--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 08:54:04 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1560/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -715.84          -719.30
2       -715.83          -720.03
--------------------------------------
TOTAL     -715.84          -719.73
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.893394    0.088449    0.386569    1.516179    0.862644   1501.00   1501.00    1.000
r(A<->C){all}   0.181146    0.022411    0.000041    0.483854    0.146560    138.78    144.54    1.002
r(A<->G){all}   0.161511    0.019370    0.000034    0.436455    0.124223    105.96    164.74    1.007
r(A<->T){all}   0.179589    0.021844    0.000004    0.482007    0.144309    223.10    253.98    1.002
r(C<->G){all}   0.158166    0.019112    0.000008    0.431719    0.119965    109.79    157.31    1.003
r(C<->T){all}   0.155464    0.019186    0.000041    0.441523    0.116433    304.99    321.97    1.004
r(G<->T){all}   0.164125    0.020480    0.000082    0.451791    0.124246    240.22    243.81    1.004
pi(A){all}      0.171203    0.000256    0.140950    0.203207    0.171003   1215.48   1272.38    1.000
pi(C){all}      0.364912    0.000427    0.323798    0.405559    0.364785   1250.05   1307.88    1.000
pi(G){all}      0.280372    0.000370    0.243153    0.318737    0.280288    851.45    982.57    1.000
pi(T){all}      0.183513    0.000281    0.151863    0.218042    0.183092   1228.78   1234.07    1.000
alpha{1,2}      0.418172    0.220739    0.000130    1.350798    0.258519   1171.83   1207.76    1.001
alpha{3}        0.453314    0.232650    0.000342    1.378326    0.288352   1424.16   1430.06    1.000
pinvar{all}     0.997063    0.000012    0.990334    0.999999    0.998182   1159.69   1237.30    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-694.738133
Model 2: PositiveSelection	-694.738136
Model 0: one-ratio	-694.738141
Model 7: beta	-694.738135
Model 8: beta&w>1	-694.738136


Model 0 vs 1	1.600000018697756E-5

Model 2 vs 1	6.000000212225132E-6

Model 8 vs 7	1.9999999949504854E-6
>C1
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C2
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C3
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C4
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C5
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C6
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=178 

C1              MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C2              MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C3              MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C4              MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C5              MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C6              MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
                **************************************************

C1              DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C2              DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C3              DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C4              DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C5              DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C6              DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
                **************************************************

C1              KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C2              KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C3              KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C4              KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C5              KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C6              KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
                **************************************************

C1              YRAGLLASIAASCTASYTVALVSGGPSI
C2              YRAGLLASIAASCTASYTVALVSGGPSI
C3              YRAGLLASIAASCTASYTVALVSGGPSI
C4              YRAGLLASIAASCTASYTVALVSGGPSI
C5              YRAGLLASIAASCTASYTVALVSGGPSI
C6              YRAGLLASIAASCTASYTVALVSGGPSI
                ****************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  178 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  178 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5340]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5340]--->[5340]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.474 Mb, Max= 30.717 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C2              MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C3              MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C4              MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C5              MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
C6              MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
                **************************************************

C1              DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C2              DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C3              DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C4              DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C5              DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
C6              DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
                **************************************************

C1              KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C2              KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C3              KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C4              KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C5              KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
C6              KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
                **************************************************

C1              YRAGLLASIAASCTASYTVALVSGGPSI
C2              YRAGLLASIAASCTASYTVALVSGGPSI
C3              YRAGLLASIAASCTASYTVALVSGGPSI
C4              YRAGLLASIAASCTASYTVALVSGGPSI
C5              YRAGLLASIAASCTASYTVALVSGGPSI
C6              YRAGLLASIAASCTASYTVALVSGGPSI
                ****************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
C2              ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
C3              ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
C4              ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
C5              ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
C6              ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
                **************************************************

C1              CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
C2              CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
C3              CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
C4              CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
C5              CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
C6              CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
                **************************************************

C1              GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
C2              GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
C3              GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
C4              GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
C5              GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
C6              GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
                **************************************************

C1              GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
C2              GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
C3              GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
C4              GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
C5              GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
C6              GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
                **************************************************

C1              CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
C2              CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
C3              CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
C4              CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
C5              CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
C6              CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
                **************************************************

C1              GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
C2              GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
C3              GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
C4              GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
C5              GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
C6              GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
                **************************************************

C1              AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
C2              AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
C3              AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
C4              AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
C5              AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
C6              AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
                **************************************************

C1              TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
C2              TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
C3              TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
C4              TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
C5              TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
C6              TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
                **************************************************

C1              TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
C2              TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
C3              TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
C4              TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
C5              TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
C6              TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
                **************************************************

C1              TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
C2              TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
C3              TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
C4              TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
C5              TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
C6              TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
                **************************************************

C1              CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
C2              CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
C3              CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
C4              CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
C5              CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
C6              CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
                **********************************



>C1
ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
>C2
ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
>C3
ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
>C4
ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
>C5
ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
>C6
ATGTTGCTTGTGCCCAGTGCAGTACCCGTCATCAACAGGCGCGGTGTGCT
CGCCGGTGGTGCTACCCTGACTGTGCTCGGAGTGTGTTTCTCCGCCTGCA
GTAAGTCCCCGTCCAAGACCCCAGAGATCGAAGAGCTACTAGGTCCATTG
GACCAGGCCAGACACGATAGTGCGCTGGCTTCCGCCGCCGCGGCTGCCAT
CGGCAACCTGCCGCAAATCACTGCAGCGCTGGCTGTGGTCGCCACCCAAC
GCGCCGCGCATGCCCGAGCACTGGTCACCGAGATCTCTCGGGCCACCGGC
AAGCTCGCCTCCTCCTCAAGCGACACAACCAGCCCCGGCCTCAGCCCAGC
TAGTCCGCCGTCGAAGCCACCGCCACCGGTATCCGACGTGATCGATGCAC
TGCGCACATCAGCGGAGGGTGCTGGTCGCCTAGTCTCCACCGCATCGGGA
TACCGGGCCGGCCTGCTCGCCTCTATAGCCGCTTCCTGCACAGCGTCCTA
CACGGTTGCGCTCGTGTCTGGAGGTCCATCGATA
>C1
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C2
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C3
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C4
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C5
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI
>C6
MLLVPSAVPVINRRGVLAGGATLTVLGVCFSACSKSPSKTPEIEELLGPL
DQARHDSALASAAAAAIGNLPQITAALAVVATQRAAHARALVTEISRATG
KLASSSSDTTSPGLSPASPPSKPPPPVSDVIDALRTSAEGAGRLVSTASG
YRAGLLASIAASCTASYTVALVSGGPSI


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 534 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579855968
      Setting output file names to "/data/7res/ML1560/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 87511073
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5671526488
      Seed = 1198084536
      Swapseed = 1579855968
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1195.117604 -- -24.965149
         Chain 2 -- -1195.117421 -- -24.965149
         Chain 3 -- -1195.117604 -- -24.965149
         Chain 4 -- -1195.117535 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1195.117604 -- -24.965149
         Chain 2 -- -1195.117604 -- -24.965149
         Chain 3 -- -1195.117421 -- -24.965149
         Chain 4 -- -1195.117604 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1195.118] (-1195.117) (-1195.118) (-1195.118) * [-1195.118] (-1195.118) (-1195.117) (-1195.118) 
        500 -- [-726.682] (-731.064) (-735.275) (-724.999) * [-719.405] (-739.856) (-726.592) (-739.584) -- 0:00:00
       1000 -- [-725.391] (-724.000) (-738.277) (-725.578) * (-727.591) (-723.561) (-725.595) [-721.978] -- 0:00:00
       1500 -- (-720.932) (-722.781) [-724.896] (-724.999) * (-720.707) (-725.652) (-727.467) [-728.757] -- 0:00:00
       2000 -- (-723.598) [-727.161] (-720.572) (-723.151) * (-726.464) [-730.690] (-732.839) (-722.856) -- 0:00:00
       2500 -- (-721.877) (-729.948) (-721.760) [-726.917] * (-719.984) (-728.561) (-729.550) [-727.208] -- 0:00:00
       3000 -- (-727.218) (-731.171) [-724.879] (-726.077) * (-727.155) [-722.132] (-723.337) (-722.804) -- 0:05:32
       3500 -- (-730.650) [-725.426] (-730.213) (-728.406) * (-729.902) (-718.826) [-723.192] (-722.802) -- 0:04:44
       4000 -- (-728.969) (-727.037) [-724.281] (-728.158) * (-725.556) (-725.838) (-725.479) [-723.332] -- 0:04:09
       4500 -- (-727.303) (-723.455) (-729.375) [-723.621] * (-730.510) [-725.880] (-734.272) (-724.806) -- 0:03:41
       5000 -- (-731.783) (-724.844) (-735.891) [-720.396] * (-733.743) [-723.616] (-726.951) (-729.804) -- 0:03:19

      Average standard deviation of split frequencies: 0.102479

       5500 -- (-720.356) (-723.616) (-718.167) [-725.978] * (-733.428) (-723.563) [-727.891] (-731.647) -- 0:03:00
       6000 -- (-726.334) (-733.203) (-716.059) [-719.470] * (-724.382) (-734.081) (-726.795) [-724.184] -- 0:02:45
       6500 -- (-727.614) (-733.508) [-714.622] (-729.342) * (-720.986) [-724.840] (-730.753) (-723.730) -- 0:02:32
       7000 -- (-726.128) [-725.161] (-716.534) (-724.161) * (-725.101) (-726.088) (-727.051) [-726.024] -- 0:02:21
       7500 -- (-722.647) (-727.170) [-717.826] (-725.362) * (-723.303) [-726.671] (-727.356) (-728.922) -- 0:02:12
       8000 -- [-725.866] (-729.989) (-718.608) (-723.724) * (-727.748) (-742.818) (-726.075) [-720.424] -- 0:02:04
       8500 -- (-728.647) [-723.241] (-716.287) (-725.997) * (-725.468) (-737.395) (-721.825) [-726.414] -- 0:01:56
       9000 -- [-729.638] (-731.148) (-718.256) (-723.065) * (-722.591) [-727.170] (-726.525) (-722.720) -- 0:01:50
       9500 -- [-722.021] (-729.922) (-719.240) (-731.588) * [-724.239] (-738.415) (-721.853) (-733.264) -- 0:01:44
      10000 -- (-727.787) (-728.712) (-723.415) [-728.857] * [-721.766] (-725.815) (-727.586) (-728.942) -- 0:01:39

      Average standard deviation of split frequencies: 0.081023

      10500 -- (-727.490) [-723.193] (-723.177) (-728.204) * [-722.114] (-726.139) (-728.742) (-721.492) -- 0:01:34
      11000 -- (-727.650) [-719.824] (-717.174) (-724.272) * (-726.592) (-721.312) (-732.142) [-724.764] -- 0:01:29
      11500 -- [-722.463] (-721.159) (-716.276) (-724.125) * [-722.550] (-721.626) (-725.045) (-727.144) -- 0:01:25
      12000 -- (-723.646) [-725.803] (-716.920) (-726.167) * (-729.101) (-728.333) [-721.491] (-719.894) -- 0:01:22
      12500 -- (-732.885) (-727.001) [-716.337] (-722.028) * (-726.919) (-726.485) [-721.763] (-726.902) -- 0:01:19
      13000 -- (-722.361) [-734.211] (-717.056) (-729.720) * (-720.441) (-723.237) (-732.627) [-730.583] -- 0:01:15
      13500 -- (-727.039) (-724.612) (-714.949) [-723.867] * (-724.658) (-725.643) [-719.701] (-723.217) -- 0:01:13
      14000 -- (-729.922) [-727.667] (-716.384) (-724.530) * (-723.300) (-730.286) (-727.809) [-727.585] -- 0:01:10
      14500 -- [-727.116] (-722.765) (-715.443) (-726.169) * (-726.888) [-725.704] (-723.351) (-728.900) -- 0:01:07
      15000 -- (-720.099) [-724.929] (-715.254) (-724.248) * [-720.072] (-724.383) (-729.905) (-721.594) -- 0:01:05

