
Average standard deviation of split frequencies: 0.008214
555500 -- [-715.250] (-715.178) (-715.872) (-716.915) * (-722.259) [-715.893] (-715.447) (-717.343) -- 0:00:27
556000 -- (-715.707) (-715.037) [-715.128] (-715.407) * (-716.342) [-716.890] (-718.061) (-719.046) -- 0:00:27
556500 -- (-715.201) [-715.097] (-717.782) (-718.885) * (-714.646) [-717.471] (-717.240) (-717.295) -- 0:00:27
557000 -- [-715.931] (-715.957) (-715.881) (-715.697) * (-714.873) (-715.183) (-716.151) [-716.468] -- 0:00:27
557500 -- (-717.081) (-714.963) [-719.580] (-715.081) * [-715.271] (-714.487) (-718.213) (-717.792) -- 0:00:26
558000 -- (-714.438) [-718.888] (-720.833) (-717.248) * (-716.100) [-715.746] (-722.616) (-716.334) -- 0:00:26
558500 -- (-715.797) [-715.799] (-717.806) (-717.793) * [-715.924] (-717.623) (-723.204) (-715.438) -- 0:00:26
559000 -- (-719.832) (-714.651) [-716.905] (-716.936) * [-715.859] (-715.744) (-718.629) (-717.296) -- 0:00:26
559500 -- (-720.343) (-719.889) (-717.482) [-714.966] * (-715.856) (-716.150) [-719.658] (-715.822) -- 0:00:26
560000 -- (-716.537) (-715.241) [-716.685] (-714.422) * (-719.743) [-715.300] (-716.650) (-716.635) -- 0:00:26
Average standard deviation of split frequencies: 0.007935
560500 -- (-717.749) (-715.219) [-716.688] (-717.500) * (-721.161) [-715.376] (-717.817) (-721.960) -- 0:00:26
561000 -- (-715.892) (-718.137) [-718.489] (-718.886) * (-720.766) (-716.055) (-716.972) [-714.208] -- 0:00:26
561500 -- (-715.995) (-720.071) [-714.814] (-717.786) * (-716.228) (-715.913) (-715.939) [-715.134] -- 0:00:27
562000 -- [-716.848] (-716.619) (-714.815) (-718.644) * (-715.343) (-717.046) [-718.025] (-714.358) -- 0:00:27
562500 -- (-716.114) (-715.946) [-718.996] (-716.426) * [-715.176] (-719.482) (-718.701) (-715.228) -- 0:00:27
563000 -- (-716.824) (-715.107) [-719.749] (-714.944) * (-719.263) [-719.571] (-716.170) (-715.189) -- 0:00:27
563500 -- (-715.536) (-714.600) [-717.451] (-719.706) * (-715.538) (-715.263) [-715.303] (-716.584) -- 0:00:27
564000 -- (-717.485) [-718.869] (-715.639) (-716.256) * (-717.934) (-717.072) (-717.407) [-715.891] -- 0:00:27
564500 -- [-716.422] (-715.622) (-714.805) (-717.334) * (-718.796) (-715.548) (-715.877) [-715.443] -- 0:00:27
565000 -- (-716.515) (-716.917) [-715.943] (-716.233) * (-716.354) [-719.257] (-717.710) (-716.340) -- 0:00:26
Average standard deviation of split frequencies: 0.008173
565500 -- [-715.981] (-718.180) (-717.250) (-717.426) * [-714.728] (-716.910) (-715.100) (-714.800) -- 0:00:26
566000 -- (-717.668) (-716.717) (-719.000) [-717.519] * (-718.020) [-717.070] (-716.433) (-717.079) -- 0:00:26
566500 -- (-715.567) (-718.348) (-715.111) [-715.748] * (-718.043) [-719.523] (-714.730) (-716.946) -- 0:00:26
567000 -- [-717.357] (-719.901) (-722.355) (-714.713) * (-717.220) [-715.766] (-717.039) (-716.571) -- 0:00:26
567500 -- [-718.293] (-715.273) (-726.353) (-716.841) * [-714.576] (-715.221) (-715.284) (-719.606) -- 0:00:26
568000 -- (-715.387) [-719.041] (-727.439) (-717.545) * [-714.504] (-716.419) (-715.042) (-718.855) -- 0:00:26
568500 -- [-722.207] (-716.909) (-717.513) (-717.230) * [-715.235] (-716.628) (-715.320) (-715.152) -- 0:00:26
569000 -- (-718.543) (-716.583) (-716.592) [-715.536] * [-715.353] (-716.906) (-716.250) (-716.238) -- 0:00:26
569500 -- (-722.536) (-716.945) (-716.549) [-717.121] * (-716.717) (-716.901) (-716.607) [-716.413] -- 0:00:26
570000 -- (-716.458) [-720.129] (-716.481) (-716.424) * [-716.505] (-716.210) (-717.774) (-721.499) -- 0:00:26
Average standard deviation of split frequencies: 0.008415
570500 -- (-717.328) (-715.660) (-715.838) [-715.511] * (-718.031) [-717.826] (-717.393) (-716.640) -- 0:00:26
571000 -- (-718.009) (-715.816) (-717.592) [-717.103] * (-717.708) [-719.473] (-716.425) (-714.824) -- 0:00:26
571500 -- [-716.488] (-716.011) (-717.118) (-715.842) * [-715.910] (-716.786) (-714.820) (-715.652) -- 0:00:26
572000 -- (-719.671) (-717.139) [-715.986] (-715.547) * (-715.795) (-714.602) [-715.377] (-715.782) -- 0:00:26
572500 -- (-719.125) [-722.143] (-716.832) (-719.744) * (-714.601) [-714.782] (-716.662) (-719.906) -- 0:00:26
573000 -- (-716.396) (-714.415) (-714.806) [-716.129] * [-715.115] (-716.908) (-718.572) (-718.251) -- 0:00:26
573500 -- [-716.278] (-716.014) (-718.004) (-715.876) * (-714.461) (-720.241) [-717.614] (-714.809) -- 0:00:26
574000 -- (-715.081) [-716.373] (-720.838) (-716.420) * [-717.494] (-720.126) (-717.055) (-714.595) -- 0:00:25
574500 -- (-716.541) (-717.057) [-719.562] (-715.884) * (-719.697) [-716.196] (-716.379) (-716.155) -- 0:00:25
575000 -- (-716.073) (-716.959) (-715.107) [-717.411] * (-717.799) (-715.691) (-717.743) [-715.405] -- 0:00:25
Average standard deviation of split frequencies: 0.008031
575500 -- (-717.251) (-716.610) (-720.275) [-716.657] * (-717.283) (-715.143) [-715.123] (-715.797) -- 0:00:25
576000 -- (-719.388) (-716.371) [-718.221] (-719.690) * (-718.300) [-715.497] (-719.536) (-715.595) -- 0:00:25
576500 -- [-715.685] (-716.507) (-715.975) (-717.068) * (-714.591) [-715.147] (-722.279) (-717.123) -- 0:00:25
577000 -- [-714.439] (-717.556) (-716.416) (-715.432) * (-716.619) [-717.787] (-721.294) (-716.347) -- 0:00:25
577500 -- (-714.362) (-716.237) [-720.102] (-723.410) * [-715.156] (-718.042) (-720.460) (-715.148) -- 0:00:25
578000 -- [-715.220] (-716.941) (-720.268) (-721.997) * (-722.728) (-723.304) [-717.050] (-717.100) -- 0:00:26
578500 -- (-717.510) (-718.876) [-716.768] (-717.755) * (-721.158) [-716.688] (-716.472) (-720.483) -- 0:00:26
579000 -- (-716.046) (-719.532) [-714.983] (-718.697) * (-717.140) (-716.773) [-722.574] (-720.689) -- 0:00:26
579500 -- (-719.624) (-717.038) [-715.800] (-715.797) * (-716.653) (-719.088) (-715.509) [-715.725] -- 0:00:26
580000 -- (-716.216) (-717.656) [-714.683] (-716.517) * [-715.147] (-715.782) (-718.157) (-717.352) -- 0:00:26
Average standard deviation of split frequencies: 0.008064
580500 -- (-716.139) [-715.658] (-715.498) (-718.881) * (-718.192) [-716.092] (-715.451) (-716.268) -- 0:00:26
581000 -- (-716.890) (-715.508) [-715.578] (-716.299) * (-716.378) (-718.213) [-716.648] (-718.500) -- 0:00:25
581500 -- (-716.023) (-715.213) [-716.639] (-714.467) * (-718.654) (-718.357) [-717.559] (-715.223) -- 0:00:25
582000 -- (-716.853) (-717.677) (-715.602) [-714.867] * (-718.496) (-717.157) (-719.994) [-716.404] -- 0:00:25
582500 -- [-716.580] (-718.057) (-714.400) (-714.947) * (-719.578) (-720.809) (-716.146) [-716.298] -- 0:00:25
583000 -- (-715.779) [-715.778] (-714.476) (-714.157) * [-715.387] (-716.200) (-717.547) (-715.511) -- 0:00:25
583500 -- [-716.088] (-715.871) (-714.758) (-717.446) * (-716.086) (-717.334) (-718.798) [-716.319] -- 0:00:25
584000 -- (-720.258) [-717.972] (-714.709) (-720.388) * [-715.907] (-715.956) (-714.963) (-717.730) -- 0:00:25
584500 -- (-715.343) (-720.833) (-718.956) [-721.046] * (-716.400) (-717.116) (-716.497) [-720.402] -- 0:00:25
585000 -- [-715.167] (-717.411) (-715.335) (-717.653) * (-714.683) [-715.836] (-717.601) (-720.194) -- 0:00:25
Average standard deviation of split frequencies: 0.008296
585500 -- [-717.604] (-721.135) (-715.000) (-717.142) * (-716.180) (-715.664) (-718.805) [-720.152] -- 0:00:25
586000 -- (-716.864) [-715.883] (-715.432) (-715.003) * (-720.216) (-717.612) (-716.246) [-715.996] -- 0:00:25
586500 -- (-714.812) [-718.043] (-722.274) (-716.717) * (-716.046) [-714.611] (-720.106) (-719.779) -- 0:00:25
587000 -- (-714.786) (-719.173) (-716.284) [-717.267] * (-717.471) (-719.974) [-716.200] (-719.603) -- 0:00:25
587500 -- [-714.986] (-716.030) (-714.640) (-718.340) * (-717.704) [-718.583] (-716.757) (-715.926) -- 0:00:25
588000 -- [-716.112] (-716.783) (-717.768) (-715.596) * [-714.504] (-716.880) (-719.119) (-718.521) -- 0:00:25
588500 -- (-716.778) [-715.312] (-718.720) (-717.395) * (-716.027) [-717.891] (-722.686) (-717.974) -- 0:00:25
589000 -- (-715.421) (-716.544) (-717.131) [-715.305] * [-715.586] (-716.173) (-721.605) (-719.925) -- 0:00:25
589500 -- [-715.307] (-715.287) (-716.474) (-715.089) * (-721.690) (-722.459) [-720.775] (-718.858) -- 0:00:25
590000 -- (-715.655) (-715.066) [-720.916] (-715.606) * [-714.820] (-719.509) (-718.279) (-718.538) -- 0:00:25
Average standard deviation of split frequencies: 0.007931
590500 -- (-716.472) (-716.432) [-718.170] (-715.087) * (-714.680) [-714.740] (-721.559) (-718.793) -- 0:00:24
591000 -- (-719.280) (-722.213) (-715.688) [-717.877] * (-716.327) (-715.456) (-717.010) [-716.367] -- 0:00:24
591500 -- (-719.192) [-715.887] (-717.481) (-716.113) * (-715.734) (-718.470) (-714.785) [-714.915] -- 0:00:24
592000 -- (-718.323) (-715.505) (-716.424) [-714.907] * (-715.282) (-723.419) (-715.544) [-715.728] -- 0:00:24
592500 -- (-717.539) (-716.056) (-716.606) [-716.716] * (-715.760) [-716.605] (-722.616) (-719.013) -- 0:00:24
593000 -- (-715.466) (-718.194) [-714.701] (-715.861) * (-717.550) [-715.469] (-718.042) (-717.045) -- 0:00:24
593500 -- (-715.266) [-714.966] (-715.846) (-715.140) * (-725.149) (-718.217) (-715.069) [-716.741] -- 0:00:24
594000 -- (-716.456) (-717.203) (-714.962) [-715.679] * [-714.546] (-715.205) (-714.948) (-719.292) -- 0:00:24
594500 -- (-715.067) (-716.389) (-716.556) [-714.494] * (-715.420) (-717.016) (-714.325) [-716.348] -- 0:00:25
595000 -- (-716.324) [-718.461] (-715.485) (-715.936) * (-716.330) (-717.659) (-715.211) [-715.978] -- 0:00:25
Average standard deviation of split frequencies: 0.007909
595500 -- (-716.605) (-717.118) [-715.597] (-719.021) * (-718.915) [-717.895] (-715.100) (-719.081) -- 0:00:25
596000 -- [-719.859] (-718.743) (-715.486) (-718.695) * (-718.164) [-717.397] (-714.668) (-716.555) -- 0:00:25
596500 -- (-717.477) (-716.057) [-716.934] (-719.247) * [-715.904] (-714.745) (-718.176) (-718.886) -- 0:00:25
597000 -- [-716.385] (-715.454) (-716.382) (-717.243) * [-717.806] (-721.111) (-718.212) (-719.239) -- 0:00:24
597500 -- (-717.957) [-714.519] (-717.202) (-718.086) * (-716.568) (-726.040) (-717.697) [-717.902] -- 0:00:24
598000 -- [-716.361] (-715.518) (-716.355) (-716.935) * (-715.934) (-717.438) (-716.183) [-716.276] -- 0:00:24
598500 -- [-717.130] (-719.284) (-715.488) (-714.551) * [-715.979] (-717.855) (-720.516) (-715.974) -- 0:00:24
599000 -- [-714.793] (-715.000) (-716.942) (-715.914) * (-715.401) (-715.110) (-716.182) [-715.082] -- 0:00:24
599500 -- (-718.395) (-715.428) [-714.644] (-714.891) * [-716.839] (-716.572) (-718.443) (-716.858) -- 0:00:24
600000 -- (-718.405) [-717.854] (-715.801) (-714.886) * (-717.145) (-716.254) [-715.169] (-715.730) -- 0:00:24
Average standard deviation of split frequencies: 0.008142
600500 -- (-719.964) (-719.614) [-714.331] (-716.005) * [-716.943] (-718.000) (-715.605) (-715.195) -- 0:00:24
601000 -- [-716.868] (-718.274) (-714.923) (-716.145) * (-716.802) (-715.782) (-716.386) [-716.965] -- 0:00:24
601500 -- (-717.623) (-717.775) (-720.662) [-715.563] * (-716.274) (-715.584) [-717.248] (-714.950) -- 0:00:24
602000 -- (-719.969) (-716.589) (-717.002) [-715.304] * (-716.224) (-717.832) (-719.879) [-715.570] -- 0:00:24
602500 -- [-715.425] (-716.144) (-716.867) (-717.730) * (-718.276) (-721.653) [-715.659] (-716.635) -- 0:00:24
603000 -- (-714.758) [-717.822] (-715.233) (-715.938) * (-717.031) (-716.963) [-715.472] (-716.410) -- 0:00:24
603500 -- (-716.869) [-716.935] (-716.984) (-714.843) * (-716.807) [-716.660] (-714.640) (-716.723) -- 0:00:24
604000 -- (-719.091) [-715.406] (-715.235) (-715.432) * (-717.682) (-719.677) [-715.212] (-717.962) -- 0:00:24
604500 -- (-715.981) [-715.192] (-716.405) (-714.644) * [-715.377] (-716.541) (-716.882) (-716.861) -- 0:00:24
605000 -- [-715.164] (-717.461) (-721.396) (-717.136) * (-715.703) (-715.976) [-715.967] (-718.270) -- 0:00:24
Average standard deviation of split frequencies: 0.008265
605500 -- (-715.140) [-718.006] (-718.738) (-716.884) * (-718.536) (-716.186) [-714.904] (-715.332) -- 0:00:24
606000 -- [-718.069] (-716.740) (-719.026) (-716.548) * (-718.993) [-715.678] (-714.944) (-718.070) -- 0:00:24
606500 -- [-719.541] (-717.802) (-717.138) (-716.366) * (-716.225) [-715.658] (-716.414) (-715.907) -- 0:00:24
607000 -- (-717.938) (-716.382) [-716.359] (-719.244) * (-718.601) [-714.758] (-717.098) (-715.450) -- 0:00:23
607500 -- (-718.702) (-718.620) [-719.083] (-717.473) * [-717.485] (-719.620) (-718.837) (-714.582) -- 0:00:23
608000 -- [-716.681] (-716.496) (-715.025) (-716.846) * (-714.810) [-715.659] (-718.482) (-714.613) -- 0:00:23
608500 -- (-715.696) (-718.889) [-716.586] (-716.889) * [-714.880] (-716.111) (-719.390) (-715.503) -- 0:00:23
609000 -- (-715.565) [-715.766] (-718.281) (-718.729) * (-718.911) (-717.900) (-717.002) [-716.026] -- 0:00:23
609500 -- (-717.648) [-715.162] (-720.772) (-718.005) * (-717.130) [-716.575] (-715.637) (-716.655) -- 0:00:23
610000 -- [-716.780] (-715.654) (-718.619) (-715.555) * (-718.489) [-715.925] (-716.016) (-716.483) -- 0:00:23
Average standard deviation of split frequencies: 0.008829
610500 -- (-716.307) (-718.545) [-715.465] (-718.222) * [-716.878] (-715.852) (-715.162) (-717.887) -- 0:00:23
611000 -- (-714.414) [-719.024] (-722.081) (-720.693) * (-716.364) (-717.487) [-715.577] (-717.270) -- 0:00:24
611500 -- (-718.701) (-717.160) (-721.877) [-716.549] * (-714.938) [-716.426] (-716.188) (-715.123) -- 0:00:24
612000 -- (-715.570) (-716.308) [-717.289] (-718.903) * (-718.533) (-714.827) [-715.035] (-715.251) -- 0:00:24
612500 -- (-717.586) (-716.062) [-715.782] (-715.011) * (-716.353) (-715.471) (-714.899) [-714.905] -- 0:00:24
613000 -- (-719.839) (-716.251) [-717.333] (-714.797) * [-715.993] (-715.671) (-714.388) (-716.729) -- 0:00:23
613500 -- (-715.310) [-716.956] (-719.252) (-715.837) * (-717.787) [-716.285] (-717.053) (-716.691) -- 0:00:23
614000 -- (-716.136) (-717.965) [-717.454] (-717.654) * (-718.650) [-716.381] (-715.132) (-717.059) -- 0:00:23
614500 -- (-718.614) (-718.148) (-716.529) [-717.618] * (-717.526) (-714.763) [-715.486] (-714.972) -- 0:00:23
615000 -- (-717.243) (-720.915) [-717.032] (-714.540) * (-714.618) (-716.852) [-715.795] (-720.319) -- 0:00:23
Average standard deviation of split frequencies: 0.008992
615500 -- [-716.064] (-717.304) (-717.662) (-714.292) * (-714.963) [-716.293] (-719.730) (-720.147) -- 0:00:23
616000 -- (-716.382) (-716.306) (-719.568) [-718.668] * (-715.649) [-716.732] (-716.033) (-716.109) -- 0:00:23
616500 -- (-720.251) [-715.307] (-715.969) (-715.323) * (-714.826) (-715.017) [-716.498] (-716.426) -- 0:00:23
617000 -- [-719.288] (-715.431) (-718.703) (-716.972) * [-715.186] (-717.890) (-718.666) (-716.334) -- 0:00:23
617500 -- (-717.034) [-721.011] (-716.812) (-718.901) * (-717.008) (-717.831) [-717.966] (-716.933) -- 0:00:23
618000 -- (-718.726) (-716.810) [-718.764] (-717.638) * (-716.752) (-716.914) [-716.992] (-714.636) -- 0:00:23
618500 -- (-715.669) (-719.467) [-718.343] (-723.130) * (-716.344) (-718.146) (-715.649) [-714.500] -- 0:00:23
619000 -- (-715.930) (-720.143) [-715.970] (-716.482) * [-717.301] (-716.599) (-718.709) (-714.203) -- 0:00:23
619500 -- [-716.438] (-719.737) (-717.364) (-716.796) * (-717.924) (-716.123) (-714.320) [-716.552] -- 0:00:23
620000 -- (-718.850) [-717.175] (-716.502) (-719.025) * (-714.865) (-716.873) (-715.834) [-715.241] -- 0:00:23
Average standard deviation of split frequencies: 0.008402
620500 -- (-718.319) (-717.012) (-718.199) [-716.528] * (-716.231) [-718.234] (-715.648) (-716.776) -- 0:00:23
621000 -- [-719.817] (-718.438) (-720.488) (-718.222) * (-719.426) [-715.552] (-717.824) (-715.247) -- 0:00:23
621500 -- (-716.592) (-722.818) [-716.840] (-719.585) * (-715.810) (-716.336) (-716.012) [-714.881] -- 0:00:23
622000 -- (-720.242) [-716.405] (-716.567) (-716.007) * [-715.827] (-722.495) (-716.268) (-715.821) -- 0:00:23
622500 -- (-719.422) [-714.651] (-715.530) (-714.713) * (-716.049) [-716.791] (-715.919) (-715.156) -- 0:00:23
623000 -- [-718.077] (-716.485) (-717.202) (-717.216) * (-716.886) (-716.904) (-715.484) [-715.403] -- 0:00:22
623500 -- [-720.821] (-714.706) (-716.335) (-719.860) * (-714.754) [-716.385] (-716.478) (-716.158) -- 0:00:22
624000 -- (-716.649) (-719.602) [-714.978] (-718.444) * (-716.381) (-715.708) [-716.582] (-717.528) -- 0:00:22
624500 -- [-717.048] (-718.447) (-715.446) (-716.491) * (-716.936) (-715.641) [-715.604] (-716.800) -- 0:00:22