      Average standard deviation of split frequencies: 0.090025

      15500 -- (-720.536) (-721.379) [-714.954] (-723.644) * (-723.281) (-725.659) [-726.069] (-729.324) -- 0:01:03
      16000 -- [-720.922] (-722.370) (-716.415) (-722.215) * [-720.481] (-720.719) (-731.464) (-719.816) -- 0:01:01
      16500 -- [-719.240] (-727.848) (-715.175) (-724.940) * [-725.862] (-720.860) (-722.044) (-727.012) -- 0:00:59
      17000 -- (-716.341) [-732.479] (-715.189) (-732.748) * [-721.220] (-725.867) (-726.793) (-731.926) -- 0:00:57
      17500 -- (-720.261) (-719.658) (-720.055) [-720.544] * [-725.695] (-723.761) (-735.167) (-726.050) -- 0:00:56
      18000 -- (-716.042) (-722.915) [-717.171] (-730.463) * [-720.192] (-722.963) (-724.230) (-718.464) -- 0:00:54
      18500 -- (-716.166) (-725.512) [-715.681] (-735.266) * (-728.155) (-725.560) (-735.162) [-724.597] -- 0:00:53
      19000 -- (-714.461) [-723.898] (-716.285) (-727.387) * [-725.565] (-733.637) (-731.943) (-725.865) -- 0:00:51
      19500 -- (-715.334) (-721.162) [-717.266] (-723.943) * (-727.095) (-729.184) [-724.747] (-726.608) -- 0:01:40
      20000 -- (-718.192) [-728.058] (-715.564) (-721.204) * [-734.864] (-727.678) (-728.880) (-736.128) -- 0:01:38

      Average standard deviation of split frequencies: 0.072992

      20500 -- (-714.539) (-736.805) [-715.869] (-723.871) * (-730.204) (-739.452) [-723.916] (-722.815) -- 0:01:35
      21000 -- (-714.596) (-722.433) [-716.757] (-729.595) * (-727.153) (-719.620) [-722.860] (-737.659) -- 0:01:33
      21500 -- [-717.741] (-723.480) (-718.918) (-722.523) * (-730.841) (-715.776) (-720.914) [-719.598] -- 0:01:31
      22000 -- (-717.942) [-721.658] (-720.101) (-723.464) * [-728.354] (-718.182) (-722.123) (-720.852) -- 0:01:28
      22500 -- (-717.740) (-722.359) (-721.442) [-725.411] * [-722.628] (-717.100) (-728.105) (-718.077) -- 0:01:26
      23000 -- (-719.784) (-725.274) [-719.778] (-722.270) * [-721.257] (-716.119) (-723.613) (-719.006) -- 0:01:24
      23500 -- (-716.912) (-729.996) [-714.579] (-729.464) * [-722.968] (-717.023) (-726.450) (-717.351) -- 0:01:23
      24000 -- [-717.472] (-721.217) (-718.040) (-732.297) * (-727.910) (-718.851) (-726.521) [-718.009] -- 0:01:21
      24500 -- (-718.258) (-722.357) (-717.365) [-725.508] * (-724.346) (-719.210) [-720.074] (-715.674) -- 0:01:19
      25000 -- (-716.613) (-727.971) (-716.785) [-727.905] * (-726.263) (-717.603) [-721.117] (-718.417) -- 0:01:18

      Average standard deviation of split frequencies: 0.062552

      25500 -- (-717.015) (-725.826) (-715.094) [-722.243] * [-722.323] (-716.490) (-723.393) (-714.981) -- 0:01:16
      26000 -- [-718.157] (-732.366) (-715.187) (-726.317) * [-726.943] (-716.707) (-722.499) (-717.729) -- 0:01:14
      26500 -- (-716.848) (-725.996) [-716.848] (-718.494) * (-728.312) [-716.149] (-732.735) (-720.775) -- 0:01:13
      27000 -- (-719.146) [-723.234] (-717.774) (-725.293) * [-725.429] (-715.807) (-731.803) (-715.633) -- 0:01:12
      27500 -- (-716.187) (-724.814) (-715.383) [-723.083] * (-727.647) [-717.279] (-724.485) (-716.655) -- 0:01:10
      28000 -- (-718.918) (-730.210) [-715.839] (-728.973) * (-724.884) [-714.337] (-728.303) (-715.743) -- 0:01:09
      28500 -- (-717.509) (-730.860) (-715.403) [-721.889] * (-730.225) (-716.928) [-726.316] (-715.320) -- 0:01:08
      29000 -- (-717.923) (-727.560) (-714.513) [-723.530] * (-724.321) (-717.305) [-725.936] (-715.311) -- 0:01:06
      29500 -- (-716.422) (-723.457) [-716.511] (-720.345) * (-744.379) (-717.090) (-723.393) [-715.302] -- 0:01:05
      30000 -- [-716.766] (-718.717) (-714.417) (-724.839) * (-717.625) [-718.948] (-715.720) (-715.345) -- 0:01:04

      Average standard deviation of split frequencies: 0.047653

      30500 -- [-716.351] (-716.066) (-717.343) (-731.782) * (-719.996) (-718.343) [-716.562] (-717.656) -- 0:01:03
      31000 -- (-718.436) (-716.431) (-715.605) [-724.063] * (-721.753) (-719.094) (-715.787) [-715.619] -- 0:01:02
      31500 -- (-716.926) (-717.783) [-717.604] (-725.789) * [-715.644] (-718.807) (-720.278) (-716.774) -- 0:01:01
      32000 -- [-716.061] (-715.037) (-719.481) (-725.684) * (-719.914) [-721.664] (-718.039) (-716.877) -- 0:01:00
      32500 -- [-716.320] (-717.448) (-715.775) (-721.498) * [-717.823] (-718.522) (-717.422) (-715.555) -- 0:00:59
      33000 -- [-717.642] (-716.979) (-715.943) (-728.697) * [-716.198] (-716.581) (-716.789) (-715.102) -- 0:00:58
      33500 -- (-722.315) [-716.968] (-716.674) (-731.270) * (-724.902) [-716.145] (-719.011) (-717.900) -- 0:00:57
      34000 -- [-715.272] (-717.829) (-718.442) (-728.158) * [-718.977] (-715.456) (-716.461) (-715.083) -- 0:00:56
      34500 -- (-715.574) (-716.002) [-716.555] (-721.671) * [-716.419] (-717.250) (-716.393) (-719.913) -- 0:00:55
      35000 -- (-715.655) (-716.045) (-718.469) [-725.429] * (-716.923) (-716.731) (-715.481) [-715.579] -- 0:00:55

      Average standard deviation of split frequencies: 0.026878

      35500 -- (-715.252) [-716.575] (-716.490) (-721.446) * (-719.997) (-717.321) [-715.878] (-714.963) -- 0:00:54
      36000 -- (-714.562) (-715.878) [-716.608] (-721.413) * (-721.128) (-717.520) (-716.237) [-715.111] -- 0:01:20
      36500 -- [-716.027] (-714.680) (-714.741) (-721.169) * [-715.863] (-716.390) (-715.271) (-714.436) -- 0:01:19
      37000 -- (-716.573) (-714.640) [-718.620] (-729.252) * (-722.426) (-721.646) [-718.406] (-716.706) -- 0:01:18
      37500 -- (-717.530) (-714.954) (-717.907) [-720.378] * [-715.567] (-720.844) (-717.854) (-718.682) -- 0:01:17
      38000 -- (-719.833) (-717.196) [-717.078] (-727.443) * (-715.964) (-714.924) (-717.856) [-717.697] -- 0:01:15
      38500 -- (-720.873) (-718.563) (-717.365) [-720.970] * (-718.608) [-715.845] (-716.425) (-715.964) -- 0:01:14
      39000 -- (-715.726) [-716.099] (-721.441) (-730.464) * (-716.833) (-717.376) (-719.494) [-715.798] -- 0:01:13
      39500 -- [-717.722] (-714.644) (-717.962) (-723.763) * (-715.446) (-716.896) (-715.822) [-715.141] -- 0:01:12
      40000 -- [-714.891] (-714.874) (-716.129) (-724.223) * (-716.170) (-720.487) [-714.671] (-715.385) -- 0:01:12

      Average standard deviation of split frequencies: 0.029895

      40500 -- [-715.682] (-715.841) (-716.310) (-732.578) * (-716.900) (-717.918) (-714.843) [-715.777] -- 0:01:11
      41000 -- [-715.016] (-716.446) (-716.064) (-723.199) * (-717.454) (-723.717) [-715.983] (-714.527) -- 0:01:10
      41500 -- (-715.737) [-716.612] (-717.791) (-731.319) * (-715.011) (-716.980) [-716.225] (-715.184) -- 0:01:09
      42000 -- (-716.766) (-719.059) [-716.609] (-733.132) * (-717.641) (-716.960) (-716.749) [-714.760] -- 0:01:08
      42500 -- [-715.832] (-717.640) (-718.468) (-735.240) * [-718.808] (-715.957) (-715.186) (-716.181) -- 0:01:07
      43000 -- (-716.932) (-716.941) [-716.657] (-716.201) * (-718.270) (-717.544) [-716.292] (-715.283) -- 0:01:06
      43500 -- (-716.466) (-715.895) [-723.523] (-717.271) * [-715.823] (-715.820) (-715.684) (-715.661) -- 0:01:05
      44000 -- (-721.444) [-714.869] (-722.234) (-719.911) * (-715.375) (-715.309) (-717.304) [-714.995] -- 0:01:05
      44500 -- (-719.884) (-719.406) [-717.555] (-717.452) * [-716.180] (-715.082) (-722.377) (-715.090) -- 0:01:04
      45000 -- (-715.402) (-714.490) (-717.063) [-717.176] * (-717.229) (-717.808) (-719.602) [-715.425] -- 0:01:03

      Average standard deviation of split frequencies: 0.030256

      45500 -- (-715.777) (-716.145) [-718.594] (-720.371) * (-715.711) [-716.612] (-717.844) (-717.761) -- 0:01:02
      46000 -- (-714.545) [-719.574] (-716.908) (-715.118) * [-717.275] (-718.604) (-714.343) (-718.448) -- 0:01:02
      46500 -- [-715.979] (-718.898) (-715.335) (-715.360) * (-716.873) (-718.384) [-716.302] (-715.962) -- 0:01:01
      47000 -- (-716.022) [-715.859] (-716.590) (-715.705) * (-715.411) (-715.869) (-715.599) [-717.274] -- 0:01:00
      47500 -- (-725.049) (-716.916) [-718.265] (-714.730) * [-716.155] (-714.783) (-719.948) (-718.490) -- 0:01:00
      48000 -- (-722.195) (-716.497) [-717.136] (-715.646) * (-717.283) [-716.208] (-719.506) (-717.098) -- 0:00:59
      48500 -- (-718.624) (-720.568) [-716.785] (-716.112) * (-717.271) (-716.550) (-715.150) [-715.602] -- 0:00:58
      49000 -- (-715.831) (-721.099) [-718.498] (-720.923) * (-717.425) [-716.548] (-718.019) (-715.864) -- 0:00:58
      49500 -- (-715.494) (-717.102) [-720.273] (-722.704) * (-716.114) [-717.991] (-721.476) (-718.097) -- 0:00:57
      50000 -- (-715.985) [-720.927] (-716.346) (-720.286) * [-715.291] (-715.540) (-718.700) (-718.246) -- 0:00:57

      Average standard deviation of split frequencies: 0.032809

      50500 -- [-716.520] (-716.051) (-718.105) (-722.327) * (-715.628) [-716.713] (-716.479) (-716.346) -- 0:00:56
      51000 -- (-716.274) (-716.594) [-714.998] (-720.674) * (-716.203) (-715.666) [-715.578] (-716.575) -- 0:00:55
      51500 -- (-717.848) (-722.059) [-716.708] (-717.455) * (-717.272) (-715.668) [-715.606] (-716.860) -- 0:00:55
      52000 -- [-716.917] (-721.494) (-717.226) (-720.701) * (-715.765) (-716.096) (-714.715) [-714.823] -- 0:00:54
      52500 -- (-715.418) (-716.430) (-715.044) [-718.167] * (-718.147) [-716.265] (-714.410) (-715.384) -- 0:00:54
      53000 -- (-721.618) (-716.289) (-721.360) [-714.823] * (-715.966) [-714.697] (-714.930) (-715.892) -- 0:01:11
      53500 -- [-715.304] (-715.921) (-715.422) (-718.901) * [-716.192] (-716.881) (-715.535) (-717.460) -- 0:01:10
      54000 -- [-719.725] (-715.489) (-715.292) (-718.611) * (-718.013) (-717.194) [-715.509] (-716.316) -- 0:01:10
      54500 -- (-717.176) (-714.738) [-714.359] (-714.942) * (-714.805) [-716.912] (-715.296) (-718.213) -- 0:01:09
      55000 -- (-716.335) (-716.587) [-714.777] (-718.674) * (-715.165) [-715.706] (-715.806) (-715.833) -- 0:01:08

      Average standard deviation of split frequencies: 0.027358

      55500 -- (-716.550) [-718.152] (-718.910) (-715.945) * (-720.994) (-715.996) (-715.675) [-715.363] -- 0:01:08
      56000 -- (-714.674) (-715.644) (-715.585) [-715.200] * (-721.088) (-719.978) (-714.804) [-716.867] -- 0:01:07
      56500 -- (-714.841) [-715.396] (-716.499) (-715.830) * (-718.920) (-719.536) (-715.289) [-717.036] -- 0:01:06
      57000 -- (-723.875) [-720.456] (-714.667) (-715.949) * (-716.264) [-715.366] (-715.380) (-717.121) -- 0:01:06
      57500 -- (-718.480) (-716.661) (-715.132) [-716.346] * (-715.803) [-717.723] (-717.222) (-716.973) -- 0:01:05
      58000 -- (-719.565) (-715.578) [-714.358] (-720.344) * [-716.801] (-716.322) (-715.028) (-716.217) -- 0:01:04
      58500 -- (-720.991) (-716.186) [-715.681] (-719.550) * (-714.876) [-717.093] (-715.077) (-717.474) -- 0:01:04
      59000 -- [-717.111] (-717.264) (-715.048) (-718.464) * (-724.422) (-716.110) [-715.438] (-715.892) -- 0:01:03
      59500 -- (-714.984) (-718.963) [-717.755] (-720.214) * (-717.943) [-715.065] (-715.390) (-715.199) -- 0:01:03
      60000 -- [-714.950] (-722.346) (-721.458) (-714.229) * (-717.591) [-715.058] (-716.843) (-716.659) -- 0:01:02

      Average standard deviation of split frequencies: 0.030693

      60500 -- (-716.478) [-717.361] (-716.504) (-714.624) * [-715.362] (-716.421) (-717.091) (-717.483) -- 0:01:02
      61000 -- (-716.157) (-716.898) (-714.552) [-716.001] * (-715.996) (-715.689) [-715.370] (-715.157) -- 0:01:01
      61500 -- [-717.404] (-715.481) (-716.132) (-715.728) * (-715.093) (-715.824) (-718.837) [-715.142] -- 0:01:01
      62000 -- (-714.822) [-716.962] (-715.029) (-717.224) * (-717.146) (-714.718) (-721.935) [-715.764] -- 0:01:00
      62500 -- [-715.952] (-719.628) (-716.552) (-717.197) * [-719.184] (-715.414) (-722.211) (-716.276) -- 0:01:00
      63000 -- (-715.230) (-717.693) (-717.792) [-717.545] * (-716.452) (-717.765) (-721.443) [-717.007] -- 0:00:59
      63500 -- (-716.892) (-716.455) (-717.957) [-717.318] * (-715.552) [-715.781] (-720.216) (-718.115) -- 0:00:58
      64000 -- (-715.541) [-716.050] (-717.362) (-716.858) * (-715.772) (-717.679) [-714.601] (-715.584) -- 0:00:58
      64500 -- (-715.365) (-714.672) [-715.305] (-717.467) * (-717.739) (-717.836) [-716.457] (-715.780) -- 0:00:58
      65000 -- (-716.199) (-714.676) (-717.108) [-716.499] * (-718.337) (-716.369) [-715.959] (-716.303) -- 0:00:57

      Average standard deviation of split frequencies: 0.029698

      65500 -- (-715.677) [-715.750] (-715.927) (-716.819) * (-716.691) [-717.332] (-714.615) (-716.816) -- 0:00:57
      66000 -- (-715.300) (-718.398) [-715.847] (-717.215) * (-714.519) (-715.178) (-716.185) [-714.382] -- 0:00:56
      66500 -- (-715.814) [-715.430] (-716.547) (-715.197) * (-715.740) (-714.748) [-720.566] (-714.658) -- 0:00:56
      67000 -- [-714.753] (-717.968) (-717.951) (-717.367) * (-715.614) (-715.741) (-714.518) [-717.683] -- 0:00:55
      67500 -- (-715.895) (-720.199) (-716.774) [-714.625] * (-715.160) (-714.459) (-716.260) [-718.280] -- 0:00:55
      68000 -- (-717.115) (-718.110) (-715.340) [-716.311] * (-715.665) [-714.259] (-715.649) (-720.798) -- 0:00:54
      68500 -- [-715.174] (-715.190) (-717.208) (-715.750) * (-718.369) [-716.103] (-715.826) (-717.090) -- 0:00:54
      69000 -- (-714.909) (-716.712) (-717.548) [-714.447] * (-715.144) (-715.853) (-714.737) [-715.972] -- 0:00:53
      69500 -- (-715.611) (-716.526) (-715.857) [-715.590] * [-714.739] (-719.668) (-716.319) (-715.555) -- 0:01:06
      70000 -- (-715.150) (-715.598) (-716.383) [-716.725] * (-714.677) [-715.585] (-716.446) (-716.083) -- 0:01:06

      Average standard deviation of split frequencies: 0.028907

      70500 -- (-721.187) [-719.642] (-716.062) (-718.907) * (-714.994) (-718.034) [-714.755] (-717.913) -- 0:01:05
      71000 -- (-715.949) [-715.374] (-718.237) (-714.871) * (-715.342) (-717.942) [-715.364] (-716.611) -- 0:01:05
      71500 -- (-715.565) (-714.998) (-715.696) [-715.051] * (-717.587) (-715.842) [-714.454] (-715.496) -- 0:01:04
      72000 -- (-715.953) (-718.952) [-717.422] (-715.541) * [-717.218] (-715.025) (-715.529) (-717.815) -- 0:01:04
      72500 -- (-717.470) (-716.695) (-714.930) [-715.060] * [-716.910] (-716.079) (-717.253) (-715.926) -- 0:01:03
      73000 -- (-717.800) (-717.291) (-716.440) [-714.564] * [-717.870] (-718.312) (-715.981) (-717.374) -- 0:01:03
      73500 -- (-718.832) (-716.120) (-716.012) [-715.248] * (-717.725) (-717.841) [-717.019] (-724.460) -- 0:01:03
      74000 -- [-717.865] (-716.994) (-716.298) (-715.625) * (-717.582) (-717.055) [-717.967] (-716.364) -- 0:01:02
      74500 -- (-717.891) (-717.814) [-715.934] (-717.994) * (-716.068) [-714.572] (-716.072) (-718.208) -- 0:01:02
      75000 -- (-719.530) [-717.667] (-719.585) (-714.842) * (-724.531) (-714.461) [-715.839] (-714.783) -- 0:01:01

      Average standard deviation of split frequencies: 0.028946

      75500 -- (-716.268) [-716.870] (-716.385) (-715.330) * (-716.585) (-715.260) (-722.146) [-714.989] -- 0:01:01
      76000 -- (-716.218) [-720.060] (-717.424) (-718.352) * (-718.891) (-714.121) (-714.910) [-715.072] -- 0:01:00
      76500 -- (-716.406) (-718.122) (-716.541) [-716.232] * (-718.315) (-714.290) (-715.176) [-715.471] -- 0:01:00
      77000 -- [-717.251] (-716.246) (-717.049) (-717.778) * (-719.536) (-714.822) (-715.430) [-717.798] -- 0:00:59
      77500 -- [-716.016] (-716.922) (-716.586) (-717.193) * (-720.073) (-715.167) [-715.791] (-718.291) -- 0:00:59
      78000 -- (-714.600) [-714.949] (-714.523) (-715.608) * (-718.035) [-714.536] (-715.727) (-716.182) -- 0:00:59
      78500 -- (-715.762) (-716.443) [-715.381] (-715.708) * (-718.215) (-714.332) [-719.149] (-716.694) -- 0:00:58
      79000 -- (-715.903) [-717.384] (-716.925) (-716.755) * (-717.447) (-715.072) (-719.531) [-715.003] -- 0:00:58
      79500 -- (-715.706) (-716.890) [-714.636] (-717.412) * (-716.586) (-719.669) [-717.478] (-715.129) -- 0:00:57
      80000 -- (-715.267) (-715.315) [-718.664] (-719.769) * (-717.438) [-716.141] (-715.240) (-717.056) -- 0:00:57

      Average standard deviation of split frequencies: 0.028927

      80500 -- (-716.940) [-714.980] (-718.792) (-717.697) * (-714.861) (-716.035) [-716.555] (-716.492) -- 0:00:57
      81000 -- (-718.483) (-715.475) (-714.876) [-714.980] * (-715.106) [-716.152] (-718.098) (-727.920) -- 0:00:56
      81500 -- (-715.571) (-726.064) [-717.020] (-715.672) * (-716.426) (-716.310) (-719.279) [-721.789] -- 0:00:56
      82000 -- [-720.444] (-716.818) (-717.286) (-714.726) * (-716.210) (-717.448) [-717.488] (-719.743) -- 0:00:55
      82500 -- (-718.953) (-716.545) (-717.553) [-715.509] * (-714.928) (-718.089) (-720.930) [-716.981] -- 0:00:55
      83000 -- [-718.062] (-716.675) (-716.260) (-716.426) * (-715.560) (-715.087) (-716.317) [-715.088] -- 0:00:55
      83500 -- (-717.680) (-721.977) (-721.181) [-715.171] * (-715.918) (-717.567) [-716.382] (-715.516) -- 0:00:54
      84000 -- (-716.773) [-717.613] (-715.868) (-718.104) * [-716.055] (-716.662) (-716.071) (-716.622) -- 0:00:54
      84500 -- (-721.455) [-716.182] (-715.235) (-717.738) * (-718.058) (-717.275) [-714.730] (-714.700) -- 0:00:54
      85000 -- (-723.587) [-716.184] (-715.030) (-716.033) * [-716.073] (-719.005) (-715.940) (-714.829) -- 0:00:53