625000 -- (-719.709) [-718.255] (-717.948) (-715.044) * (-717.567) (-714.994) [-714.933] (-715.313) -- 0:00:22
Average standard deviation of split frequencies: 0.008142
625500 -- [-718.980] (-717.683) (-714.805) (-715.441) * (-715.874) (-715.371) [-715.768] (-714.794) -- 0:00:22
626000 -- (-720.568) (-717.990) (-714.936) [-722.375] * (-716.923) [-714.928] (-717.733) (-715.533) -- 0:00:22
626500 -- (-719.715) [-717.390] (-718.438) (-718.349) * [-715.571] (-714.306) (-715.598) (-715.270) -- 0:00:22
627000 -- (-718.273) [-717.062] (-715.817) (-716.708) * [-716.175] (-715.386) (-714.854) (-714.815) -- 0:00:23
627500 -- (-716.511) [-717.529] (-715.166) (-714.948) * (-715.433) (-716.631) [-715.166] (-714.478) -- 0:00:23
628000 -- (-716.164) [-716.475] (-715.726) (-722.132) * (-717.257) (-718.714) [-714.706] (-714.448) -- 0:00:23
628500 -- (-716.207) (-715.259) [-715.244] (-718.072) * (-716.755) (-718.009) (-716.122) [-715.560] -- 0:00:23
629000 -- (-715.045) [-715.238] (-715.760) (-715.466) * [-717.185] (-715.519) (-717.627) (-715.361) -- 0:00:23
629500 -- [-719.921] (-716.646) (-719.023) (-719.103) * (-716.673) (-719.182) (-723.362) [-716.295] -- 0:00:22
630000 -- (-716.221) (-718.759) [-719.668] (-719.830) * (-717.612) (-716.584) (-717.051) [-715.587] -- 0:00:22
Average standard deviation of split frequencies: 0.007942
630500 -- (-714.836) (-715.690) (-717.164) [-715.736] * (-716.936) [-715.709] (-714.607) (-714.558) -- 0:00:22
631000 -- (-715.818) (-717.416) [-718.327] (-722.765) * (-718.500) (-716.331) [-714.841] (-717.213) -- 0:00:22
631500 -- [-714.719] (-714.937) (-716.068) (-716.343) * (-720.436) [-716.552] (-719.833) (-719.279) -- 0:00:22
632000 -- (-714.578) [-718.424] (-718.374) (-716.494) * (-715.640) [-715.526] (-718.391) (-715.738) -- 0:00:22
632500 -- (-718.097) (-717.487) (-714.772) [-714.710] * (-716.854) (-715.840) [-714.791] (-716.870) -- 0:00:22
633000 -- (-715.552) (-715.900) (-720.461) [-714.918] * (-716.805) [-717.135] (-714.768) (-717.307) -- 0:00:22
633500 -- (-717.190) [-715.725] (-717.372) (-716.746) * [-715.068] (-716.653) (-716.483) (-716.622) -- 0:00:22
634000 -- (-719.145) (-718.046) [-717.269] (-717.027) * (-720.605) (-716.102) (-718.385) [-716.296] -- 0:00:22
634500 -- (-716.061) (-718.130) (-724.001) [-714.247] * (-717.637) (-716.655) [-715.748] (-715.261) -- 0:00:22
635000 -- (-714.842) (-716.631) [-716.221] (-715.986) * (-716.213) (-717.317) [-714.862] (-715.406) -- 0:00:22
Average standard deviation of split frequencies: 0.007968
635500 -- (-717.206) (-716.053) (-715.911) [-717.596] * (-716.959) [-716.928] (-715.292) (-715.224) -- 0:00:22
636000 -- (-715.656) (-715.871) (-716.066) [-718.888] * [-716.774] (-716.243) (-720.345) (-717.055) -- 0:00:22
636500 -- (-716.580) (-718.062) [-715.741] (-719.905) * (-716.662) (-719.272) (-721.116) [-717.821] -- 0:00:22
637000 -- (-715.842) [-714.799] (-719.386) (-715.252) * [-718.694] (-714.853) (-717.548) (-717.128) -- 0:00:22
637500 -- [-715.974] (-718.602) (-718.306) (-721.357) * (-718.174) [-716.775] (-714.605) (-716.983) -- 0:00:22
638000 -- (-719.293) [-718.757] (-718.489) (-715.990) * (-715.600) (-715.664) [-714.600] (-716.615) -- 0:00:22
638500 -- (-721.225) (-717.464) [-717.008] (-719.589) * [-715.690] (-716.725) (-715.207) (-716.657) -- 0:00:22
639000 -- (-716.159) [-716.115] (-719.001) (-722.681) * (-717.199) (-716.643) (-715.093) [-715.480] -- 0:00:22
639500 -- [-716.581] (-718.092) (-717.427) (-717.886) * (-717.393) (-714.793) [-715.985] (-716.248) -- 0:00:21
640000 -- [-715.656] (-717.737) (-716.490) (-715.973) * (-716.693) [-717.604] (-716.363) (-715.373) -- 0:00:21
Average standard deviation of split frequencies: 0.007910
640500 -- (-716.992) [-716.494] (-715.825) (-715.895) * (-716.839) (-718.740) [-716.139] (-715.699) -- 0:00:21
641000 -- (-715.755) (-716.622) [-717.480] (-714.862) * (-714.924) (-718.726) (-718.069) [-717.317] -- 0:00:21
641500 -- (-717.099) (-714.942) [-716.081] (-718.079) * (-714.778) (-715.917) (-718.221) [-714.815] -- 0:00:21
642000 -- (-717.039) [-715.970] (-716.270) (-715.873) * [-715.961] (-719.027) (-717.548) (-714.503) -- 0:00:21
642500 -- [-715.696] (-719.730) (-717.711) (-714.924) * [-715.391] (-721.397) (-715.892) (-717.528) -- 0:00:21
643000 -- (-716.290) (-715.442) (-718.315) [-715.625] * (-716.195) [-718.465] (-714.929) (-721.357) -- 0:00:22
643500 -- (-716.208) (-722.179) (-715.449) [-715.480] * (-716.911) (-717.082) (-716.561) [-715.316] -- 0:00:22
644000 -- [-718.266] (-718.074) (-715.924) (-715.792) * (-715.322) [-715.847] (-715.100) (-716.114) -- 0:00:22
644500 -- [-718.791] (-715.506) (-714.726) (-717.800) * (-714.888) [-717.431] (-716.008) (-714.717) -- 0:00:22
645000 -- (-715.665) [-715.619] (-715.802) (-715.985) * (-714.843) [-716.484] (-720.510) (-715.218) -- 0:00:22
Average standard deviation of split frequencies: 0.007855
645500 -- (-716.325) [-715.702] (-719.059) (-715.759) * (-714.768) [-717.940] (-715.979) (-715.623) -- 0:00:21
646000 -- (-719.297) (-716.907) [-715.653] (-715.320) * [-717.414] (-721.039) (-716.117) (-715.805) -- 0:00:21
646500 -- (-716.464) (-717.771) (-720.690) [-715.240] * (-717.652) (-714.578) (-717.104) [-718.544] -- 0:00:21
647000 -- (-717.994) (-715.467) (-716.233) [-715.218] * [-718.427] (-714.514) (-715.572) (-718.509) -- 0:00:21
647500 -- (-715.587) (-716.510) [-719.310] (-715.996) * [-719.375] (-718.183) (-719.043) (-715.940) -- 0:00:21
648000 -- [-715.356] (-719.094) (-715.893) (-715.442) * (-715.092) (-716.218) [-715.547] (-715.572) -- 0:00:21
648500 -- (-716.854) [-717.642] (-718.868) (-716.718) * (-715.082) (-715.893) [-717.038] (-715.553) -- 0:00:21
649000 -- (-716.952) [-714.689] (-715.462) (-715.256) * (-716.905) (-715.706) [-717.287] (-716.731) -- 0:00:21
649500 -- (-716.576) [-716.287] (-715.510) (-716.810) * [-714.281] (-714.508) (-717.437) (-716.828) -- 0:00:21
650000 -- (-716.418) (-715.236) (-715.272) [-718.274] * (-714.988) [-719.603] (-721.071) (-715.197) -- 0:00:21
Average standard deviation of split frequencies: 0.007969
650500 -- (-716.645) [-716.947] (-717.342) (-719.504) * (-717.309) (-716.226) (-719.732) [-716.948] -- 0:00:21
651000 -- (-715.966) [-716.729] (-719.243) (-718.884) * [-717.216] (-715.741) (-718.083) (-715.812) -- 0:00:21
651500 -- (-716.191) [-717.041] (-716.673) (-718.003) * (-720.993) (-717.046) [-720.607] (-720.248) -- 0:00:21
652000 -- (-714.682) (-718.756) (-715.416) [-714.734] * (-723.679) [-717.597] (-717.762) (-716.431) -- 0:00:21
652500 -- (-716.772) (-716.694) [-718.432] (-717.040) * (-716.128) (-715.521) (-715.235) [-714.911] -- 0:00:21
653000 -- [-718.450] (-716.255) (-717.232) (-717.651) * (-718.074) (-717.452) [-717.147] (-714.896) -- 0:00:21
653500 -- (-718.884) [-717.516] (-717.257) (-715.122) * (-716.700) [-716.531] (-716.419) (-718.309) -- 0:00:21
654000 -- (-717.601) (-717.438) [-715.258] (-715.291) * (-719.143) [-715.290] (-717.770) (-717.756) -- 0:00:21
654500 -- (-716.443) [-716.469] (-717.959) (-718.919) * (-716.374) [-716.845] (-717.259) (-717.338) -- 0:00:21
655000 -- (-716.266) [-716.434] (-719.103) (-715.802) * (-716.727) [-715.444] (-715.223) (-718.635) -- 0:00:21
Average standard deviation of split frequencies: 0.008031
655500 -- (-717.588) (-716.552) [-716.747] (-717.123) * (-719.434) (-716.329) (-721.356) [-720.340] -- 0:00:21
656000 -- (-717.524) [-714.437] (-716.115) (-717.457) * (-720.122) (-718.821) [-715.589] (-717.382) -- 0:00:20
656500 -- (-716.939) (-715.210) (-716.655) [-716.750] * [-717.305] (-715.435) (-715.030) (-718.623) -- 0:00:20
657000 -- [-717.077] (-715.436) (-716.859) (-718.754) * (-718.848) (-717.619) (-714.576) [-715.310] -- 0:00:20
657500 -- (-715.049) (-716.309) (-716.907) [-715.575] * (-720.394) (-716.499) [-715.360] (-716.224) -- 0:00:20
658000 -- [-714.563] (-714.468) (-716.723) (-720.798) * (-719.603) [-717.679] (-718.260) (-720.588) -- 0:00:20
658500 -- (-719.324) (-714.550) (-716.212) [-715.907] * [-718.769] (-716.545) (-714.997) (-715.208) -- 0:00:20
659000 -- (-716.393) (-715.229) [-715.943] (-716.994) * (-719.694) (-718.956) (-717.327) [-715.691] -- 0:00:20
659500 -- (-716.351) [-715.947] (-716.885) (-716.011) * (-717.265) (-717.511) (-716.535) [-715.196] -- 0:00:21
660000 -- (-716.562) (-716.778) [-716.639] (-721.368) * (-716.175) [-716.758] (-718.316) (-716.001) -- 0:00:21
Average standard deviation of split frequencies: 0.008185
660500 -- (-719.370) (-718.622) [-715.541] (-715.812) * (-717.682) (-716.460) [-714.778] (-717.447) -- 0:00:21
661000 -- (-716.812) (-716.567) [-716.667] (-718.104) * (-717.351) [-715.690] (-714.809) (-717.220) -- 0:00:21
661500 -- (-717.417) [-715.631] (-721.166) (-717.546) * (-715.854) (-716.492) (-715.912) [-716.024] -- 0:00:20
662000 -- (-715.625) (-716.975) [-715.755] (-716.357) * (-718.181) [-715.431] (-717.359) (-724.724) -- 0:00:20
662500 -- (-715.462) [-714.872] (-717.463) (-716.302) * [-716.888] (-715.759) (-718.083) (-721.783) -- 0:00:20
663000 -- (-716.474) (-717.275) [-717.559] (-722.412) * [-716.556] (-716.890) (-717.566) (-716.825) -- 0:00:20
663500 -- [-714.867] (-715.853) (-714.677) (-716.439) * [-715.354] (-716.289) (-716.659) (-718.208) -- 0:00:20
664000 -- (-715.445) [-715.837] (-716.465) (-715.710) * (-714.992) [-714.993] (-717.069) (-715.492) -- 0:00:20
664500 -- [-717.565] (-719.023) (-722.389) (-718.007) * [-717.805] (-716.651) (-717.043) (-717.126) -- 0:00:20
665000 -- (-716.028) [-714.715] (-719.184) (-718.221) * (-716.051) (-718.062) (-715.230) [-715.252] -- 0:00:20
Average standard deviation of split frequencies: 0.008327
665500 -- (-717.009) [-716.700] (-718.759) (-715.926) * (-719.711) [-720.706] (-715.823) (-717.487) -- 0:00:20
666000 -- (-714.914) [-719.769] (-715.394) (-715.736) * (-717.140) (-716.372) (-717.460) [-715.329] -- 0:00:20
666500 -- (-716.385) (-718.133) (-715.828) [-718.398] * (-719.120) (-715.296) (-715.695) [-715.311] -- 0:00:20
667000 -- (-714.718) (-717.534) (-716.518) [-717.172] * (-716.045) [-714.610] (-714.611) (-718.318) -- 0:00:20
667500 -- (-717.799) (-714.292) [-716.700] (-716.688) * (-716.975) (-714.529) (-715.580) [-715.828] -- 0:00:20
668000 -- (-717.168) [-715.470] (-715.873) (-714.907) * (-715.536) [-714.503] (-715.178) (-716.249) -- 0:00:20
668500 -- (-717.910) [-716.778] (-715.981) (-717.660) * (-714.247) (-719.784) (-715.636) [-716.639] -- 0:00:20
669000 -- (-717.834) (-718.557) (-717.212) [-714.497] * (-717.804) (-722.030) (-716.257) [-714.571] -- 0:00:20
669500 -- (-716.608) (-721.059) (-715.825) [-714.436] * (-716.127) (-719.730) [-715.013] (-720.448) -- 0:00:20
670000 -- [-715.503] (-718.830) (-717.312) (-714.604) * (-721.926) (-718.331) (-716.542) [-715.120] -- 0:00:20
Average standard deviation of split frequencies: 0.007951
670500 -- (-715.904) (-718.515) (-717.394) [-714.493] * (-716.180) (-717.649) (-716.195) [-716.061] -- 0:00:20
671000 -- [-716.872] (-718.770) (-716.097) (-716.786) * (-715.517) (-719.668) (-717.397) [-714.910] -- 0:00:20
671500 -- (-715.038) (-716.883) [-716.822] (-718.646) * [-715.595] (-716.459) (-716.036) (-715.443) -- 0:00:20
672000 -- (-715.480) (-715.595) [-715.672] (-716.559) * (-715.758) [-719.943] (-714.954) (-715.128) -- 0:00:20
672500 -- (-723.121) [-714.555] (-716.411) (-716.559) * (-723.008) (-715.889) [-715.656] (-714.466) -- 0:00:19
673000 -- (-716.221) [-717.972] (-715.813) (-716.232) * (-716.511) [-715.549] (-716.332) (-716.222) -- 0:00:19
673500 -- [-715.717] (-715.590) (-715.572) (-719.920) * (-715.513) [-714.864] (-715.420) (-719.282) -- 0:00:19
674000 -- (-716.957) (-717.314) (-715.095) [-716.962] * [-717.386] (-715.701) (-716.939) (-717.249) -- 0:00:19
674500 -- (-717.069) [-718.407] (-721.250) (-718.158) * (-716.488) (-715.694) [-717.415] (-718.869) -- 0:00:19
675000 -- (-720.345) (-714.523) (-717.453) [-717.996] * (-716.747) [-715.611] (-714.630) (-714.832) -- 0:00:19
Average standard deviation of split frequencies: 0.007758
675500 -- (-715.815) (-715.632) (-715.102) [-716.949] * (-717.969) (-716.109) [-714.829] (-717.020) -- 0:00:20
676000 -- (-718.052) (-715.227) [-715.813] (-715.560) * (-714.501) [-717.031] (-715.615) (-716.864) -- 0:00:20
676500 -- [-715.132] (-718.443) (-718.830) (-718.317) * (-715.886) (-714.588) (-718.219) [-719.867] -- 0:00:20
677000 -- (-718.710) (-722.993) (-716.410) [-718.662] * [-715.664] (-716.635) (-716.056) (-717.710) -- 0:00:20
677500 -- (-722.445) [-717.316] (-716.498) (-716.003) * (-716.395) (-719.122) [-714.696] (-716.695) -- 0:00:19
678000 -- (-723.306) (-715.044) (-715.642) [-719.346] * [-717.902] (-719.930) (-717.930) (-717.110) -- 0:00:19
678500 -- (-719.136) [-718.702] (-721.575) (-714.896) * (-715.378) [-717.102] (-720.691) (-716.264) -- 0:00:19
679000 -- (-715.683) [-716.155] (-716.636) (-716.461) * (-715.340) (-715.485) [-716.658] (-716.565) -- 0:00:19
679500 -- (-719.159) (-718.441) (-715.515) [-715.362] * (-716.136) [-716.455] (-715.156) (-715.977) -- 0:00:19
680000 -- (-718.869) (-717.443) [-714.929] (-715.878) * (-716.024) (-717.006) [-716.177] (-717.245) -- 0:00:19
Average standard deviation of split frequencies: 0.007835
680500 -- [-718.528] (-715.900) (-717.213) (-717.662) * (-717.922) [-715.286] (-714.900) (-716.549) -- 0:00:19
681000 -- (-719.323) (-718.574) (-722.854) [-718.623] * (-715.966) (-716.593) [-715.341] (-715.385) -- 0:00:19
681500 -- (-717.575) [-715.482] (-716.055) (-721.074) * (-718.196) (-717.747) [-717.330] (-714.828) -- 0:00:19
682000 -- (-718.232) (-720.147) [-715.775] (-717.875) * [-715.632] (-716.051) (-724.611) (-714.971) -- 0:00:19
682500 -- [-717.911] (-716.416) (-714.495) (-717.900) * (-718.932) (-716.045) [-718.378] (-716.586) -- 0:00:19
683000 -- (-716.974) [-719.318] (-714.915) (-718.552) * [-716.169] (-716.980) (-716.534) (-717.723) -- 0:00:19
683500 -- (-719.177) [-717.241] (-717.749) (-716.317) * [-722.425] (-719.466) (-717.304) (-714.737) -- 0:00:19
684000 -- (-718.861) [-716.097] (-716.978) (-715.232) * (-718.408) [-716.110] (-719.305) (-719.539) -- 0:00:19
684500 -- (-716.406) (-715.808) [-716.583] (-716.740) * (-714.571) (-718.026) (-718.057) [-714.841] -- 0:00:19
685000 -- (-716.723) (-717.000) [-715.216] (-716.676) * (-717.158) (-718.076) [-716.418] (-717.533) -- 0:00:19
Average standard deviation of split frequencies: 0.008074
685500 -- [-719.688] (-716.504) (-715.120) (-715.100) * (-719.213) [-718.912] (-716.544) (-716.521) -- 0:00:19
686000 -- (-715.401) (-716.077) [-715.612] (-716.706) * [-715.026] (-715.695) (-716.708) (-717.518) -- 0:00:19
686500 -- (-723.764) [-715.194] (-720.090) (-714.836) * (-715.317) (-715.956) (-715.209) [-714.514] -- 0:00:19
687000 -- [-716.140] (-716.030) (-716.381) (-716.554) * (-721.947) [-717.258] (-718.061) (-714.784) -- 0:00:19
687500 -- (-717.312) (-716.143) (-717.019) [-714.915] * (-721.246) (-716.727) (-720.332) [-716.178] -- 0:00:19
688000 -- (-721.545) [-716.340] (-716.952) (-715.357) * (-715.208) [-715.122] (-716.321) (-716.472) -- 0:00:19
688500 -- (-716.647) [-714.591] (-717.852) (-717.066) * (-716.460) [-715.460] (-714.630) (-718.689) -- 0:00:19
689000 -- [-715.696] (-715.945) (-720.932) (-717.133) * (-718.353) (-715.622) (-714.455) [-719.906] -- 0:00:18
689500 -- (-718.313) (-715.678) (-716.452) [-716.258] * (-718.791) [-715.814] (-715.295) (-722.152) -- 0:00:18
690000 -- (-720.761) [-715.991] (-717.169) (-718.657) * (-717.803) [-716.032] (-716.821) (-720.865) -- 0:00:18
Average standard deviation of split frequencies: 0.008233
690500 -- (-715.437) (-718.935) [-716.969] (-718.417) * (-720.547) (-716.814) (-717.245) [-716.273] -- 0:00:18
691000 -- (-717.535) (-715.666) [-716.328] (-718.298) * (-722.333) (-719.458) [-717.470] (-718.881) -- 0:00:18
691500 -- (-716.484) (-714.922) [-716.022] (-715.247) * (-719.488) [-716.156] (-718.982) (-716.517) -- 0:00:18
692000 -- (-716.786) (-716.053) (-718.481) [-718.444] * (-718.150) [-716.433] (-715.639) (-715.471) -- 0:00:18
692500 -- (-715.476) (-721.733) (-715.144) [-715.280] * [-715.693] (-716.161) (-715.213) (-720.624) -- 0:00:19
693000 -- (-715.336) (-717.993) (-718.277) [-714.602] * [-715.749] (-717.359) (-717.123) (-717.206) -- 0:00:19
693500 -- (-716.071) (-719.246) (-717.947) [-714.684] * (-715.128) [-718.338] (-718.879) (-716.608) -- 0:00:19