      Average standard deviation of split frequencies: 0.028778

      85500 -- [-716.512] (-717.192) (-717.167) (-715.970) * (-715.242) (-717.908) (-717.931) [-716.996] -- 0:00:53
      86000 -- (-715.140) (-715.730) (-719.011) [-717.279] * (-724.188) (-717.730) [-715.929] (-716.985) -- 0:01:03
      86500 -- (-716.981) [-716.123] (-717.174) (-716.266) * [-719.676] (-723.457) (-722.135) (-716.375) -- 0:01:03
      87000 -- (-717.310) (-715.513) [-715.570] (-715.903) * (-717.409) [-717.624] (-717.562) (-715.088) -- 0:01:02
      87500 -- (-716.883) [-716.539] (-716.365) (-715.224) * (-716.235) (-717.860) [-716.352] (-714.882) -- 0:01:02
      88000 -- (-715.857) [-716.170] (-717.838) (-716.541) * (-715.794) [-715.040] (-718.026) (-719.036) -- 0:01:02
      88500 -- [-717.647] (-718.406) (-718.693) (-717.745) * (-715.721) (-716.271) [-714.735] (-716.665) -- 0:01:01
      89000 -- (-718.753) [-716.666] (-716.933) (-724.797) * [-717.961] (-716.596) (-717.934) (-716.214) -- 0:01:01
      89500 -- [-718.104] (-717.833) (-719.680) (-716.452) * [-715.222] (-717.897) (-721.479) (-716.619) -- 0:01:01
      90000 -- (-717.512) [-715.646] (-718.367) (-716.473) * (-717.186) [-714.804] (-715.574) (-718.294) -- 0:01:00

      Average standard deviation of split frequencies: 0.023273

      90500 -- (-717.107) (-719.690) [-717.789] (-718.457) * (-720.002) (-715.247) (-716.408) [-715.036] -- 0:01:00
      91000 -- (-715.654) [-716.366] (-717.529) (-717.737) * (-724.176) (-716.358) (-716.630) [-715.540] -- 0:00:59
      91500 -- (-721.836) [-720.163] (-717.678) (-719.398) * (-718.161) (-716.181) (-716.341) [-716.016] -- 0:00:59
      92000 -- (-718.362) [-715.778] (-715.385) (-715.730) * (-714.877) (-716.947) [-716.998] (-715.456) -- 0:00:59
      92500 -- (-717.167) (-714.822) [-717.879] (-716.535) * (-716.346) [-716.572] (-716.409) (-716.242) -- 0:00:58
      93000 -- (-721.000) [-714.470] (-719.477) (-721.661) * [-716.016] (-719.512) (-717.563) (-715.079) -- 0:00:58
      93500 -- (-715.077) [-715.501] (-718.904) (-715.243) * (-717.998) (-716.700) (-716.933) [-715.619] -- 0:00:58
      94000 -- [-716.237] (-716.405) (-717.406) (-718.090) * (-714.961) (-718.239) [-716.399] (-717.906) -- 0:00:57
      94500 -- (-716.246) (-717.390) (-714.673) [-715.586] * (-719.294) (-715.858) (-716.144) [-718.035] -- 0:00:57
      95000 -- (-719.052) (-715.640) (-722.679) [-715.736] * (-721.648) (-719.832) (-716.454) [-721.351] -- 0:00:57

      Average standard deviation of split frequencies: 0.026271

      95500 -- (-715.164) (-715.844) (-716.092) [-721.202] * (-716.553) (-718.506) [-716.537] (-714.956) -- 0:00:56
      96000 -- (-726.329) [-715.917] (-717.009) (-715.817) * (-721.381) [-717.682] (-716.817) (-717.739) -- 0:00:56
      96500 -- (-724.490) (-719.164) [-716.609] (-717.673) * (-720.062) (-717.282) [-715.134] (-720.311) -- 0:00:56
      97000 -- (-716.242) (-716.519) [-715.834] (-718.061) * (-715.268) (-716.296) [-714.827] (-717.724) -- 0:00:55
      97500 -- (-717.745) (-716.885) (-717.129) [-718.621] * (-714.762) [-717.800] (-716.212) (-718.801) -- 0:00:55
      98000 -- (-719.953) [-716.175] (-717.003) (-716.852) * [-718.500] (-718.912) (-717.042) (-717.696) -- 0:00:55
      98500 -- (-717.559) [-715.921] (-717.080) (-717.106) * (-714.573) (-716.309) (-718.377) [-718.406] -- 0:00:54
      99000 -- (-715.014) (-717.098) (-721.720) [-716.062] * [-714.230] (-715.743) (-721.203) (-719.940) -- 0:00:54
      99500 -- (-715.069) [-715.609] (-715.208) (-716.957) * [-714.879] (-715.321) (-717.092) (-717.180) -- 0:00:54
      100000 -- (-717.094) (-718.529) [-714.373] (-716.923) * (-715.785) (-715.571) (-716.898) [-714.906] -- 0:00:54

      Average standard deviation of split frequencies: 0.026372

      100500 -- [-716.607] (-720.792) (-716.900) (-716.957) * (-716.209) [-715.014] (-717.323) (-715.249) -- 0:00:53
      101000 -- [-717.662] (-717.459) (-716.274) (-717.417) * (-717.203) [-715.338] (-715.584) (-716.541) -- 0:00:53
      101500 -- (-716.619) (-718.630) [-718.028] (-716.521) * (-716.659) (-719.904) [-714.655] (-717.119) -- 0:00:53
      102000 -- (-716.617) (-717.689) [-717.730] (-715.900) * (-717.626) (-716.227) [-716.317] (-714.607) -- 0:00:52
      102500 -- (-718.630) (-718.374) (-718.811) [-715.410] * (-719.547) (-716.399) (-721.449) [-714.479] -- 0:00:52
      103000 -- (-718.265) [-721.294] (-719.964) (-717.960) * [-718.384] (-720.564) (-720.138) (-715.722) -- 0:01:00
      103500 -- [-716.591] (-715.699) (-721.979) (-715.238) * (-718.437) [-719.530] (-717.101) (-715.667) -- 0:01:00
      104000 -- [-717.157] (-716.394) (-718.247) (-715.369) * (-715.250) (-717.596) [-717.084] (-714.368) -- 0:01:00
      104500 -- (-721.116) (-714.734) (-716.632) [-716.158] * (-715.140) (-717.196) [-715.931] (-715.120) -- 0:00:59
      105000 -- (-717.368) [-714.822] (-714.864) (-716.320) * (-718.802) (-716.702) (-714.797) [-715.284] -- 0:00:59

      Average standard deviation of split frequencies: 0.025045

      105500 -- (-714.983) (-715.750) (-724.282) [-716.711] * (-717.391) (-717.041) (-714.574) [-716.523] -- 0:00:59
      106000 -- (-715.414) [-714.807] (-716.206) (-715.591) * (-716.631) (-719.720) (-720.782) [-716.177] -- 0:00:59
      106500 -- [-714.932] (-716.199) (-717.305) (-717.290) * (-715.291) [-715.085] (-717.577) (-716.738) -- 0:00:58
      107000 -- (-716.301) (-716.135) (-718.354) [-716.998] * (-720.074) (-718.095) [-715.018] (-717.073) -- 0:00:58
      107500 -- (-714.598) [-719.983] (-718.430) (-715.477) * (-717.834) (-715.694) [-717.038] (-715.401) -- 0:00:58
      108000 -- (-720.394) (-715.574) [-717.570] (-715.276) * (-716.478) (-716.414) (-719.058) [-714.328] -- 0:00:57
      108500 -- (-716.360) [-717.942] (-717.213) (-716.951) * (-716.403) (-717.589) (-716.633) [-714.558] -- 0:00:57
      109000 -- [-715.523] (-716.277) (-718.781) (-715.084) * (-716.537) [-715.886] (-721.144) (-716.339) -- 0:00:57
      109500 -- (-718.622) (-716.990) (-715.312) [-715.876] * [-714.609] (-715.824) (-719.783) (-716.774) -- 0:00:56
      110000 -- [-715.029] (-717.594) (-714.687) (-716.887) * (-715.596) (-716.301) [-715.929] (-715.911) -- 0:00:56

      Average standard deviation of split frequencies: 0.026231

      110500 -- [-715.589] (-719.509) (-717.851) (-715.780) * (-717.085) (-715.658) (-715.323) [-715.611] -- 0:00:56
      111000 -- (-715.961) (-718.311) [-718.938] (-714.624) * (-715.902) [-717.166] (-715.482) (-714.335) -- 0:00:56
      111500 -- (-715.696) (-718.937) (-716.180) [-716.294] * [-716.634] (-715.180) (-717.456) (-714.994) -- 0:00:55
      112000 -- (-717.153) (-715.166) [-714.529] (-715.332) * (-717.146) (-715.781) (-716.107) [-715.589] -- 0:00:55
      112500 -- (-718.059) [-716.279] (-714.740) (-714.313) * (-714.906) (-715.996) [-718.105] (-717.955) -- 0:00:55
      113000 -- (-721.103) [-715.963] (-715.693) (-715.270) * [-715.586] (-719.052) (-721.891) (-715.480) -- 0:00:54
      113500 -- (-717.108) (-716.410) [-717.189] (-716.043) * (-718.902) (-715.714) [-714.838] (-715.115) -- 0:00:54
      114000 -- (-718.509) (-717.920) (-716.910) [-715.266] * (-724.598) [-714.842] (-722.391) (-715.078) -- 0:00:54
      114500 -- [-719.118] (-717.205) (-724.425) (-716.090) * (-717.300) [-716.721] (-720.053) (-716.379) -- 0:00:54
      115000 -- (-716.187) (-716.454) (-717.217) [-715.901] * [-716.547] (-715.451) (-715.190) (-715.704) -- 0:00:53

      Average standard deviation of split frequencies: 0.022577

      115500 -- [-716.782] (-724.467) (-715.219) (-716.094) * (-718.180) [-718.756] (-715.702) (-715.552) -- 0:00:53
      116000 -- (-715.032) (-717.452) [-716.715] (-715.788) * (-721.459) (-716.076) (-716.526) [-715.704] -- 0:00:53
      116500 -- (-716.104) (-716.550) (-716.173) [-717.055] * (-716.634) [-716.026] (-715.592) (-715.358) -- 0:00:53
      117000 -- [-715.530] (-716.510) (-719.128) (-716.694) * (-715.299) [-718.206] (-717.006) (-716.711) -- 0:00:52
      117500 -- (-716.114) (-718.561) (-721.648) [-716.913] * (-716.099) (-716.721) (-715.577) [-717.128] -- 0:00:52
      118000 -- (-715.613) (-720.959) (-716.241) [-717.298] * (-717.187) (-716.035) (-715.871) [-721.471] -- 0:00:52
      118500 -- (-716.013) [-715.573] (-721.616) (-715.223) * (-717.869) [-717.675] (-715.729) (-721.593) -- 0:00:52
      119000 -- (-716.877) [-717.986] (-715.997) (-715.848) * (-716.817) (-718.050) [-715.899] (-718.103) -- 0:00:51
      119500 -- (-718.470) (-716.654) (-717.060) [-716.486] * (-719.183) (-719.132) [-715.233] (-718.723) -- 0:00:58
      120000 -- (-718.543) (-716.602) (-716.205) [-715.273] * (-715.940) (-718.913) [-718.958] (-718.682) -- 0:00:58

      Average standard deviation of split frequencies: 0.021487

      120500 -- [-718.756] (-715.022) (-721.584) (-714.621) * (-719.022) (-715.239) [-718.478] (-714.913) -- 0:00:58
      121000 -- (-719.012) (-716.060) (-716.824) [-718.722] * (-715.766) [-717.109] (-719.432) (-717.403) -- 0:00:58
      121500 -- [-716.798] (-716.693) (-721.762) (-715.120) * (-717.222) [-718.366] (-719.389) (-722.353) -- 0:00:57
      122000 -- [-715.361] (-715.854) (-716.841) (-716.383) * (-715.587) (-716.638) [-718.941] (-721.861) -- 0:00:57
      122500 -- [-716.441] (-716.729) (-716.872) (-715.416) * (-715.624) (-717.872) [-716.915] (-716.816) -- 0:00:57
      123000 -- (-720.818) (-720.418) (-717.252) [-715.955] * [-715.294] (-715.207) (-717.527) (-715.808) -- 0:00:57
      123500 -- (-718.453) (-717.003) (-718.954) [-718.954] * (-716.102) (-716.635) (-719.237) [-714.652] -- 0:00:56
      124000 -- (-720.018) (-715.110) (-716.275) [-720.679] * (-715.310) (-717.616) [-718.993] (-717.566) -- 0:00:56
      124500 -- (-718.805) [-714.821] (-714.931) (-715.615) * (-717.352) [-717.337] (-715.148) (-716.731) -- 0:00:56
      125000 -- [-717.193] (-721.280) (-715.246) (-719.000) * (-715.352) [-718.179] (-718.165) (-716.855) -- 0:00:56

      Average standard deviation of split frequencies: 0.016934

      125500 -- [-718.967] (-720.787) (-715.515) (-719.876) * (-715.342) (-715.559) [-718.657] (-717.782) -- 0:00:55
      126000 -- (-715.532) (-715.933) [-717.124] (-716.847) * [-717.393] (-717.234) (-716.154) (-719.054) -- 0:00:55
      126500 -- (-714.704) [-715.918] (-721.034) (-715.339) * (-714.467) (-723.719) (-716.841) [-716.944] -- 0:00:55
      127000 -- (-716.737) (-719.221) (-718.586) [-718.245] * (-715.483) (-718.529) (-716.712) [-715.347] -- 0:00:54
      127500 -- [-716.249] (-716.068) (-718.026) (-719.430) * (-716.541) [-717.351] (-722.597) (-715.597) -- 0:00:54
      128000 -- (-717.829) (-717.112) [-717.134] (-715.499) * (-716.222) (-715.794) [-717.610] (-714.614) -- 0:00:54
      128500 -- (-720.401) (-721.040) (-715.697) [-714.757] * (-717.143) (-716.827) (-715.888) [-715.344] -- 0:00:54
      129000 -- (-716.721) (-716.033) [-715.849] (-715.363) * (-717.214) (-718.917) [-715.305] (-715.514) -- 0:00:54
      129500 -- (-715.663) (-715.379) (-716.227) [-716.211] * (-715.368) (-715.533) [-716.762] (-716.954) -- 0:00:53
      130000 -- (-716.358) [-716.334] (-719.892) (-717.991) * (-715.384) [-714.725] (-718.089) (-719.816) -- 0:00:53

      Average standard deviation of split frequencies: 0.019241

      130500 -- [-717.150] (-718.223) (-717.043) (-719.351) * (-723.090) [-716.967] (-718.694) (-723.364) -- 0:00:53
      131000 -- [-715.468] (-718.685) (-724.872) (-715.626) * [-715.530] (-715.952) (-718.998) (-716.173) -- 0:00:53
      131500 -- (-716.845) (-718.601) (-715.207) [-721.911] * [-716.172] (-715.806) (-718.273) (-718.958) -- 0:00:52
      132000 -- (-718.495) (-715.110) [-716.259] (-716.270) * (-715.249) (-716.016) (-716.783) [-720.744] -- 0:00:52
      132500 -- (-715.801) (-717.719) (-715.905) [-714.871] * (-716.722) (-715.689) [-715.926] (-716.381) -- 0:00:52
      133000 -- (-715.644) (-718.588) [-716.225] (-715.579) * (-719.431) [-717.975] (-716.032) (-719.473) -- 0:00:52
      133500 -- (-717.705) [-716.073] (-716.624) (-716.733) * (-719.261) (-717.689) [-716.496] (-715.910) -- 0:00:51
      134000 -- (-716.099) [-718.211] (-715.470) (-715.479) * (-715.852) (-718.315) (-718.070) [-715.576] -- 0:00:51
      134500 -- (-715.467) (-722.824) (-717.064) [-716.436] * [-718.281] (-721.928) (-714.402) (-715.871) -- 0:00:51
      135000 -- (-716.802) (-717.488) [-717.224] (-716.213) * [-716.395] (-715.006) (-716.205) (-716.284) -- 0:00:51

      Average standard deviation of split frequencies: 0.017909

      135500 -- (-714.995) (-717.691) [-717.368] (-717.978) * (-717.556) (-714.817) (-715.106) [-716.962] -- 0:00:57
      136000 -- (-716.450) [-716.198] (-718.348) (-715.364) * (-716.790) (-719.635) [-718.781] (-724.195) -- 0:00:57
      136500 -- (-714.685) (-717.740) (-716.573) [-716.281] * [-716.380] (-715.534) (-716.436) (-717.455) -- 0:00:56
      137000 -- (-715.232) [-715.946] (-725.056) (-716.353) * [-716.383] (-720.768) (-718.302) (-715.826) -- 0:00:56
      137500 -- [-719.528] (-717.848) (-717.317) (-718.373) * (-714.226) (-717.142) (-716.932) [-716.583] -- 0:00:56
      138000 -- (-714.967) [-718.762] (-717.443) (-718.337) * (-714.859) [-718.324] (-715.789) (-716.156) -- 0:00:56
      138500 -- (-718.422) (-715.716) (-717.570) [-719.110] * [-715.075] (-717.505) (-721.228) (-718.326) -- 0:00:55
      139000 -- (-722.276) (-717.622) (-715.328) [-717.118] * (-714.443) [-719.742] (-716.061) (-717.798) -- 0:00:55
      139500 -- (-721.879) [-714.932] (-718.309) (-717.505) * (-716.594) (-715.423) (-716.591) [-716.019] -- 0:00:55
      140000 -- (-719.976) (-715.387) [-717.239] (-714.937) * (-715.232) (-716.110) [-716.989] (-715.891) -- 0:00:55

      Average standard deviation of split frequencies: 0.018618

      140500 -- (-717.468) (-714.743) (-716.804) [-715.447] * [-716.805] (-716.051) (-717.230) (-715.034) -- 0:00:55
      141000 -- (-716.348) (-716.864) (-718.032) [-715.081] * [-718.727] (-716.828) (-716.393) (-715.679) -- 0:00:54
      141500 -- (-716.282) [-717.096] (-716.336) (-716.195) * (-718.960) [-715.076] (-715.342) (-715.413) -- 0:00:54
      142000 -- (-717.380) (-716.540) (-716.220) [-715.318] * (-719.351) (-717.429) [-718.077] (-715.038) -- 0:00:54
      142500 -- (-714.856) [-715.617] (-718.690) (-715.180) * (-721.830) (-717.922) [-715.999] (-716.522) -- 0:00:54
      143000 -- (-718.713) [-715.560] (-715.771) (-716.580) * (-718.144) [-716.070] (-716.171) (-714.713) -- 0:00:53
      143500 -- (-716.025) (-716.123) [-716.822] (-718.914) * (-717.935) (-718.407) (-717.269) [-716.104] -- 0:00:53
      144000 -- (-717.720) [-715.850] (-715.978) (-716.528) * [-715.228] (-715.868) (-718.303) (-717.059) -- 0:00:53
      144500 -- (-716.787) [-715.726] (-715.916) (-718.743) * [-715.536] (-716.403) (-715.068) (-717.639) -- 0:00:53
      145000 -- (-716.391) [-715.050] (-716.208) (-717.161) * [-719.170] (-718.487) (-715.053) (-717.535) -- 0:00:53

      Average standard deviation of split frequencies: 0.018476

      145500 -- [-717.277] (-718.078) (-715.533) (-715.582) * (-716.706) (-715.509) [-715.134] (-719.981) -- 0:00:52
      146000 -- (-716.656) (-717.458) [-720.771] (-716.234) * [-718.029] (-716.756) (-721.840) (-717.554) -- 0:00:52
      146500 -- (-716.226) (-716.815) (-722.909) [-716.485] * (-716.675) [-716.642] (-720.266) (-715.261) -- 0:00:52
      147000 -- (-718.055) [-719.721] (-715.820) (-715.062) * (-716.202) (-717.744) (-717.441) [-717.440] -- 0:00:52
      147500 -- (-719.086) (-717.728) (-716.692) [-717.232] * (-715.018) (-716.862) [-718.819] (-714.715) -- 0:00:52
      148000 -- (-716.654) [-715.794] (-717.483) (-716.766) * [-715.360] (-718.014) (-716.111) (-717.863) -- 0:00:51
      148500 -- (-717.529) (-716.083) [-717.855] (-715.085) * (-716.553) (-717.187) (-718.113) [-715.867] -- 0:00:51
      149000 -- (-717.210) (-717.161) [-715.713] (-715.179) * (-715.792) (-716.269) [-716.002] (-721.330) -- 0:00:51
      149500 -- (-717.206) [-716.704] (-716.413) (-715.902) * (-715.614) (-716.936) [-717.976] (-716.245) -- 0:00:51
      150000 -- (-716.641) (-717.455) [-715.799] (-715.499) * (-719.185) [-715.022] (-719.768) (-716.652) -- 0:00:51

      Average standard deviation of split frequencies: 0.016687

      150500 -- (-715.626) [-716.077] (-716.982) (-716.191) * [-716.554] (-715.348) (-715.935) (-718.766) -- 0:00:50
      151000 -- (-715.789) (-716.733) [-715.653] (-720.974) * (-718.376) (-719.264) (-721.090) [-715.009] -- 0:00:50
      151500 -- [-715.299] (-716.543) (-716.992) (-721.132) * [-718.537] (-717.828) (-722.605) (-716.392) -- 0:00:56
      152000 -- (-715.938) [-716.552] (-716.398) (-714.939) * (-718.831) [-716.637] (-716.473) (-717.934) -- 0:00:55
      152500 -- (-716.583) (-716.751) (-715.328) [-718.554] * [-719.861] (-715.408) (-721.080) (-715.779) -- 0:00:55
      153000 -- [-716.053] (-714.703) (-715.283) (-718.322) * [-717.593] (-718.424) (-720.609) (-715.422) -- 0:00:55
      153500 -- (-716.635) (-717.039) [-715.709] (-717.558) * [-716.383] (-722.795) (-716.084) (-721.667) -- 0:00:55
      154000 -- (-714.797) (-714.956) [-717.711] (-716.458) * (-719.990) (-717.575) [-716.445] (-714.674) -- 0:00:54
      154500 -- [-714.885] (-717.154) (-716.995) (-716.277) * [-716.545] (-715.737) (-716.322) (-715.388) -- 0:00:54
      155000 -- [-716.062] (-717.774) (-720.159) (-716.766) * (-719.796) (-715.775) [-716.395] (-715.675) -- 0:00:54