694000 -- (-715.756) [-719.780] (-715.448) (-716.972) * (-715.617) (-718.238) (-716.335) [-717.513] -- 0:00:18
694500 -- [-716.551] (-717.370) (-718.481) (-721.485) * (-717.494) [-717.031] (-718.240) (-722.337) -- 0:00:18
695000 -- (-716.132) (-717.531) (-715.557) [-717.444] * [-717.483] (-716.224) (-718.532) (-726.255) -- 0:00:18
Average standard deviation of split frequencies: 0.008678
695500 -- [-714.708] (-719.379) (-715.985) (-716.701) * (-718.407) (-719.820) (-716.327) [-714.498] -- 0:00:18
696000 -- [-714.817] (-715.565) (-720.052) (-714.950) * (-716.460) [-717.963] (-717.945) (-716.996) -- 0:00:18
696500 -- [-714.931] (-715.372) (-715.163) (-716.350) * (-716.843) [-716.261] (-714.972) (-716.757) -- 0:00:18
697000 -- (-717.820) (-715.172) (-718.749) [-717.033] * [-717.886] (-715.407) (-715.035) (-715.618) -- 0:00:18
697500 -- (-718.043) (-715.417) [-719.540] (-714.921) * (-718.751) [-717.417] (-715.727) (-718.244) -- 0:00:18
698000 -- (-714.374) (-715.766) (-720.596) [-714.314] * [-717.873] (-718.319) (-718.566) (-717.702) -- 0:00:18
698500 -- (-719.670) (-715.449) (-717.942) [-716.667] * (-717.880) [-715.181] (-716.863) (-715.283) -- 0:00:18
699000 -- (-715.537) [-716.838] (-715.238) (-716.848) * [-715.306] (-715.228) (-719.600) (-716.275) -- 0:00:18
699500 -- (-718.717) (-717.759) [-719.474] (-719.933) * (-715.317) (-721.128) [-722.406] (-716.723) -- 0:00:18
700000 -- (-719.260) [-716.224] (-715.818) (-716.112) * [-715.576] (-724.719) (-719.826) (-715.096) -- 0:00:18
Average standard deviation of split frequencies: 0.008494
700500 -- [-719.282] (-716.434) (-715.194) (-714.669) * (-714.674) (-717.490) (-717.467) [-717.270] -- 0:00:18
701000 -- [-718.968] (-715.899) (-717.180) (-717.270) * (-714.677) (-720.382) (-720.139) [-717.796] -- 0:00:18
701500 -- (-722.065) (-716.406) [-716.380] (-714.770) * (-719.411) [-719.129] (-716.400) (-720.147) -- 0:00:18
702000 -- (-717.704) (-715.263) [-716.401] (-715.094) * (-715.882) (-718.155) (-715.346) [-716.609] -- 0:00:18
702500 -- [-715.836] (-715.121) (-716.755) (-716.332) * (-718.779) (-717.024) (-715.704) [-715.222] -- 0:00:18
703000 -- (-717.483) (-719.944) [-715.483] (-716.253) * (-719.585) [-719.969] (-717.503) (-716.057) -- 0:00:18
703500 -- (-716.355) (-718.064) (-716.454) [-715.390] * (-721.271) (-718.499) (-716.009) [-717.761] -- 0:00:18
704000 -- (-717.337) [-716.350] (-714.561) (-715.387) * (-715.033) (-716.888) [-717.497] (-714.242) -- 0:00:18
704500 -- (-715.271) [-716.068] (-717.234) (-717.632) * (-715.971) [-717.233] (-717.763) (-714.174) -- 0:00:18
705000 -- [-715.040] (-723.450) (-717.406) (-716.527) * [-717.382] (-715.521) (-721.152) (-715.784) -- 0:00:17
Average standard deviation of split frequencies: 0.008720
705500 -- [-714.437] (-718.231) (-717.739) (-720.109) * (-715.465) (-717.574) (-719.054) [-717.544] -- 0:00:17
706000 -- [-716.886] (-716.910) (-714.306) (-719.056) * (-716.010) (-715.197) (-718.533) [-721.952] -- 0:00:17
706500 -- (-719.617) (-715.005) (-714.885) [-715.189] * (-715.355) (-715.429) [-717.969] (-715.452) -- 0:00:17
707000 -- (-722.102) (-714.535) [-716.324] (-714.770) * (-715.404) (-715.269) [-718.808] (-715.771) -- 0:00:17
707500 -- (-718.523) (-715.063) [-721.261] (-716.530) * (-717.305) (-720.181) [-714.590] (-716.356) -- 0:00:17
708000 -- (-719.081) (-714.449) (-723.546) [-714.623] * (-720.698) (-718.798) [-714.915] (-718.365) -- 0:00:17
708500 -- [-717.094] (-716.402) (-715.981) (-717.853) * (-717.764) (-718.605) (-715.172) [-719.381] -- 0:00:18
709000 -- (-717.817) (-716.332) (-715.593) [-721.653] * (-717.267) (-715.441) [-718.441] (-717.768) -- 0:00:18
709500 -- (-719.675) (-720.043) (-717.752) [-720.659] * [-715.668] (-716.269) (-715.103) (-716.254) -- 0:00:18
710000 -- (-716.991) (-716.275) [-718.767] (-714.864) * (-721.100) [-715.667] (-715.699) (-715.516) -- 0:00:17
Average standard deviation of split frequencies: 0.008955
710500 -- (-715.701) [-717.433] (-718.510) (-716.110) * (-719.778) (-720.329) [-715.503] (-716.565) -- 0:00:17
711000 -- (-717.096) [-715.577] (-725.788) (-719.422) * [-717.316] (-717.239) (-717.683) (-717.171) -- 0:00:17
711500 -- (-717.469) (-716.568) [-715.697] (-716.147) * (-718.833) (-725.988) [-715.553] (-716.086) -- 0:00:17
712000 -- (-718.611) (-716.885) [-716.829] (-717.494) * (-716.580) (-715.746) [-715.359] (-714.688) -- 0:00:17
712500 -- (-716.844) (-716.044) (-717.973) [-714.545] * (-715.955) [-716.870] (-716.534) (-714.763) -- 0:00:17
713000 -- (-719.873) (-716.438) [-717.680] (-719.156) * (-716.205) (-716.255) (-715.922) [-714.575] -- 0:00:17
713500 -- (-715.761) [-716.784] (-718.040) (-715.412) * (-718.658) (-720.247) [-716.843] (-719.153) -- 0:00:17
714000 -- (-715.257) (-715.995) (-715.221) [-715.137] * (-717.665) [-715.855] (-716.811) (-715.205) -- 0:00:17
714500 -- [-715.149] (-715.939) (-721.039) (-715.261) * (-717.276) (-715.460) (-714.433) [-721.077] -- 0:00:17
715000 -- (-717.405) (-716.358) (-722.450) [-715.957] * (-716.976) (-717.482) (-714.340) [-715.888] -- 0:00:17
Average standard deviation of split frequencies: 0.009053
715500 -- (-715.100) (-718.601) [-717.898] (-716.367) * (-716.708) (-717.849) (-714.748) [-714.910] -- 0:00:17
716000 -- (-715.876) (-718.606) (-715.618) [-717.148] * (-714.966) (-716.104) (-716.864) [-715.635] -- 0:00:17
716500 -- (-716.012) [-715.542] (-719.161) (-715.988) * (-714.335) (-715.411) (-718.312) [-717.675] -- 0:00:17
717000 -- (-716.449) (-715.498) [-720.134] (-716.815) * (-715.419) (-716.922) (-717.541) [-714.875] -- 0:00:17
717500 -- [-714.718] (-715.870) (-719.477) (-716.294) * (-714.660) (-717.010) (-715.865) [-716.734] -- 0:00:17
718000 -- [-715.171] (-718.791) (-718.281) (-717.018) * (-715.344) (-715.963) [-719.756] (-714.975) -- 0:00:17
718500 -- [-715.657] (-717.549) (-721.351) (-714.648) * [-715.879] (-717.092) (-717.868) (-715.181) -- 0:00:17
719000 -- (-718.607) (-720.785) [-718.234] (-716.055) * (-714.734) (-716.814) [-715.306] (-716.125) -- 0:00:17
719500 -- [-716.713] (-719.429) (-715.238) (-716.752) * (-718.738) (-716.372) (-715.739) [-717.616] -- 0:00:17
720000 -- (-716.446) [-722.070] (-715.840) (-718.028) * (-715.797) (-715.390) (-717.116) [-717.586] -- 0:00:17
Average standard deviation of split frequencies: 0.008953
720500 -- [-716.173] (-716.924) (-719.315) (-714.884) * (-717.533) (-715.610) (-716.356) [-718.088] -- 0:00:17
721000 -- (-715.893) [-717.022] (-717.508) (-715.691) * (-717.004) (-716.098) [-716.143] (-720.235) -- 0:00:17
721500 -- (-716.345) [-717.603] (-717.081) (-717.439) * (-715.431) (-717.332) [-714.791] (-718.745) -- 0:00:16
722000 -- [-715.017] (-719.051) (-717.848) (-716.887) * (-715.681) [-714.653] (-721.237) (-715.188) -- 0:00:16
722500 -- (-716.336) (-721.120) (-716.906) [-718.786] * (-715.430) [-714.134] (-719.682) (-715.543) -- 0:00:16
723000 -- (-718.971) (-718.209) [-717.447] (-715.834) * [-715.703] (-714.135) (-716.447) (-716.045) -- 0:00:16
723500 -- (-717.583) (-716.892) [-717.153] (-718.579) * (-717.563) [-719.819] (-719.584) (-718.067) -- 0:00:16
724000 -- (-714.374) [-716.242] (-722.648) (-722.372) * (-720.083) (-719.434) (-719.133) [-715.172] -- 0:00:16
724500 -- (-714.379) [-715.131] (-715.057) (-717.382) * (-718.619) [-715.296] (-722.294) (-715.620) -- 0:00:16
725000 -- (-717.018) (-721.884) (-716.478) [-714.742] * (-718.409) (-716.029) [-716.891] (-715.795) -- 0:00:16
Average standard deviation of split frequencies: 0.008806
725500 -- (-721.728) (-719.004) [-716.052] (-716.347) * [-717.507] (-715.394) (-718.208) (-714.814) -- 0:00:17
726000 -- (-714.556) [-718.273] (-718.011) (-716.729) * (-717.112) (-715.529) [-719.654] (-715.162) -- 0:00:16
726500 -- (-715.761) (-717.260) [-718.129] (-715.521) * [-717.867] (-715.476) (-718.300) (-718.557) -- 0:00:16
727000 -- (-718.426) (-718.472) (-723.719) [-718.022] * (-717.096) (-716.077) (-715.746) [-716.348] -- 0:00:16
727500 -- (-718.036) (-715.242) [-717.420] (-716.265) * (-718.203) (-716.075) [-717.136] (-716.072) -- 0:00:16
728000 -- (-715.856) (-715.414) (-716.713) [-717.448] * (-719.226) [-715.360] (-714.748) (-716.552) -- 0:00:16
728500 -- (-719.422) (-716.542) [-718.607] (-716.414) * (-721.626) [-717.158] (-720.165) (-715.029) -- 0:00:16
729000 -- (-715.961) (-718.359) [-718.114] (-715.863) * [-714.235] (-720.732) (-718.783) (-717.631) -- 0:00:16
729500 -- (-716.513) (-716.965) [-716.144] (-714.151) * (-716.631) (-718.649) (-717.033) [-717.842] -- 0:00:16
730000 -- (-718.674) [-716.066] (-716.051) (-715.223) * (-717.296) [-718.932] (-716.463) (-717.545) -- 0:00:16
Average standard deviation of split frequencies: 0.008387
730500 -- [-716.338] (-716.522) (-717.973) (-715.198) * (-718.167) (-716.644) [-717.971] (-723.370) -- 0:00:16
731000 -- (-717.573) (-716.311) (-715.878) [-716.785] * (-719.342) (-714.504) [-717.293] (-721.957) -- 0:00:16
731500 -- (-716.577) (-720.193) (-716.313) [-715.846] * [-718.977] (-715.786) (-715.160) (-715.719) -- 0:00:16
732000 -- (-718.398) [-714.490] (-717.447) (-718.793) * (-718.121) (-715.909) [-714.615] (-721.054) -- 0:00:16
732500 -- (-714.494) [-719.152] (-716.126) (-716.206) * [-716.761] (-715.804) (-715.549) (-723.938) -- 0:00:16
733000 -- [-716.003] (-715.597) (-717.412) (-716.999) * (-716.988) [-717.087] (-717.505) (-721.042) -- 0:00:16
733500 -- (-715.766) (-715.617) (-714.525) [-714.791] * (-717.561) [-719.637] (-720.121) (-715.991) -- 0:00:16
734000 -- [-715.048] (-714.650) (-716.975) (-716.728) * [-716.131] (-718.829) (-716.127) (-718.243) -- 0:00:16
734500 -- (-714.972) [-714.650] (-716.939) (-716.476) * (-717.749) (-715.317) [-715.243] (-716.221) -- 0:00:16
735000 -- (-717.952) (-714.390) [-716.064] (-716.744) * (-715.590) (-716.311) [-716.953] (-716.691) -- 0:00:16
Average standard deviation of split frequencies: 0.008567
735500 -- (-714.922) (-714.716) [-719.462] (-717.310) * (-715.247) [-716.791] (-715.584) (-715.726) -- 0:00:16
736000 -- (-717.753) [-715.795] (-718.675) (-714.866) * (-717.900) [-715.115] (-715.643) (-715.256) -- 0:00:16
736500 -- [-717.255] (-716.730) (-724.989) (-715.971) * [-716.751] (-716.666) (-715.926) (-714.451) -- 0:00:16
737000 -- (-717.041) (-718.841) (-724.518) [-716.837] * [-716.285] (-716.415) (-716.036) (-719.131) -- 0:00:16
737500 -- (-715.227) [-716.721] (-718.037) (-714.927) * (-717.160) (-717.120) (-717.550) [-715.208] -- 0:00:16
738000 -- (-716.091) [-720.952] (-716.086) (-716.962) * [-714.681] (-715.755) (-716.019) (-718.492) -- 0:00:15
738500 -- (-716.279) (-716.684) (-715.989) [-715.917] * (-715.018) [-715.622] (-725.818) (-714.997) -- 0:00:15
739000 -- (-714.632) (-717.567) [-715.345] (-717.716) * (-714.960) (-715.157) (-716.906) [-717.112] -- 0:00:15
739500 -- (-714.985) (-719.714) [-715.984] (-715.601) * (-716.043) [-715.354] (-722.284) (-715.731) -- 0:00:15
740000 -- (-715.946) [-719.949] (-719.568) (-717.450) * (-715.362) (-719.821) [-716.054] (-715.527) -- 0:00:15
Average standard deviation of split frequencies: 0.008019
740500 -- (-719.343) [-715.540] (-717.227) (-719.900) * (-715.223) [-716.532] (-718.125) (-715.381) -- 0:00:15
741000 -- (-715.878) [-714.809] (-716.875) (-715.738) * [-715.819] (-717.182) (-718.234) (-715.805) -- 0:00:15
741500 -- (-715.474) (-716.056) [-715.697] (-717.495) * (-718.220) [-716.945] (-715.985) (-714.980) -- 0:00:15
742000 -- (-715.253) [-721.807] (-714.653) (-717.319) * (-715.637) (-720.516) [-718.778] (-716.449) -- 0:00:15
742500 -- (-714.733) (-720.489) (-714.733) [-715.794] * (-716.069) [-719.915] (-718.279) (-717.530) -- 0:00:15
743000 -- (-717.677) (-718.386) (-718.875) [-714.508] * (-715.880) (-716.922) (-716.130) [-716.380] -- 0:00:15
743500 -- (-714.471) (-718.058) (-718.842) [-715.850] * [-714.945] (-716.637) (-716.713) (-715.353) -- 0:00:15
744000 -- (-716.139) [-715.114] (-718.266) (-718.807) * [-716.104] (-714.534) (-717.595) (-716.698) -- 0:00:15
744500 -- (-718.524) (-716.371) [-714.793] (-717.744) * [-715.563] (-716.210) (-714.969) (-714.906) -- 0:00:15
745000 -- [-717.383] (-717.267) (-716.701) (-716.534) * (-714.477) (-717.164) (-715.398) [-716.898] -- 0:00:15
Average standard deviation of split frequencies: 0.008136
745500 -- [-714.880] (-717.572) (-718.917) (-715.734) * (-714.477) [-715.881] (-718.150) (-715.783) -- 0:00:15
746000 -- (-716.138) [-716.266] (-715.067) (-715.503) * (-716.111) (-714.796) (-717.510) [-715.943] -- 0:00:15
746500 -- (-715.336) (-723.154) [-719.558] (-714.833) * [-716.237] (-715.327) (-717.252) (-716.246) -- 0:00:15
747000 -- [-720.962] (-722.086) (-716.686) (-715.877) * (-717.263) (-714.235) (-717.986) [-718.265] -- 0:00:15
747500 -- (-716.441) [-718.852] (-717.414) (-715.388) * (-716.073) [-718.320] (-715.003) (-716.451) -- 0:00:15
748000 -- (-716.369) [-719.641] (-719.858) (-715.803) * (-716.380) [-714.637] (-715.958) (-718.386) -- 0:00:15
748500 -- (-716.079) (-715.227) (-717.196) [-718.960] * (-715.382) (-717.831) (-717.699) [-717.109] -- 0:00:15
749000 -- (-716.268) [-714.577] (-717.568) (-717.973) * (-716.258) [-716.613] (-715.531) (-718.103) -- 0:00:15
749500 -- [-717.186] (-717.490) (-719.664) (-717.211) * (-715.188) (-717.033) (-716.274) [-717.913] -- 0:00:15
750000 -- (-715.718) (-716.856) [-717.979] (-721.133) * [-716.037] (-715.274) (-717.078) (-715.500) -- 0:00:15
Average standard deviation of split frequencies: 0.007326
750500 -- (-717.296) (-714.679) (-715.160) [-716.806] * [-715.965] (-717.339) (-715.657) (-718.844) -- 0:00:15
751000 -- (-719.723) (-716.638) [-717.151] (-727.622) * [-715.417] (-717.340) (-718.118) (-720.213) -- 0:00:15
751500 -- [-718.823] (-722.712) (-715.505) (-717.840) * (-716.965) (-714.654) [-715.892] (-726.113) -- 0:00:15
752000 -- (-715.320) (-714.593) [-715.306] (-716.821) * [-715.431] (-717.563) (-716.411) (-723.013) -- 0:00:15
752500 -- [-716.389] (-716.029) (-715.205) (-715.227) * (-716.199) (-716.857) [-714.938] (-724.614) -- 0:00:15
753000 -- (-714.361) [-716.248] (-716.720) (-718.900) * (-716.537) (-716.560) [-714.701] (-724.134) -- 0:00:15
753500 -- (-715.365) [-720.537] (-717.571) (-715.789) * (-721.893) (-717.286) (-716.627) [-719.185] -- 0:00:15
754000 -- [-715.841] (-719.683) (-717.245) (-715.723) * (-715.136) (-718.873) (-717.151) [-717.220] -- 0:00:15
754500 -- [-715.623] (-721.886) (-719.252) (-715.370) * [-718.801] (-714.791) (-714.903) (-714.569) -- 0:00:14
755000 -- [-715.527] (-717.413) (-718.537) (-715.639) * (-723.139) (-716.930) [-714.345] (-714.581) -- 0:00:14
Average standard deviation of split frequencies: 0.007857
755500 -- (-715.515) [-715.485] (-715.250) (-716.305) * (-716.811) (-714.772) [-714.457] (-715.910) -- 0:00:14
756000 -- (-716.712) (-719.479) (-716.167) [-715.523] * (-715.374) [-714.307] (-715.436) (-714.927) -- 0:00:14
756500 -- (-717.468) (-716.221) (-717.925) [-718.812] * [-717.051] (-719.955) (-718.227) (-718.077) -- 0:00:14
757000 -- (-716.492) (-715.529) [-715.389] (-714.597) * (-717.194) (-721.366) (-715.332) [-715.315] -- 0:00:14
757500 -- (-718.290) [-715.189] (-716.055) (-714.882) * (-717.463) (-721.804) [-714.772] (-715.872) -- 0:00:14
758000 -- (-716.449) (-715.875) [-717.020] (-714.507) * (-716.854) [-721.337] (-715.968) (-717.289) -- 0:00:14
758500 -- [-716.235] (-716.095) (-716.765) (-717.713) * (-715.479) [-716.371] (-717.483) (-717.858) -- 0:00:14
759000 -- (-716.789) (-718.030) (-714.878) [-716.994] * (-716.745) (-715.608) [-714.977] (-714.527) -- 0:00:14
759500 -- (-716.002) [-717.330] (-718.706) (-716.165) * (-717.531) (-715.013) [-716.754] (-717.246) -- 0:00:14
760000 -- (-716.085) (-721.657) [-716.015] (-721.306) * (-718.277) [-715.596] (-719.975) (-716.866) -- 0:00:14
Average standard deviation of split frequencies: 0.007809
760500 -- (-717.287) (-719.033) [-716.184] (-723.401) * (-715.411) (-719.149) [-717.544] (-717.342) -- 0:00:14
761000 -- (-720.678) (-722.694) [-716.623] (-720.891) * (-718.285) (-715.793) [-716.015] (-718.715) -- 0:00:14
761500 -- (-717.371) (-717.278) (-716.709) [-717.441] * (-715.061) (-718.279) [-717.559] (-716.949) -- 0:00:14
762000 -- (-715.300) (-717.504) (-715.074) [-717.445] * (-716.047) (-716.502) [-716.950] (-719.955) -- 0:00:14
762500 -- (-716.857) (-718.965) [-717.020] (-716.969) * (-717.449) (-717.306) [-717.273] (-717.835) -- 0:00:14
763000 -- (-716.489) (-714.906) (-723.395) [-718.451] * (-716.232) (-717.045) [-721.180] (-716.167) -- 0:00:14