      Average standard deviation of split frequencies: 0.017813

      155500 -- (-715.699) (-716.983) [-717.729] (-716.234) * (-724.734) [-715.414] (-715.954) (-716.199) -- 0:00:54
      156000 -- [-717.168] (-719.603) (-715.670) (-716.850) * [-718.445] (-714.823) (-720.917) (-715.403) -- 0:00:54
      156500 -- (-724.340) [-717.479] (-715.744) (-721.051) * (-718.490) (-719.355) [-716.957] (-717.618) -- 0:00:53
      157000 -- (-716.292) (-717.874) [-716.723] (-715.588) * (-715.174) (-719.944) (-718.121) [-716.430] -- 0:00:53
      157500 -- (-714.235) (-720.762) (-715.728) [-714.865] * (-716.065) (-714.534) [-716.003] (-722.964) -- 0:00:53
      158000 -- (-714.263) [-718.231] (-720.733) (-716.240) * [-717.438] (-715.544) (-717.771) (-715.857) -- 0:00:53
      158500 -- (-714.421) (-716.724) (-719.397) [-716.097] * (-717.705) (-715.303) (-716.592) [-715.705] -- 0:00:53
      159000 -- (-715.443) (-714.963) [-718.060] (-719.382) * [-715.270] (-715.997) (-719.342) (-718.570) -- 0:00:52
      159500 -- (-715.217) (-715.980) (-715.463) [-715.948] * [-715.759] (-714.795) (-721.215) (-715.894) -- 0:00:52
      160000 -- (-715.051) (-716.063) [-721.051] (-716.447) * (-715.293) (-717.341) [-721.523] (-714.286) -- 0:00:52

      Average standard deviation of split frequencies: 0.014498

      160500 -- (-716.346) (-716.320) [-715.568] (-715.457) * (-715.736) (-717.223) [-714.799] (-718.616) -- 0:00:52
      161000 -- (-719.380) (-714.891) (-715.381) [-714.682] * [-716.411] (-717.372) (-715.270) (-719.972) -- 0:00:52
      161500 -- (-714.861) [-715.684] (-718.446) (-715.972) * (-714.973) (-719.076) [-717.343] (-715.627) -- 0:00:51
      162000 -- (-718.995) [-714.347] (-717.011) (-714.851) * (-719.426) (-717.863) [-716.467] (-715.024) -- 0:00:51
      162500 -- (-718.830) (-715.316) [-715.052] (-716.637) * [-716.489] (-716.273) (-715.396) (-717.796) -- 0:00:51
      163000 -- [-718.196] (-717.291) (-715.134) (-717.219) * [-718.426] (-719.979) (-720.660) (-716.378) -- 0:00:51
      163500 -- (-717.971) (-720.305) (-715.670) [-716.323] * (-716.882) [-715.727] (-719.018) (-715.760) -- 0:00:51
      164000 -- (-717.762) [-715.727] (-717.161) (-717.998) * [-716.935] (-716.632) (-715.272) (-715.306) -- 0:00:50
      164500 -- (-719.553) (-718.191) (-719.459) [-715.721] * [-719.412] (-715.630) (-723.152) (-717.380) -- 0:00:50
      165000 -- (-716.444) (-720.291) (-716.386) [-715.406] * (-716.353) (-715.970) [-715.681] (-715.800) -- 0:00:50

      Average standard deviation of split frequencies: 0.014700

      165500 -- (-717.389) [-716.021] (-716.687) (-715.638) * (-715.645) (-717.215) [-717.982] (-716.463) -- 0:00:50
      166000 -- (-714.728) (-715.959) (-722.653) [-715.417] * (-715.697) (-718.911) [-716.292] (-718.647) -- 0:00:50
      166500 -- (-719.484) (-715.960) (-716.566) [-715.011] * [-717.925] (-718.262) (-715.393) (-717.335) -- 0:00:50
      167000 -- (-716.159) (-717.596) (-715.294) [-717.178] * (-717.575) (-716.781) [-716.474] (-720.311) -- 0:00:49
      167500 -- [-717.479] (-715.981) (-716.860) (-720.315) * (-716.877) (-715.494) (-715.303) [-718.379] -- 0:00:54
      168000 -- (-716.261) (-715.762) (-715.873) [-716.371] * (-715.955) (-717.680) [-717.327] (-718.937) -- 0:00:54
      168500 -- (-719.626) (-717.191) (-717.096) [-720.150] * [-717.448] (-716.713) (-718.883) (-718.133) -- 0:00:54
      169000 -- (-718.923) (-718.196) [-715.628] (-720.177) * (-718.643) [-716.103] (-715.893) (-718.023) -- 0:00:54
      169500 -- (-718.980) [-714.557] (-716.053) (-718.436) * [-714.505] (-714.694) (-714.508) (-715.634) -- 0:00:53
      170000 -- [-716.242] (-718.758) (-715.242) (-716.644) * [-715.840] (-716.002) (-714.617) (-716.352) -- 0:00:53

      Average standard deviation of split frequencies: 0.015652

      170500 -- (-716.128) (-714.898) [-715.208] (-715.529) * (-721.792) (-717.985) [-715.898] (-716.478) -- 0:00:53
      171000 -- [-715.964] (-714.902) (-718.493) (-716.960) * (-719.201) [-715.858] (-721.078) (-716.232) -- 0:00:53
      171500 -- (-715.615) [-715.853] (-715.724) (-718.001) * [-718.197] (-717.694) (-718.484) (-717.280) -- 0:00:53
      172000 -- (-720.654) (-715.266) (-717.999) [-716.376] * [-718.244] (-716.978) (-717.523) (-720.569) -- 0:00:52
      172500 -- (-718.857) (-718.954) [-715.398] (-716.894) * [-715.221] (-716.551) (-721.459) (-717.469) -- 0:00:52
      173000 -- (-717.528) (-715.944) [-714.646] (-714.657) * (-716.730) (-716.282) (-720.599) [-715.288] -- 0:00:52
      173500 -- (-715.343) (-717.550) [-715.577] (-715.873) * (-716.663) [-717.126] (-715.540) (-715.300) -- 0:00:52
      174000 -- [-715.532] (-717.983) (-715.319) (-717.412) * (-715.501) (-716.468) [-715.253] (-717.874) -- 0:00:52
      174500 -- (-716.842) [-718.499] (-716.315) (-715.724) * [-715.315] (-715.781) (-715.714) (-718.072) -- 0:00:52
      175000 -- (-717.039) (-715.965) (-719.667) [-714.686] * (-718.473) (-715.971) [-715.107] (-714.859) -- 0:00:51

      Average standard deviation of split frequencies: 0.016858

      175500 -- (-715.712) (-714.938) (-715.778) [-716.194] * [-717.466] (-716.439) (-715.122) (-717.225) -- 0:00:51
      176000 -- (-715.917) [-715.193] (-716.231) (-716.308) * (-717.465) [-716.762] (-720.269) (-716.796) -- 0:00:51
      176500 -- (-714.911) (-719.033) (-717.144) [-717.041] * (-716.639) (-715.081) [-715.789] (-723.984) -- 0:00:51
      177000 -- (-718.460) [-716.886] (-716.499) (-716.533) * (-715.367) (-715.675) (-715.117) [-717.695] -- 0:00:51
      177500 -- [-715.100] (-715.843) (-715.815) (-715.242) * (-717.844) (-715.243) [-715.761] (-716.331) -- 0:00:50
      178000 -- [-715.558] (-715.828) (-718.111) (-716.544) * (-718.184) (-717.121) (-715.175) [-716.381] -- 0:00:50
      178500 -- (-718.811) (-715.260) [-714.823] (-716.878) * (-714.328) (-718.905) (-720.214) [-717.755] -- 0:00:50
      179000 -- [-716.680] (-716.020) (-717.156) (-715.470) * (-715.597) [-716.883] (-722.021) (-717.581) -- 0:00:50
      179500 -- (-716.350) [-715.734] (-719.060) (-715.076) * (-718.584) [-718.263] (-721.730) (-717.186) -- 0:00:50
      180000 -- (-720.311) (-722.882) [-718.202] (-716.187) * (-717.913) [-716.387] (-717.609) (-716.655) -- 0:00:50

      Average standard deviation of split frequencies: 0.018591

      180500 -- (-714.635) (-714.994) (-716.412) [-717.761] * (-718.247) (-719.162) (-716.215) [-717.290] -- 0:00:49
      181000 -- [-715.569] (-721.117) (-715.449) (-717.048) * [-715.715] (-715.215) (-717.094) (-715.240) -- 0:00:49
      181500 -- (-719.476) (-723.673) [-718.033] (-717.906) * [-715.660] (-715.904) (-718.010) (-714.985) -- 0:00:49
      182000 -- (-720.519) [-719.103] (-723.688) (-715.818) * (-715.358) [-716.193] (-716.450) (-715.716) -- 0:00:49
      182500 -- (-718.020) (-717.517) (-714.672) [-716.689] * (-714.772) (-715.859) [-718.743] (-716.679) -- 0:00:49
      183000 -- (-718.510) (-719.120) (-715.225) [-714.777] * (-715.374) (-715.257) [-718.075] (-717.411) -- 0:00:49
      183500 -- (-714.208) (-715.923) (-716.308) [-714.681] * [-715.030] (-717.275) (-718.541) (-716.258) -- 0:00:48
      184000 -- (-716.344) (-715.006) (-717.314) [-715.494] * (-716.399) [-714.488] (-719.217) (-719.498) -- 0:00:48
      184500 -- (-716.519) [-716.383] (-714.859) (-716.258) * (-716.318) (-717.120) (-720.688) [-717.489] -- 0:00:53
      185000 -- (-719.971) [-716.498] (-715.033) (-715.153) * (-716.031) (-716.016) (-716.862) [-715.778] -- 0:00:52

      Average standard deviation of split frequencies: 0.018039

      185500 -- (-716.451) (-716.555) (-717.118) [-716.491] * (-716.107) (-715.994) (-717.080) [-716.365] -- 0:00:52
      186000 -- (-719.592) (-717.059) [-715.615] (-717.323) * (-719.254) (-721.383) [-716.379] (-715.524) -- 0:00:52
      186500 -- (-719.625) (-721.361) (-716.291) [-716.523] * (-719.490) (-718.995) (-715.779) [-714.560] -- 0:00:52
      187000 -- [-716.025] (-714.908) (-718.784) (-716.951) * (-716.888) (-714.958) (-716.924) [-714.937] -- 0:00:52
      187500 -- (-718.641) (-715.117) (-722.081) [-715.285] * (-716.361) (-719.189) (-715.502) [-715.822] -- 0:00:52
      188000 -- (-716.367) [-716.596] (-723.892) (-716.004) * (-716.233) [-716.184] (-716.153) (-715.308) -- 0:00:51
      188500 -- (-718.314) (-717.525) (-716.532) [-718.359] * [-716.470] (-716.536) (-715.406) (-714.526) -- 0:00:51
      189000 -- (-720.088) (-714.569) [-715.577] (-715.421) * (-717.022) (-717.514) (-718.676) [-715.827] -- 0:00:51
      189500 -- (-716.439) (-714.760) [-714.936] (-715.590) * [-715.855] (-714.587) (-721.325) (-716.993) -- 0:00:51
      190000 -- (-716.823) (-715.259) [-716.930] (-720.293) * [-715.892] (-715.980) (-718.978) (-717.369) -- 0:00:51

      Average standard deviation of split frequencies: 0.017161

      190500 -- [-716.509] (-715.562) (-718.004) (-715.560) * (-717.292) [-717.259] (-719.222) (-716.333) -- 0:00:50
      191000 -- (-716.504) [-718.124] (-715.745) (-719.742) * [-717.126] (-718.159) (-714.770) (-717.507) -- 0:00:50
      191500 -- (-718.799) (-716.306) (-717.364) [-715.763] * (-715.142) (-716.107) [-716.903] (-716.347) -- 0:00:50
      192000 -- (-718.622) [-715.496] (-716.689) (-715.227) * [-718.000] (-717.995) (-718.970) (-716.460) -- 0:00:50
      192500 -- (-717.985) (-715.462) [-715.917] (-716.487) * [-715.362] (-715.635) (-715.497) (-717.160) -- 0:00:50
      193000 -- (-716.196) (-720.591) (-720.136) [-715.721] * (-714.818) (-717.029) [-717.601] (-715.922) -- 0:00:50
      193500 -- [-716.407] (-716.835) (-717.804) (-715.430) * (-717.722) (-715.808) (-717.332) [-715.572] -- 0:00:50
      194000 -- (-716.043) (-719.353) (-716.035) [-716.246] * (-714.562) [-715.868] (-715.980) (-716.606) -- 0:00:49
      194500 -- (-719.869) [-717.677] (-720.778) (-716.215) * (-719.490) [-716.267] (-719.441) (-720.962) -- 0:00:49
      195000 -- (-718.324) [-716.086] (-716.172) (-715.484) * (-719.733) (-715.554) [-714.284] (-715.327) -- 0:00:49

      Average standard deviation of split frequencies: 0.018392

      195500 -- (-718.952) (-721.283) (-715.117) [-714.600] * (-720.697) (-719.286) [-714.365] (-719.428) -- 0:00:49
      196000 -- (-715.664) (-721.345) (-715.662) [-716.145] * (-715.378) (-718.766) [-714.388] (-716.844) -- 0:00:49
      196500 -- (-715.740) (-717.344) (-716.435) [-717.053] * (-717.955) [-715.709] (-716.976) (-725.821) -- 0:00:49
      197000 -- (-717.476) [-715.070] (-720.190) (-716.672) * [-720.315] (-715.006) (-718.808) (-715.248) -- 0:00:48
      197500 -- [-716.818] (-715.968) (-720.705) (-714.977) * [-717.208] (-715.374) (-720.240) (-715.717) -- 0:00:48
      198000 -- (-715.626) (-715.837) (-722.158) [-715.839] * [-716.775] (-714.628) (-720.135) (-718.683) -- 0:00:48
      198500 -- [-715.684] (-717.977) (-718.423) (-722.064) * [-714.724] (-716.474) (-714.962) (-717.831) -- 0:00:48
      199000 -- (-716.971) (-720.325) (-718.987) [-715.876] * (-714.805) [-715.204] (-715.463) (-716.406) -- 0:00:48
      199500 -- [-717.151] (-719.262) (-715.675) (-716.080) * (-717.665) (-716.861) [-716.668] (-714.671) -- 0:00:48
      200000 -- (-718.166) (-723.157) (-721.891) [-716.245] * (-716.913) (-715.928) (-716.676) [-718.910] -- 0:00:48

      Average standard deviation of split frequencies: 0.017688

      200500 -- (-716.688) (-719.270) (-721.659) [-715.220] * (-721.160) (-719.996) (-716.052) [-715.238] -- 0:00:47
      201000 -- [-715.355] (-715.487) (-717.126) (-717.751) * [-719.351] (-718.642) (-717.228) (-718.107) -- 0:00:51
      201500 -- (-716.682) (-716.413) [-716.386] (-720.384) * (-714.896) (-719.227) [-716.660] (-717.920) -- 0:00:51
      202000 -- (-718.632) (-714.386) (-724.683) [-716.740] * [-718.438] (-717.611) (-719.122) (-717.744) -- 0:00:51
      202500 -- (-714.394) (-715.499) [-717.650] (-718.433) * (-717.617) [-717.903] (-719.101) (-716.072) -- 0:00:51
      203000 -- [-715.388] (-716.374) (-718.481) (-715.548) * (-719.156) (-717.166) [-715.795] (-715.942) -- 0:00:51
      203500 -- (-720.515) (-716.627) [-716.440] (-719.600) * (-717.776) [-717.292] (-715.041) (-715.690) -- 0:00:50
      204000 -- (-715.828) (-715.452) (-721.621) [-714.484] * (-717.932) (-716.617) (-716.132) [-718.859] -- 0:00:50
      204500 -- (-715.578) [-714.135] (-715.742) (-719.846) * (-716.451) (-720.007) [-715.844] (-715.940) -- 0:00:50
      205000 -- [-716.108] (-715.862) (-718.637) (-718.196) * (-720.697) (-720.984) [-716.426] (-716.838) -- 0:00:50

      Average standard deviation of split frequencies: 0.017163

      205500 -- (-719.045) [-714.756] (-714.819) (-717.439) * (-719.533) (-715.238) [-716.089] (-724.328) -- 0:00:50
      206000 -- [-714.805] (-718.306) (-716.757) (-718.364) * [-717.693] (-717.206) (-716.593) (-717.882) -- 0:00:50
      206500 -- (-715.009) (-714.576) [-714.426] (-718.231) * (-716.368) [-715.664] (-716.053) (-718.625) -- 0:00:49
      207000 -- [-717.055] (-714.393) (-714.395) (-718.067) * [-716.750] (-715.137) (-715.629) (-716.197) -- 0:00:49
      207500 -- [-715.880] (-716.433) (-717.438) (-718.800) * (-716.951) (-718.673) [-716.358] (-716.408) -- 0:00:49
      208000 -- [-716.088] (-722.503) (-714.972) (-716.323) * (-716.711) (-716.385) [-717.004] (-716.048) -- 0:00:49
      208500 -- [-716.853] (-717.640) (-718.353) (-722.300) * (-716.347) [-716.402] (-716.767) (-715.819) -- 0:00:49
      209000 -- [-717.370] (-720.546) (-718.980) (-716.218) * (-715.627) (-717.564) [-716.069] (-714.431) -- 0:00:49
      209500 -- (-718.580) (-717.221) [-718.575] (-716.137) * (-720.021) [-715.630] (-718.710) (-715.163) -- 0:00:49
      210000 -- (-715.072) (-715.582) (-722.525) [-715.184] * [-715.477] (-715.380) (-716.227) (-714.491) -- 0:00:48

      Average standard deviation of split frequencies: 0.016783

      210500 -- (-718.195) (-715.728) [-715.370] (-721.433) * (-716.641) (-714.709) [-715.341] (-714.780) -- 0:00:48
      211000 -- (-715.929) [-715.095] (-718.778) (-716.024) * [-715.355] (-715.328) (-716.837) (-716.069) -- 0:00:48
      211500 -- (-717.472) (-719.962) [-715.802] (-716.171) * (-718.202) [-715.887] (-714.768) (-716.293) -- 0:00:48
      212000 -- (-718.722) [-716.767] (-716.223) (-716.116) * (-717.793) (-718.404) [-714.948] (-716.383) -- 0:00:48
      212500 -- [-716.215] (-721.417) (-716.540) (-719.648) * (-721.601) (-717.334) [-718.755] (-715.613) -- 0:00:48
      213000 -- (-718.572) [-719.045] (-714.498) (-714.973) * (-716.680) [-717.562] (-722.478) (-717.984) -- 0:00:48
      213500 -- (-717.820) (-718.853) [-714.215] (-716.920) * [-718.283] (-716.264) (-718.152) (-719.776) -- 0:00:47
      214000 -- (-718.627) (-716.991) (-714.732) [-718.244] * (-718.594) (-715.692) (-714.683) [-717.348] -- 0:00:47
      214500 -- (-717.272) (-717.182) [-714.879] (-717.891) * (-718.487) [-716.605] (-716.738) (-717.133) -- 0:00:47
      215000 -- [-715.690] (-718.132) (-714.483) (-718.672) * (-717.456) (-715.559) [-715.625] (-717.207) -- 0:00:47

      Average standard deviation of split frequencies: 0.015791

      215500 -- (-715.970) (-715.215) (-716.546) [-720.431] * (-718.442) [-716.558] (-718.170) (-714.357) -- 0:00:47
      216000 -- (-721.524) (-720.692) (-716.391) [-717.328] * (-719.092) [-718.455] (-716.438) (-715.834) -- 0:00:47
      216500 -- (-717.457) (-715.817) [-717.666] (-716.417) * (-726.241) [-718.816] (-720.017) (-715.744) -- 0:00:47
      217000 -- (-716.448) (-716.386) [-715.439] (-714.426) * (-716.462) (-717.297) (-717.970) [-715.162] -- 0:00:46
      217500 -- (-718.699) (-715.948) [-714.704] (-719.434) * (-714.985) (-718.748) [-716.083] (-717.130) -- 0:00:50
      218000 -- (-717.534) (-714.964) [-715.739] (-715.402) * [-719.055] (-718.351) (-715.131) (-715.386) -- 0:00:50
      218500 -- [-715.512] (-714.749) (-716.486) (-715.905) * (-717.539) (-721.001) [-715.999] (-716.255) -- 0:00:50
      219000 -- (-715.116) (-716.824) (-717.287) [-715.240] * (-717.478) (-716.982) (-715.240) [-716.769] -- 0:00:49
      219500 -- (-715.425) (-717.719) [-717.180] (-718.197) * [-717.339] (-715.212) (-717.523) (-718.023) -- 0:00:49
      220000 -- [-714.257] (-718.539) (-716.777) (-715.816) * [-716.248] (-716.299) (-718.624) (-717.180) -- 0:00:49

      Average standard deviation of split frequencies: 0.016690

      220500 -- (-715.542) [-718.635] (-717.396) (-716.335) * (-715.184) [-716.128] (-714.821) (-718.217) -- 0:00:49
      221000 -- (-719.120) (-716.677) (-716.403) [-715.336] * [-716.171] (-716.291) (-717.199) (-717.538) -- 0:00:49
      221500 -- (-717.166) (-714.726) [-716.109] (-715.859) * (-714.569) [-717.432] (-716.318) (-716.853) -- 0:00:49
      222000 -- (-715.675) (-714.547) [-716.157] (-716.962) * (-714.315) (-716.452) (-718.501) [-716.443] -- 0:00:49
      222500 -- (-718.234) (-715.404) [-716.398] (-715.595) * (-715.065) [-714.599] (-715.668) (-714.971) -- 0:00:48
      223000 -- [-714.920] (-719.392) (-716.301) (-715.704) * [-716.061] (-715.698) (-715.490) (-715.697) -- 0:00:48
      223500 -- (-715.116) (-721.686) (-715.293) [-714.969] * (-716.216) [-715.711] (-715.049) (-716.645) -- 0:00:48
      224000 -- (-717.760) (-719.557) (-719.646) [-714.767] * (-718.076) (-715.728) (-715.532) [-714.924] -- 0:00:48
      224500 -- (-716.035) (-718.832) [-716.571] (-725.392) * (-716.484) [-717.477] (-715.354) (-715.222) -- 0:00:48
      225000 -- [-715.240] (-715.294) (-719.501) (-720.514) * (-719.020) (-716.067) [-714.474] (-715.024) -- 0:00:48