763500 -- (-715.826) [-715.973] (-716.124) (-718.250) * (-717.940) (-715.848) (-719.107) [-716.472] -- 0:00:14
764000 -- (-718.890) [-715.363] (-716.140) (-716.549) * [-717.427] (-716.096) (-717.276) (-715.353) -- 0:00:14
764500 -- (-716.197) [-718.336] (-716.006) (-716.789) * (-718.377) (-714.220) [-716.831] (-717.412) -- 0:00:14
765000 -- (-715.025) [-715.955] (-717.704) (-716.127) * (-714.378) (-714.894) [-719.734] (-716.135) -- 0:00:14
Average standard deviation of split frequencies: 0.007549
765500 -- (-714.921) (-715.325) [-717.833] (-716.737) * (-716.409) (-717.188) [-719.752] (-716.830) -- 0:00:14
766000 -- [-715.630] (-719.141) (-716.676) (-717.095) * (-716.049) [-716.239] (-719.509) (-717.149) -- 0:00:14
766500 -- (-715.425) [-715.305] (-716.040) (-715.150) * (-717.177) (-717.535) [-717.214] (-715.930) -- 0:00:14
767000 -- (-718.230) [-715.361] (-714.814) (-715.373) * (-716.723) (-715.215) (-716.542) [-715.621] -- 0:00:14
767500 -- (-716.987) (-717.831) [-715.228] (-717.737) * (-716.011) (-717.219) (-715.643) [-719.472] -- 0:00:14
768000 -- (-716.784) [-718.202] (-716.347) (-717.813) * (-716.920) [-715.969] (-715.410) (-718.270) -- 0:00:14
768500 -- (-717.119) [-715.335] (-715.124) (-716.344) * (-716.782) (-715.902) (-717.078) [-715.868] -- 0:00:14
769000 -- (-716.688) (-715.926) [-716.260] (-718.517) * (-716.576) (-714.819) [-720.434] (-715.192) -- 0:00:14
769500 -- (-714.793) (-715.013) [-717.119] (-718.141) * [-716.363] (-716.054) (-716.295) (-723.846) -- 0:00:14
770000 -- (-715.352) (-714.289) (-717.801) [-715.205] * (-716.761) (-715.416) (-719.766) [-715.148] -- 0:00:14
Average standard deviation of split frequencies: 0.007585
770500 -- [-715.439] (-714.504) (-717.381) (-717.127) * [-718.725] (-716.439) (-715.723) (-717.464) -- 0:00:13
771000 -- (-716.896) (-715.492) [-714.997] (-715.917) * (-716.146) (-716.711) [-716.168] (-719.489) -- 0:00:13
771500 -- [-715.194] (-717.461) (-715.636) (-716.924) * (-718.618) (-718.830) (-715.108) [-716.399] -- 0:00:13
772000 -- [-714.796] (-717.695) (-716.816) (-720.398) * [-714.681] (-715.304) (-716.341) (-715.566) -- 0:00:13
772500 -- (-714.647) [-716.487] (-716.114) (-717.074) * [-714.830] (-721.183) (-714.475) (-715.663) -- 0:00:13
773000 -- (-715.455) [-715.612] (-717.537) (-718.586) * (-718.904) (-718.010) (-714.999) [-716.094] -- 0:00:13
773500 -- (-715.577) [-716.199] (-718.388) (-716.693) * (-719.456) (-717.673) [-719.695] (-714.620) -- 0:00:13
774000 -- [-715.945] (-715.122) (-714.836) (-715.510) * (-717.157) (-718.712) [-723.571] (-717.194) -- 0:00:13
774500 -- (-716.348) [-715.811] (-717.251) (-722.573) * (-718.314) [-718.116] (-716.587) (-715.738) -- 0:00:13
775000 -- [-718.685] (-715.625) (-715.951) (-716.918) * (-718.413) (-717.247) (-715.220) [-715.993] -- 0:00:13
Average standard deviation of split frequencies: 0.007735
775500 -- (-715.580) (-715.876) [-715.223] (-715.524) * (-717.326) [-715.441] (-717.915) (-716.742) -- 0:00:13
776000 -- [-716.475] (-718.153) (-716.066) (-715.577) * (-719.512) [-719.939] (-718.061) (-720.179) -- 0:00:13
776500 -- (-717.204) (-715.051) [-716.046] (-717.058) * [-715.336] (-716.275) (-719.552) (-715.841) -- 0:00:13
777000 -- [-714.952] (-715.439) (-719.818) (-716.309) * (-715.896) (-716.964) (-719.218) [-715.614] -- 0:00:13
777500 -- (-723.959) (-715.745) (-715.653) [-714.806] * (-716.491) (-718.673) [-716.892] (-715.222) -- 0:00:13
778000 -- [-722.127] (-715.179) (-719.892) (-716.290) * (-715.564) (-717.229) (-716.806) [-714.535] -- 0:00:13
778500 -- (-721.974) (-714.657) (-717.379) [-716.655] * [-715.292] (-718.328) (-717.542) (-716.170) -- 0:00:13
779000 -- (-717.154) (-714.735) (-717.064) [-715.366] * (-716.347) (-721.403) [-717.336] (-715.417) -- 0:00:13
779500 -- (-718.022) (-716.532) [-715.127] (-716.756) * [-716.264] (-718.129) (-715.985) (-715.935) -- 0:00:13
780000 -- (-718.583) [-717.937] (-714.755) (-714.827) * (-717.899) (-717.834) (-715.539) [-715.411] -- 0:00:13
Average standard deviation of split frequencies: 0.007649
780500 -- (-720.241) (-717.045) (-716.568) [-715.711] * (-717.158) (-716.971) (-718.249) [-717.228] -- 0:00:13
781000 -- [-714.477] (-714.682) (-720.075) (-717.947) * (-715.663) [-714.691] (-716.603) (-719.776) -- 0:00:13
781500 -- (-715.676) (-715.923) (-716.164) [-715.905] * [-716.339] (-715.164) (-718.482) (-717.095) -- 0:00:13
782000 -- (-715.091) (-715.250) (-716.627) [-717.488] * (-716.918) (-715.918) (-716.625) [-715.317] -- 0:00:13
782500 -- (-719.636) (-715.093) [-715.312] (-717.279) * (-717.394) (-716.422) (-717.556) [-716.091] -- 0:00:13
783000 -- (-715.666) (-717.872) (-715.896) [-715.542] * [-715.778] (-715.757) (-716.537) (-716.732) -- 0:00:13
783500 -- (-715.767) (-715.175) [-714.383] (-718.248) * (-715.410) (-716.817) (-715.861) [-717.129] -- 0:00:13
784000 -- [-721.251] (-716.981) (-716.471) (-717.739) * (-715.179) (-718.590) [-716.627] (-718.086) -- 0:00:13
784500 -- (-720.819) (-716.205) [-717.908] (-714.349) * (-715.505) (-719.268) [-716.210] (-716.009) -- 0:00:13
785000 -- (-716.839) [-717.932] (-715.819) (-718.020) * (-718.802) (-718.803) (-716.538) [-716.505] -- 0:00:13
Average standard deviation of split frequencies: 0.008117
785500 -- [-717.621] (-716.676) (-718.169) (-717.063) * (-717.276) [-715.256] (-717.623) (-715.188) -- 0:00:13
786000 -- (-716.186) (-714.972) (-718.321) [-715.281] * (-723.841) [-716.474] (-716.521) (-715.490) -- 0:00:13
786500 -- (-716.581) (-719.002) [-717.231] (-715.562) * (-716.694) [-715.702] (-716.661) (-716.103) -- 0:00:13
787000 -- [-716.344] (-715.981) (-715.471) (-719.470) * (-716.775) [-716.137] (-715.618) (-716.189) -- 0:00:12
787500 -- (-718.220) (-716.116) (-715.203) [-716.906] * (-716.575) [-718.745] (-717.314) (-715.295) -- 0:00:12
788000 -- (-715.815) (-717.299) [-715.710] (-717.086) * (-716.843) (-715.316) (-717.107) [-715.958] -- 0:00:12
788500 -- (-714.588) (-717.965) (-717.511) [-716.159] * (-717.097) [-715.539] (-716.442) (-715.092) -- 0:00:12
789000 -- [-717.014] (-716.012) (-720.438) (-716.859) * (-715.899) (-718.573) (-716.642) [-715.475] -- 0:00:12
789500 -- (-719.730) [-718.788] (-718.589) (-718.341) * (-714.751) (-718.537) (-716.743) [-715.142] -- 0:00:12
790000 -- [-715.442] (-720.295) (-717.772) (-718.075) * [-716.169] (-718.726) (-717.393) (-717.208) -- 0:00:12
Average standard deviation of split frequencies: 0.007870
790500 -- (-714.742) (-723.032) [-714.262] (-717.479) * [-719.216] (-716.029) (-717.772) (-720.098) -- 0:00:12
791000 -- (-715.198) (-717.216) [-715.267] (-717.184) * (-721.099) [-714.780] (-717.444) (-717.198) -- 0:00:12
791500 -- (-719.029) (-717.682) [-720.833] (-718.584) * [-716.554] (-717.589) (-717.982) (-718.985) -- 0:00:12
792000 -- (-718.948) [-715.348] (-721.232) (-718.949) * (-715.200) (-715.768) [-715.920] (-718.858) -- 0:00:12
792500 -- [-714.713] (-719.668) (-716.365) (-716.444) * (-717.389) (-716.664) (-718.276) [-718.114] -- 0:00:12
793000 -- [-716.782] (-717.129) (-719.778) (-717.258) * (-715.744) (-717.290) [-715.343] (-717.490) -- 0:00:12
793500 -- (-717.965) (-718.751) [-719.179] (-716.327) * (-718.506) [-715.358] (-715.785) (-719.231) -- 0:00:12
794000 -- (-716.684) (-720.555) (-717.164) [-715.392] * [-716.440] (-717.912) (-715.979) (-719.972) -- 0:00:12
794500 -- (-718.642) (-714.417) (-715.566) [-716.523] * (-717.519) (-718.685) (-716.956) [-715.881] -- 0:00:12
795000 -- (-716.128) (-716.184) (-715.627) [-714.916] * (-718.239) (-719.016) [-716.282] (-715.969) -- 0:00:12
Average standard deviation of split frequencies: 0.008133
795500 -- (-721.098) [-720.485] (-715.944) (-715.927) * (-716.115) (-721.248) [-718.825] (-722.364) -- 0:00:12
796000 -- [-715.926] (-718.116) (-715.002) (-714.770) * [-717.294] (-718.068) (-716.213) (-716.376) -- 0:00:12
796500 -- (-717.505) [-715.362] (-714.970) (-717.564) * (-715.485) (-716.214) [-715.581] (-716.983) -- 0:00:12
797000 -- (-721.563) (-715.798) [-715.230] (-716.125) * [-716.849] (-715.006) (-714.781) (-718.474) -- 0:00:12
797500 -- (-718.514) [-716.052] (-715.539) (-714.761) * (-716.258) [-719.144] (-718.747) (-717.873) -- 0:00:12
798000 -- [-715.401] (-717.185) (-724.354) (-714.843) * (-715.881) [-718.744] (-714.722) (-718.082) -- 0:00:12
798500 -- (-715.174) [-716.903] (-717.809) (-716.394) * (-715.072) (-717.644) [-715.655] (-715.337) -- 0:00:12
799000 -- (-716.041) [-715.584] (-716.538) (-715.977) * [-714.837] (-717.047) (-715.103) (-716.644) -- 0:00:12
799500 -- (-716.467) (-714.850) (-717.370) [-717.422] * (-714.570) (-715.698) [-717.752] (-715.367) -- 0:00:12
800000 -- [-715.225] (-714.767) (-717.401) (-715.381) * (-714.577) [-715.544] (-714.554) (-717.290) -- 0:00:12
Average standard deviation of split frequencies: 0.008086
800500 -- [-715.542] (-715.028) (-715.209) (-718.491) * (-714.688) [-719.166] (-715.260) (-717.108) -- 0:00:12
801000 -- (-715.242) [-715.354] (-715.304) (-715.991) * (-715.537) (-715.395) (-715.086) [-717.684] -- 0:00:12
801500 -- (-715.185) [-717.898] (-715.304) (-716.471) * [-717.110] (-718.713) (-714.968) (-717.969) -- 0:00:12
802000 -- [-714.493] (-717.552) (-716.812) (-716.583) * (-716.301) [-715.989] (-714.742) (-715.510) -- 0:00:12
802500 -- (-716.394) (-716.079) [-716.035] (-717.782) * [-716.280] (-714.999) (-719.798) (-714.586) -- 0:00:12
803000 -- (-716.560) (-720.975) [-714.553] (-720.519) * (-716.897) (-714.261) (-719.176) [-716.303] -- 0:00:12
803500 -- (-716.383) [-717.065] (-718.501) (-715.739) * [-719.203] (-715.584) (-717.466) (-718.223) -- 0:00:11
804000 -- [-717.201] (-716.822) (-715.700) (-717.218) * (-714.466) [-715.164] (-715.949) (-716.391) -- 0:00:11
804500 -- (-716.065) [-715.442] (-719.596) (-715.422) * (-716.560) (-716.550) [-717.778] (-716.025) -- 0:00:11
805000 -- (-717.871) (-716.490) [-715.691] (-715.808) * [-716.125] (-715.772) (-714.772) (-714.838) -- 0:00:11
Average standard deviation of split frequencies: 0.007759
805500 -- [-714.884] (-719.618) (-717.522) (-715.536) * (-716.631) [-716.940] (-720.881) (-717.649) -- 0:00:11
806000 -- (-716.845) [-716.688] (-715.878) (-715.333) * [-717.871] (-716.177) (-717.002) (-714.888) -- 0:00:11
806500 -- (-719.234) (-716.471) (-717.867) [-722.456] * (-715.785) [-715.790] (-718.255) (-714.854) -- 0:00:11
807000 -- (-715.866) (-715.880) [-719.467] (-720.489) * [-716.084] (-717.079) (-718.313) (-716.535) -- 0:00:11
807500 -- (-715.653) (-716.199) [-717.118] (-716.468) * (-716.870) (-714.714) [-715.477] (-716.294) -- 0:00:11
808000 -- (-717.869) (-716.341) (-716.831) [-721.162] * (-717.988) [-715.465] (-719.002) (-715.719) -- 0:00:11
808500 -- (-719.083) (-717.050) [-718.379] (-717.020) * (-717.385) [-717.985] (-720.012) (-716.423) -- 0:00:11
809000 -- (-724.130) (-715.425) [-715.480] (-717.364) * (-716.553) [-716.884] (-715.909) (-715.686) -- 0:00:11
809500 -- (-719.150) (-716.788) (-716.045) [-722.433] * (-717.334) (-720.459) (-718.565) [-716.316] -- 0:00:11
810000 -- [-718.173] (-715.094) (-715.026) (-717.003) * (-718.089) (-716.144) (-718.099) [-719.243] -- 0:00:11
Average standard deviation of split frequencies: 0.007792
810500 -- (-717.039) [-716.798] (-715.972) (-717.966) * (-715.388) (-718.573) [-715.192] (-715.538) -- 0:00:11
811000 -- [-719.542] (-716.055) (-715.144) (-715.828) * (-714.554) [-718.551] (-721.923) (-718.640) -- 0:00:11
811500 -- [-715.194] (-714.769) (-716.475) (-719.253) * [-714.465] (-715.683) (-722.149) (-719.307) -- 0:00:11
812000 -- (-716.018) (-716.613) [-715.862] (-719.313) * (-719.089) [-716.565] (-717.424) (-719.889) -- 0:00:11
812500 -- (-715.966) (-716.329) (-715.848) [-720.759] * (-715.391) (-715.595) [-717.644] (-716.920) -- 0:00:11
813000 -- (-714.965) (-717.351) (-718.038) [-721.202] * (-716.409) (-715.685) [-717.550] (-717.012) -- 0:00:11
813500 -- (-722.380) (-717.220) [-716.397] (-716.590) * (-715.414) [-718.483] (-718.677) (-718.489) -- 0:00:11
814000 -- [-718.915] (-717.486) (-716.189) (-717.623) * (-720.370) (-717.858) (-716.171) [-719.982] -- 0:00:11
814500 -- (-722.028) (-716.957) (-715.305) [-719.368] * (-721.159) (-716.964) [-714.865] (-716.227) -- 0:00:11
815000 -- (-717.519) (-715.996) [-714.706] (-715.609) * (-723.765) (-716.169) (-715.304) [-719.238] -- 0:00:11
Average standard deviation of split frequencies: 0.007780
815500 -- (-716.498) (-715.277) [-715.844] (-717.369) * (-716.878) (-721.205) (-715.026) [-718.967] -- 0:00:11
816000 -- (-719.313) (-715.480) (-715.757) [-718.055] * (-717.136) (-719.547) [-717.143] (-720.959) -- 0:00:11
816500 -- (-717.224) (-718.513) (-715.850) [-715.570] * (-716.637) [-715.977] (-722.002) (-720.911) -- 0:00:11
817000 -- (-715.035) (-716.387) [-715.257] (-715.355) * [-718.083] (-715.655) (-717.530) (-717.789) -- 0:00:11
817500 -- (-718.233) (-718.999) [-716.243] (-719.981) * (-717.327) (-715.309) (-717.205) [-715.760] -- 0:00:11
818000 -- (-716.017) [-715.721] (-716.133) (-715.886) * (-715.800) (-716.799) [-714.722] (-717.383) -- 0:00:11
818500 -- [-715.399] (-716.549) (-718.084) (-717.254) * (-718.592) (-716.252) [-717.888] (-715.020) -- 0:00:11
819000 -- [-714.171] (-718.240) (-716.417) (-715.386) * [-715.890] (-716.058) (-714.814) (-718.809) -- 0:00:11
819500 -- [-714.786] (-715.921) (-716.404) (-716.390) * (-718.183) [-719.133] (-717.455) (-715.938) -- 0:00:11
820000 -- (-719.140) [-715.367] (-717.210) (-715.464) * [-718.014] (-715.084) (-714.541) (-717.854) -- 0:00:10
Average standard deviation of split frequencies: 0.007276
820500 -- (-716.725) [-715.159] (-718.890) (-717.002) * [-716.450] (-716.773) (-716.580) (-724.963) -- 0:00:10
821000 -- (-718.813) (-718.090) (-719.855) [-715.904] * (-721.039) (-715.551) (-716.622) [-716.866] -- 0:00:10
821500 -- (-720.292) [-719.120] (-719.244) (-717.887) * (-720.626) [-715.989] (-718.135) (-714.214) -- 0:00:10
822000 -- [-715.979] (-718.730) (-719.794) (-718.093) * (-718.979) (-716.329) (-716.922) [-722.497] -- 0:00:10
822500 -- [-715.277] (-718.398) (-721.580) (-716.655) * (-718.479) (-718.723) (-715.822) [-715.393] -- 0:00:10
823000 -- (-718.061) (-717.784) [-715.922] (-716.061) * (-716.693) (-717.214) (-716.347) [-716.594] -- 0:00:10
823500 -- (-717.125) (-723.611) (-714.806) [-716.271] * [-717.402] (-717.891) (-717.400) (-716.463) -- 0:00:10
824000 -- [-715.906] (-719.670) (-715.826) (-718.600) * (-720.913) (-716.797) [-718.390] (-719.109) -- 0:00:10
824500 -- (-716.109) [-715.980] (-715.896) (-722.504) * (-715.251) (-716.061) (-717.930) [-716.601] -- 0:00:10
825000 -- (-717.155) [-717.451] (-717.754) (-720.167) * (-718.388) (-715.874) [-716.271] (-718.124) -- 0:00:10
Average standard deviation of split frequencies: 0.007495
825500 -- (-717.287) [-717.595] (-715.827) (-717.583) * [-717.325] (-716.159) (-716.190) (-720.351) -- 0:00:10
826000 -- (-719.353) (-714.991) (-717.511) [-717.868] * [-717.558] (-717.198) (-715.055) (-719.807) -- 0:00:10
826500 -- (-716.229) [-715.489] (-714.837) (-715.758) * [-717.168] (-720.784) (-718.225) (-715.314) -- 0:00:10
827000 -- (-720.664) [-717.713] (-719.826) (-718.948) * [-715.435] (-715.403) (-715.316) (-714.894) -- 0:00:10
827500 -- [-717.190] (-716.388) (-718.531) (-717.931) * [-715.208] (-715.574) (-715.767) (-717.059) -- 0:00:10
828000 -- (-715.195) (-720.116) (-717.628) [-717.324] * (-717.860) [-716.286] (-716.043) (-715.103) -- 0:00:10
828500 -- (-720.317) (-715.994) [-720.943] (-717.298) * [-715.163] (-718.927) (-715.519) (-718.015) -- 0:00:10
829000 -- [-716.548] (-715.845) (-717.482) (-720.350) * (-719.499) (-718.268) (-715.693) [-715.155] -- 0:00:10
829500 -- (-716.943) (-717.084) [-719.099] (-719.309) * (-716.943) [-716.482] (-717.918) (-715.167) -- 0:00:10
830000 -- [-715.729] (-715.466) (-718.536) (-716.147) * (-716.206) (-717.895) (-717.035) [-715.523] -- 0:00:10
Average standard deviation of split frequencies: 0.007340
830500 -- (-715.696) [-715.554] (-716.788) (-716.129) * (-717.061) (-718.469) [-715.786] (-717.206) -- 0:00:10
831000 -- (-716.429) (-719.540) [-715.575] (-718.188) * (-716.755) [-719.341] (-715.019) (-718.335) -- 0:00:10
831500 -- [-717.268] (-718.077) (-720.516) (-714.527) * [-718.190] (-719.860) (-715.068) (-715.791) -- 0:00:10
832000 -- (-717.246) (-717.599) (-715.753) [-715.021] * (-715.244) (-715.872) (-720.211) [-716.541] -- 0:00:10
832500 -- (-719.305) (-718.040) [-714.906] (-718.207) * [-720.949] (-717.484) (-714.888) (-718.038) -- 0:00:10
833000 -- (-717.156) [-718.196] (-715.839) (-718.633) * [-717.775] (-719.141) (-714.755) (-714.755) -- 0:00:10
833500 -- (-716.783) [-720.535] (-715.872) (-718.503) * (-715.695) (-716.719) (-715.451) [-714.936] -- 0:00:10
834000 -- (-715.201) [-716.476] (-716.771) (-717.362) * (-715.310) (-720.187) [-716.685] (-715.609) -- 0:00:10
834500 -- (-715.074) (-718.096) (-716.660) [-716.680] * (-715.466) (-722.688) (-715.942) [-714.469] -- 0:00:10
835000 -- (-716.789) [-715.877] (-716.440) (-717.051) * (-716.434) (-724.490) (-716.603) [-715.005] -- 0:00:10
Average standard deviation of split frequencies: 0.006879
835500 -- (-715.631) (-715.544) [-716.587] (-716.141) * [-716.712] (-718.792) (-715.529) (-717.355) -- 0:00:10
836000 -- (-714.531) (-718.680) (-719.674) [-716.925] * (-719.305) (-717.074) [-715.318] (-715.214) -- 0:00:10
836500 -- (-715.242) [-717.604] (-718.577) (-716.132) * (-717.211) (-719.206) [-714.897] (-715.639) -- 0:00:09
837000 -- (-715.136) (-716.601) (-717.549) [-714.722] * (-717.644) (-716.204) (-714.885) [-714.935] -- 0:00:09
837500 -- [-715.243] (-716.562) (-714.825) (-714.720) * [-719.813] (-715.027) (-715.343) (-715.616) -- 0:00:09
838000 -- (-715.908) (-716.126) [-720.305] (-715.676) * [-716.901] (-715.646) (-718.577) (-716.197) -- 0:00:09
838500 -- [-716.357] (-718.980) (-716.725) (-714.695) * (-719.546) [-716.035] (-718.009) (-716.049) -- 0:00:09
839000 -- (-717.447) [-715.878] (-718.669) (-714.670) * [-714.973] (-715.172) (-715.765) (-717.424) -- 0:00:09
839500 -- (-716.127) [-721.190] (-718.698) (-716.887) * (-718.245) [-715.224] (-715.850) (-716.493) -- 0:00:09
840000 -- (-718.759) [-719.029] (-715.901) (-717.489) * (-718.600) [-716.458] (-717.096) (-715.622) -- 0:00:09
Average standard deviation of split frequencies: 0.006467
840500 -- [-717.012] (-717.207) (-717.052) (-716.313) * [-714.767] (-716.582) (-716.122) (-716.045) -- 0:00:09
841000 -- (-715.658) [-715.639] (-717.706) (-718.233) * (-714.964) (-717.130) (-718.646) [-720.858] -- 0:00:09
841500 -- (-716.182) [-714.545] (-716.164) (-720.975) * (-719.660) (-716.194) [-715.720] (-718.512) -- 0:00:09
842000 -- (-719.927) [-715.725] (-715.466) (-715.285) * (-727.736) [-715.762] (-714.891) (-716.498) -- 0:00:09
842500 -- (-720.020) [-718.073] (-721.643) (-716.414) * (-721.743) (-717.412) [-714.869] (-717.348) -- 0:00:09
843000 -- (-719.113) (-719.540) [-716.910] (-716.475) * (-715.139) (-717.242) (-714.891) [-715.628] -- 0:00:09
843500 -- (-715.466) [-716.065] (-718.083) (-717.061) * [-715.277] (-719.397) (-714.930) (-717.475) -- 0:00:09
844000 -- (-718.614) (-715.827) [-716.958] (-717.633) * [-715.430] (-716.218) (-715.373) (-717.735) -- 0:00:09
844500 -- (-717.672) (-715.590) (-718.527) [-715.233] * (-719.115) (-716.408) (-715.606) [-715.252] -- 0:00:09
845000 -- (-715.827) [-714.818] (-718.549) (-714.276) * (-716.769) (-716.228) (-714.856) [-714.340] -- 0:00:09
Average standard deviation of split frequencies: 0.006835
845500 -- [-714.905] (-715.354) (-722.372) (-716.523) * (-718.465) [-718.032] (-715.155) (-714.380) -- 0:00:09
846000 -- [-715.426] (-715.143) (-722.824) (-717.266) * (-721.166) (-718.502) (-716.867) [-714.382] -- 0:00:09
846500 -- (-716.464) [-720.341] (-722.444) (-715.763) * (-719.278) [-717.553] (-719.202) (-715.023) -- 0:00:09
847000 -- (-720.448) (-715.554) [-716.595] (-717.261) * (-717.887) (-718.906) [-718.459] (-716.164) -- 0:00:09
847500 -- (-719.689) (-714.777) [-715.693] (-714.669) * (-715.600) (-715.047) [-715.531] (-718.462) -- 0:00:09
848000 -- [-719.168] (-717.198) (-718.106) (-714.526) * (-716.951) (-714.967) (-716.625) [-714.682] -- 0:00:09
848500 -- (-715.313) [-716.182] (-715.491) (-714.776) * [-715.470] (-716.266) (-717.021) (-720.637) -- 0:00:09
849000 -- (-716.272) (-719.327) [-717.331] (-716.470) * (-715.688) [-715.084] (-715.631) (-716.622) -- 0:00:09
849500 -- [-717.680] (-720.194) (-716.170) (-717.590) * (-716.863) [-716.721] (-715.076) (-717.503) -- 0:00:09
850000 -- (-717.637) (-715.849) [-719.868] (-720.485) * [-717.889] (-715.640) (-722.795) (-716.725) -- 0:00:09
Average standard deviation of split frequencies: 0.006982
850500 -- [-716.017] (-716.320) (-715.117) (-716.951) * (-716.721) [-716.599] (-714.626) (-717.638) -- 0:00:09
851000 -- [-716.951] (-716.975) (-719.707) (-715.482) * (-718.430) (-716.215) (-714.633) [-715.529] -- 0:00:09
851500 -- (-719.320) [-716.951] (-719.082) (-719.243) * (-718.434) (-716.091) (-716.935) [-716.098] -- 0:00:09
852000 -- [-719.677] (-717.821) (-716.923) (-716.199) * [-716.790] (-715.112) (-716.607) (-716.014) -- 0:00:09
852500 -- (-716.020) (-723.226) (-722.150) [-714.148] * (-716.996) (-718.013) (-718.291) [-716.326] -- 0:00:08
853000 -- (-719.308) (-718.132) (-716.556) [-715.896] * (-715.880) [-718.012] (-717.715) (-714.669) -- 0:00:08
853500 -- (-714.834) (-715.991) (-716.662) [-716.872] * [-716.064] (-719.647) (-716.185) (-718.696) -- 0:00:08
854000 -- [-714.881] (-717.345) (-714.871) (-717.778) * [-717.066] (-716.656) (-716.436) (-717.419) -- 0:00:08
854500 -- (-714.966) (-717.942) [-714.906] (-717.327) * (-717.539) (-716.958) (-716.790) [-716.649] -- 0:00:08
855000 -- [-715.665] (-717.269) (-715.305) (-720.905) * [-715.929] (-715.187) (-714.969) (-718.797) -- 0:00:08
Average standard deviation of split frequencies: 0.006976
855500 -- (-716.995) (-717.208) [-714.855] (-714.986) * (-716.011) [-715.933] (-714.970) (-716.228) -- 0:00:08
856000 -- (-715.344) (-715.449) [-719.645] (-715.073) * [-715.737] (-717.243) (-717.972) (-715.659) -- 0:00:08
856500 -- (-716.966) (-715.655) (-716.742) [-716.358] * [-714.773] (-716.338) (-715.929) (-716.862) -- 0:00:08
857000 -- [-714.784] (-715.204) (-716.721) (-715.264) * (-714.835) (-715.700) [-715.564] (-722.562) -- 0:00:08
857500 -- (-718.043) (-718.227) [-714.984] (-715.999) * [-715.936] (-718.324) (-715.614) (-716.618) -- 0:00:08
858000 -- (-720.416) (-715.217) (-721.437) [-714.473] * (-715.849) (-720.157) [-715.577] (-720.097) -- 0:00:08
858500 -- [-718.338] (-715.811) (-715.837) (-715.573) * (-714.821) (-718.093) [-715.670] (-719.855) -- 0:00:08
859000 -- (-715.632) (-716.284) (-717.095) [-716.080] * (-715.869) (-716.469) [-715.351] (-719.450) -- 0:00:08
859500 -- (-716.749) (-716.285) (-715.415) [-716.058] * (-716.052) (-715.284) [-715.415] (-714.801) -- 0:00:08
860000 -- (-715.043) (-717.934) [-715.808] (-716.503) * (-716.074) [-715.112] (-714.660) (-714.882) -- 0:00:08
Average standard deviation of split frequencies: 0.006682
860500 -- [-716.324] (-714.487) (-714.871) (-717.257) * [-715.528] (-717.001) (-718.696) (-714.787) -- 0:00:08
861000 -- (-717.472) [-715.603] (-718.084) (-714.950) * (-714.525) [-717.056] (-716.388) (-715.603) -- 0:00:08
861500 -- (-720.084) (-719.098) [-715.937] (-714.628) * [-714.827] (-721.303) (-716.906) (-718.653) -- 0:00:08
862000 -- [-719.221] (-715.144) (-715.090) (-716.102) * (-716.335) (-716.138) [-714.223] (-717.477) -- 0:00:08
862500 -- [-715.170] (-717.292) (-719.876) (-717.842) * (-715.946) (-715.551) (-714.223) [-715.347] -- 0:00:08
863000 -- [-716.344] (-716.144) (-720.440) (-717.300) * (-717.359) (-715.643) (-714.278) [-714.887] -- 0:00:08
863500 -- (-720.196) (-715.242) (-720.359) [-715.441] * (-718.382) (-720.645) [-716.977] (-714.920) -- 0:00:08
864000 -- (-720.541) (-717.122) [-723.256] (-717.900) * [-719.722] (-718.307) (-717.655) (-719.485) -- 0:00:08
864500 -- (-717.376) (-716.401) (-718.009) [-718.520] * (-722.088) (-716.760) (-716.422) [-716.464] -- 0:00:08
865000 -- (-717.512) (-716.494) (-719.915) [-716.186] * [-715.459] (-714.716) (-715.423) (-717.666) -- 0:00:08
Average standard deviation of split frequencies: 0.006859
865500 -- (-719.938) (-715.159) [-715.583] (-717.600) * (-720.265) (-716.175) [-715.627] (-716.139) -- 0:00:08
866000 -- (-719.177) (-714.425) [-715.533] (-717.670) * [-716.056] (-716.782) (-718.460) (-714.222) -- 0:00:08
866500 -- (-716.358) (-716.305) [-714.385] (-718.428) * [-715.264] (-717.227) (-714.521) (-714.276) -- 0:00:08
867000 -- (-716.177) (-717.623) [-716.359] (-716.115) * (-715.925) [-715.393] (-714.682) (-715.544) -- 0:00:08
867500 -- (-719.962) (-715.801) [-715.742] (-715.711) * [-715.984] (-715.590) (-719.610) (-715.784) -- 0:00:08
868000 -- [-714.867] (-718.011) (-721.093) (-719.250) * [-715.049] (-717.745) (-718.378) (-715.693) -- 0:00:08
868500 -- [-715.143] (-714.587) (-716.872) (-715.883) * (-715.655) [-716.075] (-717.356) (-715.232) -- 0:00:08
869000 -- (-718.574) (-716.131) [-715.849] (-717.522) * (-715.428) [-715.818] (-717.731) (-715.502) -- 0:00:07
869500 -- (-720.016) (-720.150) (-718.074) [-714.872] * (-718.454) [-716.077] (-715.997) (-715.237) -- 0:00:07
870000 -- (-714.799) (-717.445) [-716.152] (-714.925) * (-717.097) [-715.218] (-715.876) (-717.234) -- 0:00:07
Average standard deviation of split frequencies: 0.006750
870500 -- (-716.586) (-716.452) (-716.118) [-715.662] * (-717.709) (-717.896) [-716.812] (-718.379) -- 0:00:07
871000 -- (-720.024) (-720.400) [-715.777] (-719.835) * (-718.009) [-716.904] (-716.873) (-714.971) -- 0:00:07
871500 -- (-715.317) (-718.705) (-715.302) [-715.995] * [-716.964] (-716.838) (-719.109) (-716.883) -- 0:00:07
872000 -- (-714.913) (-716.541) [-716.813] (-714.800) * (-717.838) (-717.100) (-719.487) [-716.311] -- 0:00:07
872500 -- (-716.788) [-715.221] (-716.798) (-715.881) * (-719.606) (-717.918) [-716.340] (-715.748) -- 0:00:07
873000 -- (-715.834) [-717.272] (-714.992) (-717.866) * (-720.755) [-717.449] (-720.056) (-717.882) -- 0:00:07
873500 -- (-716.952) (-716.676) [-715.100] (-717.563) * (-718.573) (-717.611) (-720.210) [-714.956] -- 0:00:07
874000 -- [-716.498] (-715.910) (-714.196) (-716.854) * (-721.055) (-717.709) (-721.665) [-714.896] -- 0:00:07
874500 -- (-717.804) (-714.947) [-714.422] (-719.292) * (-718.997) (-716.395) [-722.223] (-714.963) -- 0:00:07
875000 -- (-716.862) (-716.312) [-714.417] (-716.960) * (-716.196) (-716.542) [-719.724] (-716.179) -- 0:00:07
Average standard deviation of split frequencies: 0.006637
875500 -- (-715.898) [-716.468] (-716.427) (-716.138) * (-716.571) [-717.443] (-716.184) (-715.787) -- 0:00:07
876000 -- (-715.967) (-718.490) [-715.947] (-719.463) * (-719.878) [-716.367] (-716.468) (-716.381) -- 0:00:07
876500 -- (-715.417) (-717.023) [-715.586] (-717.116) * [-717.636] (-715.761) (-719.772) (-718.545) -- 0:00:07
877000 -- [-717.221] (-716.546) (-716.683) (-717.713) * [-716.973] (-717.443) (-715.846) (-717.530) -- 0:00:07
877500 -- [-714.879] (-715.010) (-716.557) (-716.461) * [-714.844] (-715.377) (-716.139) (-718.626) -- 0:00:07
878000 -- [-715.175] (-714.916) (-717.079) (-716.579) * (-715.168) (-717.997) [-715.672] (-714.827) -- 0:00:07
878500 -- (-716.136) [-714.991] (-716.564) (-719.724) * (-715.626) (-720.624) (-719.453) [-718.763] -- 0:00:07
879000 -- [-715.199] (-715.397) (-715.806) (-718.667) * (-717.297) [-716.434] (-719.883) (-723.406) -- 0:00:07
879500 -- (-716.302) (-714.969) [-716.255] (-717.137) * [-723.463] (-715.869) (-719.264) (-717.744) -- 0:00:07
880000 -- (-718.795) (-716.787) [-714.936] (-715.600) * (-715.277) [-715.094] (-716.633) (-715.600) -- 0:00:07
Average standard deviation of split frequencies: 0.006852
880500 -- (-719.151) (-717.380) (-720.570) [-715.480] * (-716.327) (-717.206) (-716.068) [-718.730] -- 0:00:07
881000 -- (-719.452) (-716.251) (-715.338) [-715.872] * (-716.182) (-715.736) [-717.705] (-716.114) -- 0:00:07
881500 -- (-716.420) [-717.589] (-719.596) (-716.349) * (-721.081) (-720.814) (-714.740) [-714.852] -- 0:00:07
882000 -- [-716.513] (-717.987) (-718.637) (-715.223) * [-719.060] (-716.042) (-715.928) (-714.394) -- 0:00:07
882500 -- (-717.837) (-715.405) (-720.967) [-716.092] * (-716.244) (-716.324) (-719.356) [-719.143] -- 0:00:07
883000 -- (-717.031) (-715.901) (-717.560) [-716.805] * (-715.053) (-716.445) [-716.282] (-718.903) -- 0:00:07
883500 -- (-718.330) (-717.287) (-716.975) [-722.950] * [-716.775] (-716.040) (-717.688) (-715.787) -- 0:00:07
884000 -- (-720.044) [-717.075] (-716.366) (-720.366) * (-716.974) (-716.777) (-715.549) [-716.234] -- 0:00:07
884500 -- (-717.455) (-716.410) (-714.595) [-719.786] * (-717.795) (-717.098) [-717.888] (-716.026) -- 0:00:07
885000 -- (-715.453) [-718.122] (-715.524) (-715.243) * (-714.703) [-717.708] (-716.020) (-716.618) -- 0:00:07
Average standard deviation of split frequencies: 0.007023
885500 -- [-716.549] (-719.758) (-716.146) (-715.306) * (-717.627) [-722.619] (-716.170) (-717.083) -- 0:00:06
886000 -- (-718.354) (-717.843) [-716.164] (-715.299) * (-719.430) [-714.413] (-716.166) (-717.187) -- 0:00:06
886500 -- (-716.135) [-718.513] (-717.245) (-716.702) * [-714.648] (-716.097) (-717.093) (-717.268) -- 0:00:06
887000 -- (-717.743) (-717.697) (-718.087) [-715.111] * (-717.835) [-714.839] (-714.935) (-717.383) -- 0:00:06
887500 -- (-717.749) [-714.808] (-721.292) (-716.809) * (-719.069) (-715.488) [-716.184] (-716.683) -- 0:00:06
888000 -- (-716.162) (-718.779) [-719.048] (-718.102) * (-715.325) (-715.907) [-716.338] (-715.443) -- 0:00:06
888500 -- (-720.275) (-716.642) (-719.152) [-715.568] * (-715.635) [-717.400] (-718.227) (-716.659) -- 0:00:06
889000 -- [-715.077] (-717.120) (-718.257) (-716.612) * (-720.020) (-714.715) (-721.310) [-715.137] -- 0:00:06
889500 -- (-715.847) (-719.410) (-718.595) [-715.276] * [-715.478] (-714.714) (-718.749) (-719.704) -- 0:00:06
890000 -- (-714.981) (-716.681) (-716.368) [-715.440] * (-717.200) (-719.306) [-717.527] (-715.650) -- 0:00:06
Average standard deviation of split frequencies: 0.007057
890500 -- (-714.659) [-717.599] (-720.723) (-715.725) * [-717.253] (-715.267) (-715.269) (-715.428) -- 0:00:06
891000 -- (-714.378) (-716.249) (-715.472) [-716.535] * [-719.942] (-715.473) (-715.987) (-716.944) -- 0:00:06
891500 -- (-717.746) [-716.434] (-715.495) (-719.819) * (-716.061) (-717.192) (-715.218) [-717.292] -- 0:00:06
892000 -- [-716.035] (-717.375) (-714.934) (-717.077) * [-718.558] (-715.857) (-716.812) (-714.846) -- 0:00:06
892500 -- (-716.450) (-717.789) [-715.066] (-720.385) * [-718.339] (-717.924) (-718.765) (-714.920) -- 0:00:06
893000 -- (-716.053) (-717.589) (-716.312) [-717.541] * (-719.611) [-720.311] (-716.594) (-716.630) -- 0:00:06
893500 -- (-715.242) (-715.029) [-716.472] (-715.258) * (-716.075) [-717.999] (-715.935) (-715.921) -- 0:00:06
894000 -- (-721.026) (-716.384) (-717.017) [-714.857] * (-717.950) (-716.857) (-715.271) [-716.829] -- 0:00:06
894500 -- (-717.027) (-719.930) [-718.146] (-715.465) * (-717.677) (-714.917) (-715.114) [-719.212] -- 0:00:06
895000 -- (-715.638) [-717.280] (-715.241) (-716.337) * (-714.978) [-718.541] (-715.793) (-718.126) -- 0:00:06
Average standard deviation of split frequencies: 0.006945
895500 -- [-715.015] (-719.375) (-716.533) (-716.864) * (-717.139) (-716.935) [-716.757] (-716.038) -- 0:00:06
896000 -- [-715.193] (-717.005) (-715.878) (-718.331) * (-716.267) (-716.851) (-716.567) [-717.521] -- 0:00:06
896500 -- (-715.331) (-715.100) [-717.272] (-718.453) * (-717.012) (-715.643) [-715.456] (-715.945) -- 0:00:06
897000 -- [-716.949] (-715.792) (-715.127) (-717.335) * [-719.978] (-723.832) (-716.180) (-716.626) -- 0:00:06
897500 -- (-718.640) (-717.333) (-721.053) [-714.472] * (-714.504) (-722.331) (-715.624) [-717.053] -- 0:00:06
898000 -- [-716.489] (-717.515) (-716.579) (-714.515) * (-716.399) (-721.590) (-714.981) [-717.363] -- 0:00:06
898500 -- (-718.178) (-719.636) (-714.599) [-715.517] * (-717.614) (-715.370) (-716.531) [-715.836] -- 0:00:06
899000 -- [-719.050] (-720.639) (-714.820) (-720.532) * (-714.558) [-717.742] (-718.645) (-715.838) -- 0:00:06
899500 -- (-715.141) (-719.865) [-715.910] (-715.915) * (-718.984) (-715.417) (-717.446) [-715.553] -- 0:00:06
900000 -- (-717.355) [-719.882] (-718.403) (-718.154) * (-716.352) (-716.975) [-715.424] (-722.041) -- 0:00:06
Average standard deviation of split frequencies: 0.007118
900500 -- (-714.604) [-716.163] (-719.343) (-715.751) * (-717.188) [-718.169] (-715.468) (-715.665) -- 0:00:06
901000 -- (-714.561) (-715.148) (-717.425) [-715.347] * (-715.529) [-717.662] (-715.211) (-718.774) -- 0:00:06
901500 -- (-715.533) [-719.609] (-714.421) (-717.924) * (-718.084) [-717.438] (-714.458) (-716.544) -- 0:00:06
902000 -- [-718.097] (-715.214) (-715.421) (-718.748) * [-714.996] (-715.241) (-718.239) (-714.342) -- 0:00:05
902500 -- (-717.397) (-716.455) (-717.105) [-716.089] * (-715.464) (-714.875) [-717.457] (-724.383) -- 0:00:05
903000 -- (-720.699) (-715.440) (-717.180) [-714.841] * (-720.858) [-718.067] (-715.995) (-718.913) -- 0:00:05
903500 -- [-721.579] (-715.333) (-716.800) (-715.068) * [-716.243] (-718.941) (-714.647) (-717.067) -- 0:00:05
904000 -- [-721.690] (-718.182) (-717.010) (-716.417) * (-715.187) (-719.201) [-715.068] (-719.241) -- 0:00:05
904500 -- (-721.938) [-715.784] (-724.114) (-724.371) * (-716.110) (-715.490) (-715.847) [-714.417] -- 0:00:05
905000 -- (-720.776) (-718.103) [-716.749] (-716.259) * (-714.969) [-715.186] (-715.971) (-714.509) -- 0:00:05
Average standard deviation of split frequencies: 0.007007
905500 -- (-721.054) (-719.991) [-718.231] (-718.835) * [-716.653] (-715.593) (-720.746) (-718.440) -- 0:00:05
906000 -- (-717.141) (-719.049) [-716.443] (-719.208) * (-717.129) (-716.585) [-718.106] (-718.112) -- 0:00:05
906500 -- [-715.635] (-717.609) (-723.607) (-719.296) * (-720.377) [-715.783] (-716.119) (-718.111) -- 0:00:05
907000 -- (-715.853) (-718.824) (-718.488) [-719.056] * (-716.222) (-715.343) [-718.342] (-716.987) -- 0:00:05
907500 -- (-716.740) (-719.211) [-717.074] (-716.901) * (-715.870) (-716.663) (-716.510) [-717.895] -- 0:00:05
908000 -- [-716.095] (-721.158) (-716.048) (-716.700) * (-715.994) (-715.508) (-715.598) [-715.708] -- 0:00:05
908500 -- (-715.054) (-716.697) [-715.744] (-716.565) * (-715.502) (-715.601) [-717.534] (-716.154) -- 0:00:05
909000 -- [-718.403] (-717.060) (-717.176) (-718.736) * [-717.928] (-719.423) (-717.642) (-716.249) -- 0:00:05
909500 -- [-715.145] (-722.603) (-716.104) (-717.326) * [-715.973] (-716.014) (-715.701) (-720.092) -- 0:00:05
910000 -- (-715.340) (-717.562) (-719.088) [-715.653] * (-714.749) [-717.371] (-718.816) (-716.703) -- 0:00:05
Average standard deviation of split frequencies: 0.007316
910500 -- (-714.912) (-717.776) [-717.321] (-715.146) * (-720.563) (-716.375) [-718.550] (-717.523) -- 0:00:05
911000 -- (-715.088) (-718.055) (-717.566) [-715.104] * (-716.496) (-716.129) (-718.424) [-716.557] -- 0:00:05
911500 -- (-717.343) (-716.588) (-718.197) [-714.580] * (-716.550) [-716.153] (-715.558) (-716.824) -- 0:00:05
912000 -- (-717.363) (-716.404) (-714.858) [-715.378] * [-715.306] (-715.663) (-715.010) (-716.982) -- 0:00:05
912500 -- (-718.201) [-718.672] (-716.787) (-717.445) * (-715.769) (-715.953) [-718.219] (-718.001) -- 0:00:05
913000 -- (-715.262) [-714.398] (-715.223) (-717.976) * (-716.644) (-715.789) (-715.913) [-717.480] -- 0:00:05
913500 -- [-716.729] (-715.448) (-717.226) (-714.390) * (-717.999) (-716.280) [-717.151] (-715.978) -- 0:00:05
914000 -- (-716.772) (-716.158) [-716.088] (-716.177) * [-715.902] (-715.148) (-715.603) (-716.803) -- 0:00:05
914500 -- (-715.954) [-714.535] (-716.076) (-719.451) * [-718.302] (-715.610) (-714.968) (-723.085) -- 0:00:05
915000 -- (-715.055) (-715.452) [-717.346] (-719.545) * (-717.476) (-718.539) [-716.349] (-715.180) -- 0:00:05
Average standard deviation of split frequencies: 0.007685
915500 -- (-717.222) (-715.371) [-717.390] (-718.649) * [-719.689] (-717.750) (-718.174) (-715.148) -- 0:00:05
916000 -- (-716.990) (-714.907) [-716.859] (-716.343) * (-715.887) (-715.626) [-718.902] (-716.052) -- 0:00:05
916500 -- (-716.024) (-714.851) [-715.978] (-716.250) * (-717.769) (-716.033) [-718.408] (-717.624) -- 0:00:05
917000 -- (-714.471) (-714.687) (-714.899) [-714.674] * [-717.016] (-715.922) (-714.579) (-718.347) -- 0:00:05
917500 -- [-715.683] (-715.455) (-717.522) (-715.422) * (-718.716) (-718.084) [-714.374] (-721.703) -- 0:00:05
918000 -- [-717.058] (-715.412) (-715.254) (-718.787) * (-718.048) (-716.362) [-714.363] (-716.297) -- 0:00:05
918500 -- (-715.665) (-717.202) (-715.249) [-717.420] * (-715.824) (-717.353) [-717.056] (-714.888) -- 0:00:04
919000 -- (-718.216) (-715.146) [-716.569] (-719.539) * (-718.586) [-717.544] (-716.319) (-714.888) -- 0:00:04
919500 -- [-715.129] (-714.927) (-716.129) (-715.876) * (-717.797) (-718.767) [-714.700] (-716.252) -- 0:00:04
920000 -- [-714.688] (-716.511) (-718.136) (-721.622) * (-716.834) (-716.135) (-716.098) [-717.627] -- 0:00:04
Average standard deviation of split frequencies: 0.007578
920500 -- [-715.373] (-716.842) (-720.535) (-717.625) * (-717.099) [-718.035] (-714.773) (-718.550) -- 0:00:04
921000 -- [-718.278] (-717.028) (-718.813) (-719.973) * (-717.509) (-721.705) [-715.253] (-717.456) -- 0:00:04
921500 -- (-716.477) [-715.589] (-714.932) (-715.694) * (-716.796) (-723.588) (-715.378) [-717.863] -- 0:00:04
922000 -- (-719.620) (-717.106) [-715.530] (-717.423) * [-721.952] (-721.139) (-717.697) (-717.046) -- 0:00:04
922500 -- (-717.909) (-716.313) (-715.679) [-717.597] * [-718.681] (-720.700) (-715.818) (-719.059) -- 0:00:04
923000 -- [-717.337] (-717.154) (-716.381) (-718.511) * (-721.335) (-721.548) (-716.341) [-719.833] -- 0:00:04
923500 -- (-715.501) (-716.847) (-715.288) [-716.858] * [-720.291] (-716.665) (-718.873) (-716.239) -- 0:00:04
924000 -- (-715.330) (-714.670) (-715.258) [-716.640] * (-720.899) (-720.869) (-716.631) [-715.259] -- 0:00:04
924500 -- (-714.853) (-715.811) [-718.904] (-719.660) * [-717.103] (-717.545) (-719.395) (-716.952) -- 0:00:04
925000 -- (-719.476) [-714.904] (-718.999) (-716.805) * (-716.360) (-715.876) (-718.690) [-716.684] -- 0:00:04
Average standard deviation of split frequencies: 0.007127
925500 -- [-716.703] (-717.055) (-719.472) (-715.151) * [-716.367] (-715.906) (-720.607) (-718.151) -- 0:00:04
926000 -- (-718.152) (-716.126) [-716.584] (-715.046) * [-718.196] (-718.238) (-716.987) (-716.723) -- 0:00:04
926500 -- (-716.556) [-716.808] (-720.661) (-716.054) * [-717.248] (-715.501) (-717.167) (-715.366) -- 0:00:04
927000 -- (-716.566) [-717.357] (-718.245) (-718.645) * (-717.491) (-715.952) (-717.155) [-718.186] -- 0:00:04
927500 -- (-716.832) (-715.884) [-722.914] (-715.848) * (-714.492) (-718.441) (-715.981) [-715.182] -- 0:00:04
928000 -- [-717.699] (-714.365) (-718.886) (-717.866) * (-717.363) [-718.176] (-718.000) (-717.194) -- 0:00:04
928500 -- (-722.261) (-723.596) (-718.434) [-715.309] * (-717.242) (-715.334) (-716.750) [-719.155] -- 0:00:04
929000 -- (-716.695) (-716.632) (-715.566) [-716.465] * [-718.043] (-715.016) (-715.882) (-722.785) -- 0:00:04
929500 -- (-715.991) (-716.457) (-719.121) [-714.754] * (-714.915) [-715.403] (-716.786) (-722.279) -- 0:00:04
930000 -- [-716.805] (-717.638) (-726.822) (-714.678) * (-714.674) (-716.129) [-717.640] (-717.116) -- 0:00:04
Average standard deviation of split frequencies: 0.006787
930500 -- [-714.413] (-716.695) (-721.821) (-716.580) * [-716.218] (-715.434) (-717.937) (-717.733) -- 0:00:04
931000 -- (-715.685) [-716.042] (-722.794) (-716.281) * [-716.537] (-715.999) (-716.872) (-716.212) -- 0:00:04
931500 -- [-715.421] (-717.531) (-719.016) (-716.048) * (-716.384) [-715.047] (-720.853) (-715.731) -- 0:00:04
932000 -- (-716.102) [-717.882] (-716.717) (-717.924) * (-716.696) [-714.416] (-721.621) (-718.395) -- 0:00:04
932500 -- [-718.131] (-715.197) (-718.422) (-715.309) * (-715.896) (-714.437) (-717.953) [-719.075] -- 0:00:04
933000 -- (-717.419) [-716.286] (-714.400) (-717.508) * [-715.051] (-714.266) (-716.338) (-725.110) -- 0:00:04
933500 -- (-720.678) (-715.871) [-715.184] (-715.668) * (-715.793) (-716.730) [-716.054] (-718.215) -- 0:00:04
934000 -- (-718.507) (-716.719) (-715.387) [-715.475] * [-715.019] (-716.613) (-716.242) (-717.860) -- 0:00:04
934500 -- (-719.419) [-716.929] (-715.592) (-717.316) * (-716.890) (-715.893) (-717.676) [-719.244] -- 0:00:03
935000 -- [-714.587] (-719.155) (-716.983) (-717.387) * [-716.138] (-719.185) (-715.290) (-718.225) -- 0:00:03
Average standard deviation of split frequencies: 0.006648
935500 -- [-715.295] (-716.018) (-715.370) (-720.194) * (-714.684) (-717.791) [-715.290] (-715.524) -- 0:00:03
936000 -- (-714.470) (-714.972) [-717.140] (-717.984) * [-714.667] (-715.460) (-718.736) (-716.715) -- 0:00:03
936500 -- (-716.723) (-717.032) (-718.011) [-714.448] * (-714.666) (-720.276) [-714.595] (-717.029) -- 0:00:03
937000 -- [-715.882] (-717.382) (-720.551) (-715.161) * (-716.216) (-722.499) [-715.325] (-718.770) -- 0:00:03
937500 -- (-716.174) [-717.991] (-716.951) (-717.101) * (-719.591) [-718.049] (-719.704) (-719.601) -- 0:00:03
938000 -- (-715.693) (-717.943) (-717.441) [-715.785] * (-719.378) [-715.033] (-720.634) (-716.063) -- 0:00:03
938500 -- (-714.807) (-716.032) [-715.645] (-714.787) * (-715.545) (-715.968) (-714.927) [-717.873] -- 0:00:03
939000 -- (-717.530) (-715.818) (-717.995) [-716.236] * (-715.299) (-715.577) (-715.464) [-718.301] -- 0:00:03
939500 -- (-715.691) [-715.557] (-715.895) (-716.438) * (-717.791) (-715.388) [-716.160] (-716.428) -- 0:00:03
940000 -- (-714.451) (-715.886) (-715.964) [-716.601] * (-716.076) [-715.742] (-715.562) (-715.950) -- 0:00:03
Average standard deviation of split frequencies: 0.006548
940500 -- [-721.120] (-715.738) (-716.066) (-717.301) * (-715.743) (-716.313) [-716.000] (-716.783) -- 0:00:03
941000 -- (-723.544) (-715.421) (-715.707) [-716.486] * (-716.870) (-715.127) (-716.028) [-718.209] -- 0:00:03
941500 -- (-721.292) [-718.045] (-714.675) (-716.763) * [-715.270] (-715.378) (-719.590) (-718.297) -- 0:00:03
942000 -- (-716.079) (-716.977) (-716.503) [-714.343] * (-716.099) (-715.708) [-715.231] (-714.717) -- 0:00:03
942500 -- [-716.298] (-714.712) (-720.336) (-715.356) * (-716.915) [-715.346] (-714.897) (-714.730) -- 0:00:03
943000 -- [-716.053] (-714.550) (-716.180) (-715.488) * (-717.296) [-716.477] (-717.231) (-714.716) -- 0:00:03
943500 -- (-717.020) [-715.944] (-721.319) (-714.866) * (-716.985) [-715.461] (-716.368) (-715.720) -- 0:00:03
944000 -- (-715.378) (-715.378) [-716.193] (-715.324) * (-718.453) [-717.185] (-714.558) (-716.358) -- 0:00:03
944500 -- [-719.046] (-719.048) (-719.448) (-717.877) * [-717.739] (-716.409) (-714.536) (-720.513) -- 0:00:03
945000 -- (-716.833) [-716.081] (-716.904) (-714.811) * (-718.613) (-716.579) [-714.571] (-715.476) -- 0:00:03
Average standard deviation of split frequencies: 0.006412
945500 -- (-714.939) [-716.032] (-718.049) (-718.383) * [-716.620] (-720.397) (-716.822) (-719.889) -- 0:00:03
946000 -- (-715.012) (-716.019) [-715.646] (-717.416) * (-715.671) (-719.899) [-717.139] (-716.093) -- 0:00:03
946500 -- (-715.646) [-717.258] (-715.604) (-720.427) * [-719.111] (-719.038) (-717.079) (-718.236) -- 0:00:03
947000 -- (-715.159) (-725.449) [-715.812] (-714.798) * (-717.982) [-717.728] (-715.813) (-719.345) -- 0:00:03
947500 -- [-720.540] (-724.856) (-717.130) (-720.172) * (-715.648) (-715.064) [-714.954] (-716.947) -- 0:00:03
948000 -- (-716.085) (-721.777) [-718.250] (-715.168) * [-717.175] (-716.343) (-716.579) (-716.016) -- 0:00:03
948500 -- (-714.629) [-718.855] (-715.310) (-717.564) * [-714.776] (-721.632) (-715.540) (-718.148) -- 0:00:03
949000 -- (-718.951) (-717.890) [-716.328] (-716.288) * (-715.234) (-720.390) [-715.968] (-717.698) -- 0:00:03
949500 -- (-716.631) [-718.254] (-714.817) (-716.346) * (-715.960) (-718.329) (-715.779) [-715.027] -- 0:00:03
950000 -- (-717.274) (-717.027) [-716.558] (-715.197) * (-715.608) (-716.798) [-718.969] (-717.401) -- 0:00:03
Average standard deviation of split frequencies: 0.006215
950500 -- (-716.815) [-719.798] (-719.508) (-715.452) * (-716.798) [-715.177] (-717.916) (-717.545) -- 0:00:03
951000 -- [-715.182] (-717.674) (-719.760) (-716.406) * (-718.549) (-715.344) [-716.415] (-717.450) -- 0:00:02
951500 -- [-714.654] (-715.229) (-717.576) (-718.061) * (-715.371) (-715.229) (-718.591) [-714.913] -- 0:00:02
952000 -- (-716.921) (-719.033) (-718.505) [-717.163] * (-714.555) (-715.627) [-715.106] (-716.296) -- 0:00:02
952500 -- (-717.731) (-715.611) (-717.001) [-717.109] * (-717.633) (-716.159) (-718.932) [-715.079] -- 0:00:02
953000 -- (-717.045) [-717.155] (-715.939) (-717.469) * [-715.501] (-720.436) (-717.452) (-718.843) -- 0:00:02
953500 -- (-719.268) (-716.156) (-715.835) [-714.909] * (-715.656) (-720.997) [-716.293] (-719.720) -- 0:00:02
954000 -- (-719.792) (-717.836) (-716.989) [-714.917] * (-715.191) (-717.039) [-715.523] (-717.229) -- 0:00:02
954500 -- (-720.484) (-716.373) [-716.239] (-715.515) * [-717.210] (-715.523) (-715.408) (-717.520) -- 0:00:02
955000 -- (-716.586) (-714.616) [-718.084] (-715.153) * (-716.698) [-719.880] (-718.267) (-714.556) -- 0:00:02
Average standard deviation of split frequencies: 0.006377
955500 -- [-715.270] (-719.808) (-718.231) (-717.166) * (-718.255) (-715.638) (-720.911) [-715.091] -- 0:00:02
956000 -- [-718.271] (-719.573) (-718.016) (-716.012) * [-717.926] (-717.845) (-716.766) (-718.521) -- 0:00:02
956500 -- (-714.933) (-716.638) [-715.408] (-716.005) * [-716.060] (-716.018) (-718.028) (-715.929) -- 0:00:02
957000 -- (-715.782) (-718.014) [-715.081] (-722.063) * (-719.151) (-715.711) [-715.374] (-717.522) -- 0:00:02
957500 -- (-718.864) (-716.743) [-717.586] (-715.964) * [-717.460] (-715.435) (-717.935) (-717.305) -- 0:00:02
958000 -- [-718.969] (-718.321) (-715.472) (-716.564) * [-717.313] (-717.010) (-721.037) (-718.819) -- 0:00:02
958500 -- [-717.796] (-721.094) (-716.815) (-715.517) * (-720.064) [-716.602] (-717.849) (-718.331) -- 0:00:02
959000 -- [-717.351] (-718.372) (-716.346) (-716.033) * (-717.868) [-717.821] (-715.401) (-720.601) -- 0:00:02
959500 -- [-714.700] (-716.992) (-715.717) (-717.400) * (-717.364) [-716.294] (-718.329) (-716.963) -- 0:00:02
960000 -- (-717.168) (-716.767) [-714.762] (-718.680) * (-716.651) (-720.960) (-715.272) [-716.644] -- 0:00:02
Average standard deviation of split frequencies: 0.006183
960500 -- (-719.525) (-717.085) (-718.705) [-718.007] * (-718.745) (-721.731) (-717.802) [-714.671] -- 0:00:02
961000 -- (-720.151) [-715.504] (-715.665) (-715.406) * (-715.192) (-718.339) [-715.507] (-714.671) -- 0:00:02
961500 -- (-723.511) (-714.971) (-718.449) [-715.942] * (-717.798) (-719.207) (-716.405) [-719.378] -- 0:00:02
962000 -- [-715.218] (-715.551) (-719.600) (-715.934) * [-716.149] (-715.337) (-716.398) (-719.517) -- 0:00:02
962500 -- (-715.339) (-715.678) (-718.025) [-715.915] * (-714.953) (-716.376) [-716.153] (-715.514) -- 0:00:02
963000 -- (-716.139) [-716.133] (-715.308) (-719.959) * (-717.868) (-721.046) (-717.747) [-717.199] -- 0:00:02
963500 -- [-716.891] (-716.031) (-715.923) (-717.748) * (-717.771) (-717.226) [-719.826] (-721.868) -- 0:00:02
964000 -- [-714.950] (-714.965) (-719.302) (-716.627) * (-717.436) (-714.675) [-715.485] (-718.543) -- 0:00:02
964500 -- (-715.348) (-717.010) [-715.788] (-715.482) * (-716.351) (-716.791) (-716.896) [-716.335] -- 0:00:02
965000 -- (-717.189) [-716.467] (-719.331) (-715.194) * (-717.265) [-714.722] (-719.808) (-716.526) -- 0:00:02
Average standard deviation of split frequencies: 0.006084
965500 -- [-716.423] (-717.847) (-715.595) (-715.533) * [-716.313] (-715.022) (-716.087) (-714.981) -- 0:00:02
966000 -- (-715.451) (-718.102) [-715.692] (-716.361) * [-715.738] (-717.973) (-718.732) (-718.503) -- 0:00:02
966500 -- (-719.358) [-716.716] (-715.666) (-715.939) * (-717.497) (-716.845) (-716.077) [-717.798] -- 0:00:02
967000 -- (-714.286) (-716.651) (-716.778) [-714.633] * [-716.128] (-714.728) (-714.610) (-721.991) -- 0:00:02
967500 -- (-714.732) [-715.629] (-715.921) (-714.459) * [-717.455] (-714.619) (-716.502) (-719.696) -- 0:00:01
968000 -- (-715.438) (-720.718) (-718.765) [-715.375] * (-717.688) (-715.187) (-715.340) [-716.676] -- 0:00:01
968500 -- (-722.138) [-714.449] (-715.094) (-715.539) * [-716.007] (-715.623) (-717.698) (-724.110) -- 0:00:01
969000 -- (-716.949) (-716.335) [-714.931] (-721.269) * [-714.623] (-718.539) (-714.983) (-721.698) -- 0:00:01
969500 -- [-716.949] (-716.267) (-719.538) (-718.032) * (-719.586) (-716.616) [-714.821] (-716.836) -- 0:00:01
970000 -- (-718.194) (-720.189) (-716.546) [-720.399] * (-714.475) (-715.732) [-714.770] (-716.077) -- 0:00:01
Average standard deviation of split frequencies: 0.006022
970500 -- (-715.203) (-721.323) (-715.740) [-715.320] * (-717.933) (-720.238) (-715.508) [-715.914] -- 0:00:01
971000 -- [-714.566] (-719.503) (-719.690) (-718.644) * (-715.679) (-718.237) (-716.397) [-717.543] -- 0:00:01
971500 -- [-715.537] (-718.947) (-720.812) (-717.443) * (-715.575) (-717.053) [-715.537] (-714.790) -- 0:00:01
972000 -- (-714.799) [-718.020] (-715.756) (-717.377) * (-715.163) (-717.033) [-715.192] (-714.831) -- 0:00:01
972500 -- (-714.851) [-715.512] (-716.977) (-718.657) * [-718.991] (-720.669) (-714.813) (-714.594) -- 0:00:01
973000 -- (-718.072) (-717.012) (-716.812) [-716.035] * (-716.093) (-715.029) [-714.830] (-714.667) -- 0:00:01
973500 -- (-720.413) [-718.879] (-715.503) (-719.049) * (-715.765) (-715.188) (-715.259) [-715.338] -- 0:00:01
974000 -- (-717.603) (-716.617) (-715.726) [-716.581] * (-714.579) (-716.577) [-716.241] (-720.749) -- 0:00:01
974500 -- (-715.066) (-717.226) (-715.777) [-716.373] * [-715.210] (-717.930) (-716.357) (-717.416) -- 0:00:01
975000 -- (-715.753) (-714.543) (-720.186) [-716.481] * (-716.918) [-716.737] (-718.223) (-718.151) -- 0:00:01
Average standard deviation of split frequencies: 0.006021
975500 -- (-717.837) (-716.219) (-717.313) [-716.723] * (-716.243) [-717.314] (-717.514) (-719.923) -- 0:00:01
976000 -- [-717.082] (-716.327) (-720.269) (-715.435) * (-716.058) (-714.904) [-715.058] (-719.239) -- 0:00:01
976500 -- [-715.459] (-718.713) (-718.756) (-716.938) * (-716.367) (-718.866) (-717.118) [-716.441] -- 0:00:01
977000 -- (-720.575) (-718.227) [-716.532] (-720.906) * [-717.209] (-720.294) (-718.225) (-714.532) -- 0:00:01
977500 -- [-716.618] (-716.167) (-718.840) (-719.270) * (-717.206) (-716.990) [-715.111] (-718.474) -- 0:00:01
978000 -- (-719.898) (-718.903) (-716.638) [-718.617] * (-715.179) [-717.638] (-717.566) (-717.218) -- 0:00:01
978500 -- (-716.048) [-717.059] (-716.551) (-716.895) * [-717.577] (-716.500) (-717.588) (-717.761) -- 0:00:01
979000 -- (-715.876) (-719.477) (-718.787) [-717.682] * (-715.999) (-723.487) [-718.000] (-716.566) -- 0:00:01
979500 -- (-716.170) (-717.712) [-715.850] (-717.417) * (-716.083) (-717.952) (-716.272) [-715.814] -- 0:00:01
980000 -- (-715.739) (-719.612) (-715.905) [-716.179] * (-716.921) (-719.511) (-718.019) [-715.778] -- 0:00:01
Average standard deviation of split frequencies: 0.005416
980500 -- (-715.084) (-719.094) [-716.849] (-717.091) * (-715.614) (-716.460) (-715.171) [-718.030] -- 0:00:01
981000 -- (-715.480) [-716.241] (-718.438) (-717.209) * (-717.144) (-715.092) (-718.777) [-714.678] -- 0:00:01
981500 -- (-715.705) (-716.459) (-714.675) [-719.408] * (-715.510) (-716.108) (-715.607) [-714.531] -- 0:00:01
982000 -- [-716.545] (-719.269) (-717.291) (-722.793) * [-715.159] (-719.850) (-714.400) (-720.612) -- 0:00:01
982500 -- (-715.443) (-720.333) (-721.702) [-719.707] * [-716.529] (-719.316) (-715.156) (-718.556) -- 0:00:01
983000 -- (-716.691) (-717.358) [-716.570] (-722.311) * (-715.212) (-716.992) [-716.471] (-717.198) -- 0:00:01
983500 -- [-717.889] (-716.560) (-715.002) (-719.652) * [-715.170] (-715.517) (-718.133) (-717.478) -- 0:00:01
984000 -- (-715.574) [-715.995] (-714.774) (-719.619) * (-717.422) (-717.859) (-717.293) [-716.879] -- 0:00:00
984500 -- (-715.224) (-719.588) [-717.590] (-717.965) * (-716.881) (-718.545) (-717.360) [-716.052] -- 0:00:00
985000 -- (-716.022) (-717.963) (-718.034) [-718.015] * (-717.455) (-716.389) [-718.556] (-716.476) -- 0:00:00
Average standard deviation of split frequencies: 0.005897
985500 -- (-718.109) (-718.436) (-718.079) [-716.091] * (-718.862) (-715.779) [-715.492] (-715.275) -- 0:00:00
986000 -- (-717.751) (-715.468) [-716.949] (-717.047) * (-720.253) [-717.279] (-716.791) (-715.035) -- 0:00:00
986500 -- [-714.843] (-715.476) (-717.096) (-719.495) * (-716.074) [-715.139] (-717.718) (-715.181) -- 0:00:00
987000 -- (-714.646) (-717.229) [-714.983] (-717.818) * (-721.418) (-714.536) (-715.135) [-717.680] -- 0:00:00
987500 -- (-715.063) [-715.030] (-715.457) (-716.256) * (-722.040) (-717.082) [-717.508] (-721.490) -- 0:00:00
988000 -- (-716.336) (-716.494) (-716.331) [-715.983] * (-718.955) (-717.303) [-715.836] (-715.970) -- 0:00:00
988500 -- [-714.537] (-716.839) (-716.640) (-718.249) * (-717.327) (-716.397) [-715.784] (-715.626) -- 0:00:00
989000 -- (-714.856) (-716.168) (-717.757) [-715.640] * (-717.095) (-720.145) [-714.566] (-715.178) -- 0:00:00
989500 -- (-715.395) (-716.478) (-719.211) [-715.736] * (-715.380) [-717.578] (-717.665) (-718.274) -- 0:00:00
990000 -- (-715.430) (-715.311) [-718.171] (-717.158) * [-716.478] (-716.952) (-716.517) (-720.290) -- 0:00:00
Average standard deviation of split frequencies: 0.005805
990500 -- (-716.731) [-718.238] (-720.384) (-717.491) * [-714.640] (-717.491) (-718.155) (-715.287) -- 0:00:00
991000 -- (-719.759) (-716.096) (-715.450) [-716.822] * (-721.445) (-717.130) [-716.301] (-715.368) -- 0:00:00
991500 -- [-714.562] (-721.498) (-715.181) (-716.371) * (-716.102) [-715.818] (-719.648) (-715.034) -- 0:00:00
992000 -- (-717.151) (-720.425) [-715.062] (-716.284) * (-716.281) [-714.744] (-717.430) (-715.101) -- 0:00:00
992500 -- [-716.234] (-721.577) (-716.536) (-717.035) * (-715.948) [-716.804] (-718.203) (-715.083) -- 0:00:00
993000 -- (-716.267) (-720.921) [-715.719] (-719.686) * (-716.407) [-718.580] (-716.272) (-714.946) -- 0:00:00
993500 -- (-715.156) [-716.223] (-717.076) (-715.699) * [-715.316] (-714.487) (-719.040) (-717.320) -- 0:00:00
994000 -- (-716.583) (-716.913) (-718.198) [-717.646] * (-721.151) [-716.425] (-718.289) (-715.934) -- 0:00:00
994500 -- (-715.632) (-718.620) (-718.318) [-715.612] * (-721.263) (-715.286) [-715.584] (-717.407) -- 0:00:00
995000 -- (-717.154) (-718.838) (-722.211) [-717.324] * (-716.393) (-715.805) (-719.265) [-716.143] -- 0:00:00
Average standard deviation of split frequencies: 0.006374
995500 -- [-716.203] (-716.520) (-718.695) (-714.768) * (-716.334) [-717.384] (-720.773) (-719.047) -- 0:00:00
996000 -- (-716.372) (-716.072) (-717.438) [-716.725] * [-714.910] (-717.276) (-718.401) (-719.555) -- 0:00:00
996500 -- (-715.146) [-717.814] (-716.939) (-714.672) * [-715.340] (-717.773) (-715.532) (-715.582) -- 0:00:00
997000 -- (-716.047) (-715.219) (-718.399) [-715.840] * (-715.624) (-715.245) (-715.538) [-714.813] -- 0:00:00
997500 -- (-718.928) (-718.485) (-718.773) [-715.426] * [-718.498] (-715.259) (-715.446) (-716.029) -- 0:00:00
998000 -- [-714.767] (-717.950) (-719.200) (-716.635) * [-719.397] (-715.420) (-715.355) (-718.243) -- 0:00:00
998500 -- (-715.576) (-715.654) (-719.035) [-719.135] * (-717.854) [-716.890] (-715.413) (-715.699) -- 0:00:00
999000 -- (-716.000) [-717.865] (-716.301) (-715.228) * [-716.017] (-718.382) (-717.605) (-714.995) -- 0:00:00
999500 -- (-719.910) (-717.605) [-716.858] (-715.171) * (-715.570) [-720.011] (-718.395) (-718.062) -- 0:00:00
1000000 -- (-721.324) (-715.093) [-715.206] (-718.919) * (-716.750) (-719.907) (-719.388) [-714.700] -- 0:00:00
Average standard deviation of split frequencies: 0.006658
Analysis completed in 1 mins 1 seconds
Analysis used 59.51 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -714.13
Likelihood of best state for "cold" chain of run 2 was -714.13
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.5 % ( 69 %) Dirichlet(Revmat{all})
99.9 % ( 99 %) Slider(Revmat{all})
30.8 % ( 25 %) Dirichlet(Pi{all})
31.4 % ( 29 %) Slider(Pi{all})
79.8 % ( 63 %) Multiplier(Alpha{1,2})
77.8 % ( 58 %) Multiplier(Alpha{3})
22.8 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 97 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.3 % ( 99 %) Nodeslider(V{all})
30.7 % ( 16 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.9 % ( 72 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
30.5 % ( 18 %) Dirichlet(Pi{all})
31.9 % ( 31 %) Slider(Pi{all})
79.0 % ( 48 %) Multiplier(Alpha{1,2})
77.7 % ( 53 %) Multiplier(Alpha{3})
23.2 % ( 23 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.2 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166636 0.82 0.67
3 | 166537 166922 0.84
4 | 166082 166831 166992
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167217 0.82 0.67
3 | 166018 167247 0.84
4 | 166625 166357 166536
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -715.91
| 1 2 2 2 |
| 2 2 2 12 2 1 |
| 21 2 2 1 * |
| 1 2 2 11 1 2 2 2 1 1 1|
| 2 1 12 111 1 2 2 1 2 1 1 1 2* 22|
|1 * 212 21 11 22 1 * 2 2 1 1 2 |
| 1 2 12 12 2 1 2 2 1 1 12 2 |
| * 1 1 2 |
| 1 121 1 1 |
|2 2 1 1 21 1 1 1 |
| 2 2 1 |
| 11 |
| 2 2 1 2 22 |
| 2 2 |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -717.68
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -715.84 -719.30
2 -715.83 -720.03
--------------------------------------
TOTAL -715.84 -719.73
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893394 0.088449 0.386569 1.516179 0.862644 1501.00 1501.00 1.000
r(A<->C){all} 0.181146 0.022411 0.000041 0.483854 0.146560 138.78 144.54 1.002
r(A<->G){all} 0.161511 0.019370 0.000034 0.436455 0.124223 105.96 164.74 1.007
r(A<->T){all} 0.179589 0.021844 0.000004 0.482007 0.144309 223.10 253.98 1.002
r(C<->G){all} 0.158166 0.019112 0.000008 0.431719 0.119965 109.79 157.31 1.003
r(C<->T){all} 0.155464 0.019186 0.000041 0.441523 0.116433 304.99 321.97 1.004
r(G<->T){all} 0.164125 0.020480 0.000082 0.451791 0.124246 240.22 243.81 1.004
pi(A){all} 0.171203 0.000256 0.140950 0.203207 0.171003 1215.48 1272.38 1.000
pi(C){all} 0.364912 0.000427 0.323798 0.405559 0.364785 1250.05 1307.88 1.000
pi(G){all} 0.280372 0.000370 0.243153 0.318737 0.280288 851.45 982.57 1.000
pi(T){all} 0.183513 0.000281 0.151863 0.218042 0.183092 1228.78 1234.07 1.000
alpha{1,2} 0.418172 0.220739 0.000130 1.350798 0.258519 1171.83 1207.76 1.001
alpha{3} 0.453314 0.232650 0.000342 1.378326 0.288352 1424.16 1430.06 1.000
pinvar{all} 0.997063 0.000012 0.990334 0.999999 0.998182 1159.69 1237.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- .*.***
9 -- .**.**
10 -- ...*.*
11 -- ....**
12 -- ..****
13 -- .**...
14 -- .*.*..
15 -- ...**.
16 -- .****.
17 -- ..*.*.
18 -- ..**..
19 -- .***.*
20 -- ..*..*
21 -- .*...*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 467 0.155563 0.015546 0.144570 0.166556 2
8 462 0.153897 0.000942 0.153231 0.154564 2
9 447 0.148901 0.007066 0.143904 0.153897 2
10 444 0.147901 0.000942 0.147235 0.148568 2
11 444 0.147901 0.006595 0.143238 0.152565 2
12 441 0.146902 0.012719 0.137908 0.155896 2
13 438 0.145903 0.001884 0.144570 0.147235 2
14 438 0.145903 0.000942 0.145237 0.146569 2
15 427 0.142239 0.003298 0.139907 0.144570 2
16 416 0.138574 0.002827 0.136576 0.140573 2
17 415 0.138241 0.006124 0.133911 0.142572 2
18 413 0.137575 0.007066 0.132578 0.142572 2
19 405 0.134910 0.015546 0.123917 0.145903 2
20 405 0.134910 0.011777 0.126582 0.143238 2
21 372 0.123917 0.006595 0.119254 0.128581 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100567 0.009972 0.000030 0.296664 0.071245 1.001 2
length{all}[2] 0.098655 0.010382 0.000028 0.308883 0.065946 1.002 2
length{all}[3] 0.099709 0.010630 0.000004 0.307862 0.066731 1.000 2
length{all}[4] 0.099603 0.010223 0.000025 0.301415 0.067798 1.000 2
length{all}[5] 0.097980 0.009533 0.000074 0.295149 0.069622 1.000 2
length{all}[6] 0.098197 0.010177 0.000054 0.300126 0.066144 1.000 2
length{all}[7] 0.101454 0.010312 0.000200 0.284129 0.073945 0.998 2
length{all}[8] 0.102346 0.011288 0.000131 0.333220 0.066811 1.003 2
length{all}[9] 0.097827 0.009954 0.000126 0.292160 0.068066 1.004 2
length{all}[10] 0.100357 0.012065 0.000001 0.288784 0.066101 0.998 2
length{all}[11] 0.100425 0.008191 0.000173 0.278683 0.073482 0.999 2
length{all}[12] 0.093224 0.006722 0.000264 0.256489 0.073078 1.001 2
length{all}[13] 0.101486 0.010174 0.000322 0.331776 0.069785 0.999 2
length{all}[14] 0.099932 0.010961 0.000209 0.300027 0.067601 1.016 2
length{all}[15] 0.097444 0.009384 0.000485 0.287458 0.067596 1.003 2
length{all}[16] 0.107598 0.010847 0.000012 0.343502 0.075285 0.999 2
length{all}[17] 0.103465 0.010586 0.000064 0.325371 0.068769 1.005 2
length{all}[18] 0.101460 0.010087 0.000035 0.289338 0.070933 0.998 2
length{all}[19] 0.097912 0.009670 0.000215 0.288933 0.065357 0.998 2
length{all}[20] 0.097354 0.009143 0.000595 0.297965 0.070352 1.000 2
length{all}[21] 0.100100 0.011317 0.000105 0.304660 0.066839 1.002 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006658
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.016
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 534
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 51 patterns at 178 / 178 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 51 patterns at 178 / 178 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
49776 bytes for conP
4488 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.078526 0.049551 0.024547 0.044916 0.014247 0.015429 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -734.507911
Iterating by ming2
Initial: fx= 734.507911
x= 0.07853 0.04955 0.02455 0.04492 0.01425 0.01543 0.30000 1.30000
1 h-m-p 0.0000 0.0001 427.7589 ++ 719.633148 m 0.0001 13 | 1/8
2 h-m-p 0.0010 0.0096 32.6570 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 391.2171 ++ 718.601471 m 0.0000 44 | 2/8
4 h-m-p 0.0001 0.0122 26.1315 ---------.. | 2/8
5 h-m-p 0.0000 0.0001 349.5268 ++ 712.233701 m 0.0001 73 | 3/8
6 h-m-p 0.0007 0.0147 21.7474 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 302.7460 ++ 701.506651 m 0.0001 104 | 4/8
8 h-m-p 0.0019 0.0224 14.9409 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 247.8725 ++ 699.871494 m 0.0000 136 | 5/8
10 h-m-p 0.0005 0.0389 9.0643 -----------.. | 5/8
11 h-m-p 0.0000 0.0002 174.9293 +++ 694.738141 m 0.0002 168 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 Y 694.738141 0 1.2143 179 | 6/8
13 h-m-p 0.9907 8.0000 0.0000 --------------Y 694.738141 0 0.0000 206
Out..
lnL = -694.738141
207 lfun, 207 eigenQcodon, 1242 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.070347 0.017464 0.030544 0.053055 0.096385 0.044389 0.299962 0.670453 0.330308
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.207808
np = 9
lnL0 = -748.370027
Iterating by ming2
Initial: fx= 748.370027
x= 0.07035 0.01746 0.03054 0.05306 0.09639 0.04439 0.29996 0.67045 0.33031
1 h-m-p 0.0000 0.0001 412.3382 ++ 730.759816 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0005 163.0247 ++ 719.444067 m 0.0005 26 | 2/9
3 h-m-p 0.0000 0.0001 873.1733 ++ 710.985087 m 0.0001 38 | 3/9
4 h-m-p 0.0000 0.0001 648.3147 ++ 705.939829 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0000 19899.8145 ++ 699.466298 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 47958.7272 ++ 698.410161 m 0.0000 74 | 6/9
7 h-m-p 0.0013 0.0966 4.9319 -----------.. | 6/9
8 h-m-p 0.0000 0.0001 173.2168 ++ 694.738143 m 0.0001 107 | 7/9
9 h-m-p 0.2621 8.0000 0.0000 +++ 694.738143 m 8.0000 120 | 7/9
10 h-m-p 0.0160 8.0000 0.0124 +++++ 694.738141 m 8.0000 137 | 7/9
11 h-m-p 0.0609 0.3047 0.9203 ++ 694.738136 m 0.3047 151 | 8/9
12 h-m-p 1.0571 5.2856 0.1132 ++ 694.738133 m 5.2856 165 | 9/9
13 h-m-p 0.0160 8.0000 0.0000 N 694.738133 0 0.0160 178
Out..
lnL = -694.738133
179 lfun, 537 eigenQcodon, 2148 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038794 0.048338 0.059255 0.080499 0.039528 0.102787 0.000100 1.663689 0.161138 0.271138 1.522349
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.749535
np = 11
lnL0 = -756.406156
Iterating by ming2
Initial: fx= 756.406156
x= 0.03879 0.04834 0.05925 0.08050 0.03953 0.10279 0.00011 1.66369 0.16114 0.27114 1.52235
1 h-m-p 0.0000 0.0000 391.2151 ++ 755.724052 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0011 215.6824 ++++ 717.234235 m 0.0011 32 | 2/11
3 h-m-p 0.0000 0.0000 1305.5115 ++ 716.693690 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0003 241.8189 +++ 711.098739 m 0.0003 61 | 4/11
5 h-m-p 0.0005 0.0023 41.9030 ++ 709.245757 m 0.0023 75 | 5/11
6 h-m-p 0.0000 0.0002 264.5736 ++ 703.396502 m 0.0002 89 | 6/11
7 h-m-p 0.0032 0.0212 11.4817 ------------.. | 6/11
8 h-m-p 0.0000 0.0001 238.4238 ++ 696.582242 m 0.0001 127 | 7/11
9 h-m-p 0.0160 8.0000 2.7865 -------------.. | 7/11
10 h-m-p 0.0000 0.0001 173.7043 ++ 694.738136 m 0.0001 166 | 8/11
11 h-m-p 0.2651 8.0000 0.0000 +++ 694.738136 m 8.0000 181 | 8/11
12 h-m-p 0.0539 8.0000 0.0002 ++++ 694.738136 m 8.0000 200 | 8/11
13 h-m-p 0.0160 8.0000 1.3085 -------Y 694.738136 0 0.0000 224 | 8/11
14 h-m-p 0.0904 8.0000 0.0000 C 694.738136 0 0.0226 238 | 8/11
15 h-m-p 0.0270 8.0000 0.0000 ---Y 694.738136 0 0.0001 258
Out..
lnL = -694.738136
259 lfun, 1036 eigenQcodon, 4662 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -694.748604 S = -694.736524 -0.004624
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:02
did 20 / 51 patterns 0:02
did 30 / 51 patterns 0:02
did 40 / 51 patterns 0:02
did 50 / 51 patterns 0:02
did 51 / 51 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.018088 0.034825 0.034516 0.103706 0.085231 0.073970 0.000100 0.422487 1.940728
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 18.553079
np = 9
lnL0 = -754.033388
Iterating by ming2
Initial: fx= 754.033388
x= 0.01809 0.03482 0.03452 0.10371 0.08523 0.07397 0.00011 0.42249 1.94073
1 h-m-p 0.0000 0.0000 403.1649 ++ 753.551890 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0597 13.0037 ----------.. | 1/9
3 h-m-p 0.0000 0.0001 403.3754 ++ 736.382642 m 0.0001 46 | 2/9
4 h-m-p 0.0034 0.0677 11.2556 ------------.. | 2/9
5 h-m-p 0.0000 0.0001 373.6160 ++ 722.646924 m 0.0001 80 | 3/9
6 h-m-p 0.0037 0.0627 8.7828 ------------.. | 3/9
7 h-m-p 0.0000 0.0000 338.2977 ++ 722.438549 m 0.0000 114 | 4/9
8 h-m-p 0.0001 0.0564 8.2959 ----------.. | 4/9
9 h-m-p 0.0000 0.0002 290.9365 +++ 702.162640 m 0.0002 147 | 5/9
10 h-m-p 0.0084 0.0658 6.6744 -------------.. | 5/9
11 h-m-p 0.0000 0.0001 244.5939 ++ 698.113786 m 0.0001 182 | 6/9
12 h-m-p 0.0039 0.1556 2.9932 ------------.. | 6/9
13 h-m-p 0.0000 0.0001 173.5528 ++ 694.738135 m 0.0001 216 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 ++ 694.738135 m 8.0000 228 | 7/9
15 h-m-p 0.1708 8.0000 0.0000 -N 694.738135 0 0.0053 243 | 7/9
16 h-m-p 0.0160 8.0000 0.0000 -N 694.738135 0 0.0010 258
Out..
lnL = -694.738135
259 lfun, 2849 eigenQcodon, 15540 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.025774 0.029221 0.067375 0.016530 0.037013 0.079138 0.000100 0.900000 0.871132 1.447607 1.300003
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.828783
np = 11
lnL0 = -738.163935
Iterating by ming2
Initial: fx= 738.163935
x= 0.02577 0.02922 0.06737 0.01653 0.03701 0.07914 0.00011 0.90000 0.87113 1.44761 1.30000
1 h-m-p 0.0000 0.0000 406.1526 ++ 737.000386 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0023 90.4671 ++++ 720.627194 m 0.0023 32 | 2/11
3 h-m-p 0.0000 0.0001 440.1412 ++ 712.300044 m 0.0001 46 | 3/11
4 h-m-p 0.0001 0.0006 41.3550 ++ 711.939549 m 0.0006 60 | 4/11
5 h-m-p 0.0000 0.0001 402.0752 ++ 708.919443 m 0.0001 74 | 5/11
6 h-m-p 0.0002 0.0015 364.0434 ++ 703.372231 m 0.0015 88 | 6/11
7 h-m-p 0.0001 0.0007 122.4466 ++ 694.738137 m 0.0007 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0001 ++ 694.738137 m 8.0000 116 | 7/11
9 h-m-p 0.1919 8.0000 0.0059 +++ 694.738137 m 8.0000 135 | 7/11
10 h-m-p 0.0070 0.1411 6.7113 --------Y 694.738137 0 0.0000 161 | 7/11
11 h-m-p 0.0685 8.0000 0.0000 ++++ 694.738137 m 8.0000 177 | 7/11
12 h-m-p 0.1031 8.0000 0.0001 ++++ 694.738137 m 8.0000 197 | 7/11
13 h-m-p 0.0077 3.8594 0.9591 ---------Y 694.738137 0 0.0000 224 | 7/11
14 h-m-p 0.0160 8.0000 0.0001 +++++ 694.738137 m 8.0000 245 | 7/11
15 h-m-p 0.0034 1.6829 0.4531 +++++ 694.738136 m 1.6829 266 | 8/11
16 h-m-p 0.2809 1.5024 1.2050 ---------------.. | 8/11
17 h-m-p 0.0160 8.0000 0.0000 ------------- | 8/11
18 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -694.738136
351 lfun, 4212 eigenQcodon, 23166 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -694.751206 S = -694.736371 -0.006515
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:12
did 20 / 51 patterns 0:13
did 30 / 51 patterns 0:13
did 40 / 51 patterns 0:13
did 50 / 51 patterns 0:13
did 51 / 51 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=178
NC_011896_1_WP_010908405_1_1650_MLBR_RS07845 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
NC_002677_1_NP_302084_1_956_ML1560 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
NZ_LVXE01000006_1_WP_010908405_1_2274_A3216_RS03560 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
NZ_LYPH01000002_1_WP_010908405_1_242_A8144_RS01155 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
NZ_CP029543_1_WP_010908405_1_1683_DIJ64_RS08565 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
NZ_AP014567_1_WP_010908405_1_1725_JK2ML_RS08775 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
**************************************************
NC_011896_1_WP_010908405_1_1650_MLBR_RS07845 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
NC_002677_1_NP_302084_1_956_ML1560 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
NZ_LVXE01000006_1_WP_010908405_1_2274_A3216_RS03560 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
NZ_LYPH01000002_1_WP_010908405_1_242_A8144_RS01155 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
NZ_CP029543_1_WP_010908405_1_1683_DIJ64_RS08565 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
NZ_AP014567_1_WP_010908405_1_1725_JK2ML_RS08775 DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
**************************************************
NC_011896_1_WP_010908405_1_1650_MLBR_RS07845 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
NC_002677_1_NP_302084_1_956_ML1560 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
NZ_LVXE01000006_1_WP_010908405_1_2274_A3216_RS03560 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
NZ_LYPH01000002_1_WP_010908405_1_242_A8144_RS01155 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
NZ_CP029543_1_WP_010908405_1_1683_DIJ64_RS08565 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
NZ_AP014567_1_WP_010908405_1_1725_JK2ML_RS08775 KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
**************************************************
NC_011896_1_WP_010908405_1_1650_MLBR_RS07845 YRAGLLASIAASCTASYTVALVSGGPSI
NC_002677_1_NP_302084_1_956_ML1560 YRAGLLASIAASCTASYTVALVSGGPSI
NZ_LVXE01000006_1_WP_010908405_1_2274_A3216_RS03560 YRAGLLASIAASCTASYTVALVSGGPSI
NZ_LYPH01000002_1_WP_010908405_1_242_A8144_RS01155 YRAGLLASIAASCTASYTVALVSGGPSI
NZ_CP029543_1_WP_010908405_1_1683_DIJ64_RS08565 YRAGLLASIAASCTASYTVALVSGGPSI
NZ_AP014567_1_WP_010908405_1_1725_JK2ML_RS08775 YRAGLLASIAASCTASYTVALVSGGPSI
****************************
>NC_011896_1_WP_010908405_1_1650_MLBR_RS07845 ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA >NC_002677_1_NP_302084_1_956_ML1560 ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA >NZ_LVXE01000006_1_WP_010908405_1_2274_A3216_RS03560 ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA >NZ_LYPH01000002_1_WP_010908405_1_242_A8144_RS01155 ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA >NZ_CP029543_1_WP_010908405_1_1683_DIJ64_RS08565 ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA >NZ_AP014567_1_WP_010908405_1_1725_JK2ML_RS08775 ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
>NC_011896_1_WP_010908405_1_1650_MLBR_RS07845 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG YRAGLLASIAASCTASYTVALVSGGPSI >NC_002677_1_NP_302084_1_956_ML1560 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG YRAGLLASIAASCTASYTVALVSGGPSI >NZ_LVXE01000006_1_WP_010908405_1_2274_A3216_RS03560 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG YRAGLLASIAASCTASYTVALVSGGPSI >NZ_LYPH01000002_1_WP_010908405_1_242_A8144_RS01155 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG YRAGLLASIAASCTASYTVALVSGGPSI >NZ_CP029543_1_WP_010908405_1_1683_DIJ64_RS08565 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG YRAGLLASIAASCTASYTVALVSGGPSI >NZ_AP014567_1_WP_010908405_1_1725_JK2ML_RS08775 MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG YRAGLLASIAASCTASYTVALVSGGPSI
#NEXUS
[ID: 5671526488]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908405_1_1650_MLBR_RS07845
NC_002677_1_NP_302084_1_956_ML1560
NZ_LVXE01000006_1_WP_010908405_1_2274_A3216_RS03560
NZ_LYPH01000002_1_WP_010908405_1_242_A8144_RS01155
NZ_CP029543_1_WP_010908405_1_1683_DIJ64_RS08565
NZ_AP014567_1_WP_010908405_1_1725_JK2ML_RS08775
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908405_1_1650_MLBR_RS07845,
2 NC_002677_1_NP_302084_1_956_ML1560,
3 NZ_LVXE01000006_1_WP_010908405_1_2274_A3216_RS03560,
4 NZ_LYPH01000002_1_WP_010908405_1_242_A8144_RS01155,
5 NZ_CP029543_1_WP_010908405_1_1683_DIJ64_RS08565,
6 NZ_AP014567_1_WP_010908405_1_1725_JK2ML_RS08775
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07124538,2:0.06594649,3:0.0667307,4:0.06779804,5:0.06962249,6:0.06614367);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07124538,2:0.06594649,3:0.0667307,4:0.06779804,5:0.06962249,6:0.06614367);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -715.84 -719.30
2 -715.83 -720.03
--------------------------------------
TOTAL -715.84 -719.73
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893394 0.088449 0.386569 1.516179 0.862644 1501.00 1501.00 1.000
r(A<->C){all} 0.181146 0.022411 0.000041 0.483854 0.146560 138.78 144.54 1.002
r(A<->G){all} 0.161511 0.019370 0.000034 0.436455 0.124223 105.96 164.74 1.007
r(A<->T){all} 0.179589 0.021844 0.000004 0.482007 0.144309 223.10 253.98 1.002
r(C<->G){all} 0.158166 0.019112 0.000008 0.431719 0.119965 109.79 157.31 1.003
r(C<->T){all} 0.155464 0.019186 0.000041 0.441523 0.116433 304.99 321.97 1.004
r(G<->T){all} 0.164125 0.020480 0.000082 0.451791 0.124246 240.22 243.81 1.004
pi(A){all} 0.171203 0.000256 0.140950 0.203207 0.171003 1215.48 1272.38 1.000
pi(C){all} 0.364912 0.000427 0.323798 0.405559 0.364785 1250.05 1307.88 1.000
pi(G){all} 0.280372 0.000370 0.243153 0.318737 0.280288 851.45 982.57 1.000
pi(T){all} 0.183513 0.000281 0.151863 0.218042 0.183092 1228.78 1234.07 1.000
alpha{1,2} 0.418172 0.220739 0.000130 1.350798 0.258519 1171.83 1207.76 1.001
alpha{3} 0.453314 0.232650 0.000342 1.378326 0.288352 1424.16 1430.06 1.000
pinvar{all} 0.997063 0.000012 0.990334 0.999999 0.998182 1159.69 1237.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1560/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 178
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 1 1 1 1 1 1
TTC 1 1 1 1 1 1 | TCC 10 10 10 10 10 10 | TAC 2 2 2 2 2 2 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 6 6 6 6 6 6 | CCC 3 3 3 3 3 3 | CAC 1 1 1 1 1 1 | CGC 4 4 4 4 4 4
CTA 3 3 3 3 3 3 | CCA 6 6 6 6 6 6 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 7 7 7 7 7 7 | CCG 6 6 6 6 6 6 | CAG 1 1 1 1 1 1 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 4 4 4 4 4 4
ATC 6 6 6 6 6 6 | ACC 7 7 7 7 7 7 | AAC 2 2 2 2 2 2 | AGC 3 3 3 3 3 3
ATA 2 2 2 2 2 2 | ACA 3 3 3 3 3 3 | Lys AAA 0 0 0 0 0 0 | Arg AGA 1 1 1 1 1 1
Met ATG 1 1 1 1 1 1 | ACG 1 1 1 1 1 1 | AAG 4 4 4 4 4 4 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 7 7 7 7 7 7 | Asp GAT 2 2 2 2 2 2 | Gly GGT 7 7 7 7 7 7
GTC 4 4 4 4 4 4 | GCC 14 14 14 14 14 14 | GAC 3 3 3 3 3 3 | GGC 4 4 4 4 4 4
GTA 2 2 2 2 2 2 | GCA 5 5 5 5 5 5 | Glu GAA 1 1 1 1 1 1 | GGA 3 3 3 3 3 3
GTG 7 7 7 7 7 7 | GCG 7 7 7 7 7 7 | GAG 4 4 4 4 4 4 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908405_1_1650_MLBR_RS07845
position 1: T:0.14607 C:0.24719 A:0.20787 G:0.39888
position 2: T:0.24157 C:0.44382 A:0.12921 G:0.18539
position 3: T:0.16292 C:0.40449 A:0.17416 G:0.25843
Average T:0.18352 C:0.36517 A:0.17041 G:0.28090
#2: NC_002677_1_NP_302084_1_956_ML1560
position 1: T:0.14607 C:0.24719 A:0.20787 G:0.39888
position 2: T:0.24157 C:0.44382 A:0.12921 G:0.18539
position 3: T:0.16292 C:0.40449 A:0.17416 G:0.25843
Average T:0.18352 C:0.36517 A:0.17041 G:0.28090
#3: NZ_LVXE01000006_1_WP_010908405_1_2274_A3216_RS03560
position 1: T:0.14607 C:0.24719 A:0.20787 G:0.39888
position 2: T:0.24157 C:0.44382 A:0.12921 G:0.18539
position 3: T:0.16292 C:0.40449 A:0.17416 G:0.25843
Average T:0.18352 C:0.36517 A:0.17041 G:0.28090
#4: NZ_LYPH01000002_1_WP_010908405_1_242_A8144_RS01155
position 1: T:0.14607 C:0.24719 A:0.20787 G:0.39888
position 2: T:0.24157 C:0.44382 A:0.12921 G:0.18539
position 3: T:0.16292 C:0.40449 A:0.17416 G:0.25843
Average T:0.18352 C:0.36517 A:0.17041 G:0.28090
#5: NZ_CP029543_1_WP_010908405_1_1683_DIJ64_RS08565
position 1: T:0.14607 C:0.24719 A:0.20787 G:0.39888
position 2: T:0.24157 C:0.44382 A:0.12921 G:0.18539
position 3: T:0.16292 C:0.40449 A:0.17416 G:0.25843
Average T:0.18352 C:0.36517 A:0.17041 G:0.28090
#6: NZ_AP014567_1_WP_010908405_1_1725_JK2ML_RS08775
position 1: T:0.14607 C:0.24719 A:0.20787 G:0.39888
position 2: T:0.24157 C:0.44382 A:0.12921 G:0.18539
position 3: T:0.16292 C:0.40449 A:0.17416 G:0.25843
Average T:0.18352 C:0.36517 A:0.17041 G:0.28090
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 18 | Tyr Y TAT 0 | Cys C TGT 6
TTC 6 | TCC 60 | TAC 12 | TGC 12
Leu L TTA 0 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 18 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 0
CTC 36 | CCC 18 | CAC 6 | CGC 24
CTA 18 | CCA 36 | Gln Q CAA 12 | CGA 6
CTG 42 | CCG 36 | CAG 6 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 24
ATC 36 | ACC 42 | AAC 12 | AGC 18
ATA 12 | ACA 18 | Lys K AAA 0 | Arg R AGA 6
Met M ATG 6 | ACG 6 | AAG 24 | AGG 6
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 42 | Asp D GAT 12 | Gly G GGT 42
GTC 24 | GCC 84 | GAC 18 | GGC 24
GTA 12 | GCA 30 | Glu E GAA 6 | GGA 18
GTG 42 | GCG 42 | GAG 24 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14607 C:0.24719 A:0.20787 G:0.39888
position 2: T:0.24157 C:0.44382 A:0.12921 G:0.18539
position 3: T:0.16292 C:0.40449 A:0.17416 G:0.25843
Average T:0.18352 C:0.36517 A:0.17041 G:0.28090
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -694.738141 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299962 1.300003
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908405_1_1650_MLBR_RS07845: 0.000004, NC_002677_1_NP_302084_1_956_ML1560: 0.000004, NZ_LVXE01000006_1_WP_010908405_1_2274_A3216_RS03560: 0.000004, NZ_LYPH01000002_1_WP_010908405_1_242_A8144_RS01155: 0.000004, NZ_CP029543_1_WP_010908405_1_1683_DIJ64_RS08565: 0.000004, NZ_AP014567_1_WP_010908405_1_1725_JK2ML_RS08775: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29996
omega (dN/dS) = 1.30000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 361.8 172.2 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 361.8 172.2 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 361.8 172.2 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 361.8 172.2 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 361.8 172.2 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 361.8 172.2 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -694.738133 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908405_1_1650_MLBR_RS07845: 0.000004, NC_002677_1_NP_302084_1_956_ML1560: 0.000004, NZ_LVXE01000006_1_WP_010908405_1_2274_A3216_RS03560: 0.000004, NZ_LYPH01000002_1_WP_010908405_1_242_A8144_RS01155: 0.000004, NZ_CP029543_1_WP_010908405_1_1683_DIJ64_RS08565: 0.000004, NZ_AP014567_1_WP_010908405_1_1725_JK2ML_RS08775: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 361.4 172.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 361.4 172.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 361.4 172.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 361.4 172.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 361.4 172.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 361.4 172.6 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -694.738136 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.707972 0.156677 0.000001 1.619221
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908405_1_1650_MLBR_RS07845: 0.000004, NC_002677_1_NP_302084_1_956_ML1560: 0.000004, NZ_LVXE01000006_1_WP_010908405_1_2274_A3216_RS03560: 0.000004, NZ_LYPH01000002_1_WP_010908405_1_242_A8144_RS01155: 0.000004, NZ_CP029543_1_WP_010908405_1_1683_DIJ64_RS08565: 0.000004, NZ_AP014567_1_WP_010908405_1_1725_JK2ML_RS08775: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.70797 0.15668 0.13535
w: 0.00000 1.00000 1.61922
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 361.4 172.6 0.3758 0.0000 0.0000 0.0 0.0
7..2 0.000 361.4 172.6 0.3758 0.0000 0.0000 0.0 0.0
7..3 0.000 361.4 172.6 0.3758 0.0000 0.0000 0.0 0.0
7..4 0.000 361.4 172.6 0.3758 0.0000 0.0000 0.0 0.0
7..5 0.000 361.4 172.6 0.3758 0.0000 0.0000 0.0 0.0
7..6 0.000 361.4 172.6 0.3758 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908405_1_1650_MLBR_RS07845)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908405_1_1650_MLBR_RS07845)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -694.738135 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.422342 1.940674
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908405_1_1650_MLBR_RS07845: 0.000004, NC_002677_1_NP_302084_1_956_ML1560: 0.000004, NZ_LVXE01000006_1_WP_010908405_1_2274_A3216_RS03560: 0.000004, NZ_LYPH01000002_1_WP_010908405_1_242_A8144_RS01155: 0.000004, NZ_CP029543_1_WP_010908405_1_1683_DIJ64_RS08565: 0.000004, NZ_AP014567_1_WP_010908405_1_1725_JK2ML_RS08775: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.42234 q = 1.94067
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00037 0.00505 0.01706 0.03840 0.07117 0.11818 0.18369 0.27514 0.40856 0.63798
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 361.4 172.6 0.1756 0.0000 0.0000 0.0 0.0
7..2 0.000 361.4 172.6 0.1756 0.0000 0.0000 0.0 0.0
7..3 0.000 361.4 172.6 0.1756 0.0000 0.0000 0.0 0.0
7..4 0.000 361.4 172.6 0.1756 0.0000 0.0000 0.0 0.0
7..5 0.000 361.4 172.6 0.1756 0.0000 0.0000 0.0 0.0
7..6 0.000 361.4 172.6 0.1756 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
check convergence..
lnL(ntime: 6 np: 11): -694.738136 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.722226 0.354201 1.316855 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908405_1_1650_MLBR_RS07845: 0.000004, NC_002677_1_NP_302084_1_956_ML1560: 0.000004, NZ_LVXE01000006_1_WP_010908405_1_2274_A3216_RS03560: 0.000004, NZ_LYPH01000002_1_WP_010908405_1_242_A8144_RS01155: 0.000004, NZ_CP029543_1_WP_010908405_1_1683_DIJ64_RS08565: 0.000004, NZ_AP014567_1_WP_010908405_1_1725_JK2ML_RS08775: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.72223 p = 0.35420 q = 1.31685
(p1 = 0.27777) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.07222 0.07222 0.07222 0.07222 0.07222 0.07222 0.07222 0.07222 0.07222 0.07222 0.27777
w: 0.00015 0.00332 0.01407 0.03658 0.07505 0.13419 0.21983 0.34022 0.50960 0.76435 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 361.4 172.6 0.4293 0.0000 0.0000 0.0 0.0
7..2 0.000 361.4 172.6 0.4293 0.0000 0.0000 0.0 0.0
7..3 0.000 361.4 172.6 0.4293 0.0000 0.0000 0.0 0.0
7..4 0.000 361.4 172.6 0.4293 0.0000 0.0000 0.0 0.0
7..5 0.000 361.4 172.6 0.4293 0.0000 0.0000 0.0 0.0
7..6 0.000 361.4 172.6 0.4293 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908405_1_1650_MLBR_RS07845)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:13
Model 1: NearlyNeutral -694.738133 Model 2: PositiveSelection -694.738136 Model 0: one-ratio -694.738141 Model 7: beta -694.738135 Model 8: beta&w>1 -694.738136 Model 0 vs 1 1.600000018697756E-5 Model 2 vs 1 6.000000212225132E-6 Model 8 vs 7 1.9999999949504854E-6
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