      Average standard deviation of split frequencies: 0.016319

      225500 -- (-715.944) [-715.395] (-717.860) (-717.501) * (-718.007) (-717.422) (-718.238) [-714.483] -- 0:00:48
      226000 -- (-714.556) [-715.721] (-716.231) (-714.984) * (-720.162) (-718.305) (-717.028) [-715.216] -- 0:00:47
      226500 -- (-715.405) (-715.993) [-719.729] (-717.325) * [-715.370] (-718.972) (-715.508) (-715.656) -- 0:00:47
      227000 -- (-715.614) [-714.534] (-716.058) (-717.956) * (-717.777) (-716.167) [-715.938] (-716.188) -- 0:00:47
      227500 -- (-715.258) (-716.854) [-716.697] (-715.361) * (-716.304) (-716.174) (-715.562) [-715.729] -- 0:00:47
      228000 -- (-715.239) [-715.063] (-715.701) (-715.853) * (-724.254) (-717.894) [-714.907] (-717.578) -- 0:00:47
      228500 -- (-715.815) [-715.232] (-714.886) (-717.195) * (-716.954) (-716.804) [-715.489] (-719.068) -- 0:00:47
      229000 -- (-714.963) [-716.044] (-715.260) (-720.731) * (-716.680) [-714.588] (-717.730) (-715.135) -- 0:00:47
      229500 -- [-714.964] (-715.112) (-716.851) (-717.440) * (-718.954) [-716.134] (-717.694) (-716.200) -- 0:00:47
      230000 -- [-715.590] (-715.730) (-714.380) (-715.273) * (-720.700) [-715.754] (-721.192) (-719.550) -- 0:00:46

      Average standard deviation of split frequencies: 0.016109

      230500 -- [-715.664] (-716.945) (-714.679) (-715.768) * (-718.211) (-715.658) [-717.553] (-720.679) -- 0:00:46
      231000 -- (-717.426) [-716.789] (-719.810) (-719.822) * [-716.418] (-716.057) (-715.292) (-716.749) -- 0:00:46
      231500 -- (-715.784) (-721.428) (-722.380) [-717.168] * [-715.578] (-715.968) (-715.474) (-716.474) -- 0:00:46
      232000 -- [-717.103] (-718.689) (-715.226) (-717.090) * [-720.397] (-718.207) (-719.354) (-714.714) -- 0:00:46
      232500 -- [-718.164] (-718.437) (-716.880) (-719.094) * (-718.149) (-716.228) (-720.024) [-718.511] -- 0:00:46
      233000 -- (-717.818) (-716.693) (-718.829) [-715.962] * (-715.531) [-715.256] (-716.549) (-717.077) -- 0:00:46
      233500 -- [-715.998] (-714.780) (-719.647) (-717.865) * (-715.225) (-715.550) (-716.256) [-721.456] -- 0:00:45
      234000 -- (-715.697) (-715.983) [-716.228] (-717.003) * (-715.887) (-716.463) (-718.747) [-714.859] -- 0:00:49
      234500 -- (-717.650) (-715.319) [-715.106] (-716.678) * (-718.266) [-715.613] (-717.713) (-716.852) -- 0:00:48
      235000 -- (-716.093) (-716.534) [-719.464] (-716.319) * [-716.144] (-715.031) (-716.223) (-715.630) -- 0:00:48

      Average standard deviation of split frequencies: 0.015480

      235500 -- (-719.395) (-716.004) (-723.442) [-714.977] * [-722.783] (-718.909) (-716.356) (-719.287) -- 0:00:48
      236000 -- (-717.792) (-716.110) (-715.597) [-717.192] * (-718.346) (-717.631) [-717.257] (-718.830) -- 0:00:48
      236500 -- [-715.912] (-715.974) (-714.353) (-715.720) * [-721.333] (-717.326) (-715.823) (-717.489) -- 0:00:48
      237000 -- [-716.695] (-715.673) (-717.299) (-717.543) * (-716.291) (-715.633) (-716.180) [-720.418] -- 0:00:48
      237500 -- (-716.003) (-715.560) [-720.408] (-720.953) * (-719.742) (-715.659) (-719.236) [-717.657] -- 0:00:48
      238000 -- (-716.532) (-715.799) [-716.305] (-715.918) * [-719.383] (-716.018) (-724.266) (-715.727) -- 0:00:48
      238500 -- [-717.283] (-714.898) (-715.845) (-718.515) * (-721.814) (-716.308) (-721.914) [-715.776] -- 0:00:47
      239000 -- (-719.075) [-714.464] (-716.741) (-719.364) * (-724.548) [-716.609] (-716.183) (-719.478) -- 0:00:47
      239500 -- (-721.084) (-716.251) (-719.957) [-716.155] * [-716.845] (-716.136) (-721.518) (-718.348) -- 0:00:47
      240000 -- (-719.717) (-716.876) (-718.443) [-715.300] * (-717.171) (-722.528) (-716.194) [-717.815] -- 0:00:47

      Average standard deviation of split frequencies: 0.015555

      240500 -- (-715.647) (-721.154) [-716.030] (-715.780) * [-715.191] (-722.381) (-719.507) (-717.696) -- 0:00:47
      241000 -- (-718.906) (-720.723) [-720.361] (-716.717) * (-717.509) (-715.391) (-718.580) [-717.434] -- 0:00:47
      241500 -- [-717.154] (-717.861) (-715.846) (-717.906) * (-717.916) [-715.137] (-715.119) (-722.684) -- 0:00:47
      242000 -- (-719.034) (-716.250) [-715.121] (-715.656) * (-716.221) [-714.992] (-715.217) (-721.347) -- 0:00:46
      242500 -- (-718.530) (-720.259) (-718.149) [-716.335] * (-715.287) [-715.570] (-714.838) (-719.622) -- 0:00:46
      243000 -- [-715.922] (-719.545) (-717.652) (-718.720) * (-715.960) (-718.666) [-716.408] (-715.134) -- 0:00:46
      243500 -- (-716.806) [-719.936] (-720.630) (-716.106) * (-719.959) (-717.048) [-716.471] (-714.751) -- 0:00:46
      244000 -- [-716.341] (-714.403) (-721.422) (-715.534) * (-718.496) (-716.108) [-715.589] (-718.802) -- 0:00:46
      244500 -- [-715.374] (-715.856) (-714.895) (-715.492) * (-715.202) (-716.283) [-714.920] (-719.798) -- 0:00:46
      245000 -- (-719.841) (-718.265) (-715.866) [-716.308] * (-718.109) (-717.722) [-715.232] (-716.354) -- 0:00:46

      Average standard deviation of split frequencies: 0.015330

      245500 -- (-717.569) (-722.468) [-716.092] (-715.298) * (-714.982) [-714.982] (-714.875) (-716.925) -- 0:00:46
      246000 -- (-719.069) (-718.252) (-715.943) [-714.773] * (-716.074) (-716.291) (-714.424) [-715.312] -- 0:00:45
      246500 -- (-718.916) (-722.388) [-714.817] (-715.429) * (-715.641) (-715.094) [-717.293] (-718.451) -- 0:00:45
      247000 -- (-716.770) (-715.335) [-715.083] (-714.976) * [-715.777] (-715.949) (-719.349) (-715.583) -- 0:00:45
      247500 -- (-716.239) [-714.748] (-717.102) (-715.689) * [-715.738] (-718.026) (-716.078) (-715.764) -- 0:00:45
      248000 -- [-718.845] (-718.496) (-714.669) (-716.699) * (-717.240) (-717.106) [-715.536] (-717.512) -- 0:00:45
      248500 -- (-720.550) (-715.764) [-716.509] (-714.940) * (-715.212) [-716.852] (-715.829) (-716.574) -- 0:00:45
      249000 -- (-714.695) (-714.898) (-716.519) [-714.818] * [-716.935] (-714.497) (-715.469) (-716.824) -- 0:00:45
      249500 -- [-715.778] (-721.878) (-716.469) (-716.075) * (-715.034) (-718.774) (-720.818) [-715.658] -- 0:00:45
      250000 -- (-717.300) (-721.255) [-716.315] (-714.249) * [-715.731] (-714.611) (-721.508) (-715.383) -- 0:00:45

      Average standard deviation of split frequencies: 0.014602

      250500 -- (-717.624) (-714.674) (-716.151) [-714.264] * (-715.857) [-715.983] (-717.635) (-715.295) -- 0:00:47
      251000 -- (-721.051) (-718.691) (-716.290) [-715.319] * (-718.914) (-716.153) [-715.409] (-715.765) -- 0:00:47
      251500 -- (-719.136) (-716.295) (-718.480) [-715.011] * (-718.598) (-715.812) (-721.148) [-717.288] -- 0:00:47
      252000 -- (-714.763) (-719.017) [-718.434] (-715.555) * [-719.365] (-716.576) (-721.427) (-719.815) -- 0:00:47
      252500 -- [-715.394] (-722.323) (-718.398) (-715.545) * (-717.393) (-715.356) (-718.443) [-715.616] -- 0:00:47
      253000 -- [-715.904] (-717.245) (-717.477) (-716.703) * (-723.241) [-715.269] (-721.253) (-714.885) -- 0:00:47
      253500 -- [-715.742] (-718.292) (-720.388) (-716.143) * (-719.811) (-714.986) (-719.770) [-716.032] -- 0:00:47
      254000 -- (-716.677) [-716.529] (-717.848) (-714.966) * (-718.088) [-717.296] (-715.692) (-716.344) -- 0:00:46
      254500 -- [-719.009] (-719.167) (-715.078) (-717.839) * [-715.789] (-716.741) (-716.969) (-714.765) -- 0:00:46
      255000 -- (-718.759) (-715.687) [-714.875] (-717.141) * (-715.812) (-716.556) (-715.327) [-715.821] -- 0:00:46

      Average standard deviation of split frequencies: 0.014623

      255500 -- (-714.565) [-716.666] (-716.284) (-716.797) * (-715.010) [-717.413] (-715.328) (-715.553) -- 0:00:46
      256000 -- (-715.472) (-715.391) [-716.717] (-719.531) * (-716.369) [-716.381] (-717.167) (-723.013) -- 0:00:46
      256500 -- (-718.456) [-716.333] (-716.536) (-717.596) * (-716.743) (-716.455) (-715.312) [-717.528] -- 0:00:46
      257000 -- (-718.249) (-715.057) [-717.970] (-716.034) * (-717.167) [-717.519] (-714.497) (-717.597) -- 0:00:46
      257500 -- (-717.140) (-715.225) (-715.833) [-718.338] * (-715.848) (-719.057) [-715.677] (-715.139) -- 0:00:46
      258000 -- [-719.110] (-715.571) (-716.378) (-721.800) * (-715.765) (-717.029) [-721.471] (-714.869) -- 0:00:46
      258500 -- (-716.560) (-715.389) (-716.668) [-715.391] * (-715.177) (-721.148) (-719.603) [-718.775] -- 0:00:45
      259000 -- (-715.356) (-716.955) (-715.758) [-716.154] * (-715.369) (-716.131) (-715.112) [-716.273] -- 0:00:45
      259500 -- [-715.361] (-719.830) (-717.364) (-715.186) * (-715.385) [-715.463] (-716.286) (-715.948) -- 0:00:45
      260000 -- (-716.781) [-719.700] (-716.661) (-716.670) * (-715.251) (-716.747) (-716.780) [-716.017] -- 0:00:45

      Average standard deviation of split frequencies: 0.012961

      260500 -- [-716.146] (-717.315) (-717.875) (-717.562) * (-714.575) (-717.124) (-719.073) [-714.884] -- 0:00:45
      261000 -- (-715.328) (-720.172) [-716.784] (-715.600) * (-717.933) (-718.529) [-718.680] (-720.146) -- 0:00:45
      261500 -- (-715.191) [-716.639] (-720.135) (-717.103) * (-715.363) [-717.027] (-716.757) (-716.751) -- 0:00:45
      262000 -- (-719.189) (-715.669) (-718.140) [-716.861] * (-715.202) (-718.819) (-717.044) [-722.093] -- 0:00:45
      262500 -- (-721.093) (-715.896) [-720.439] (-716.276) * (-717.112) [-715.549] (-716.267) (-716.727) -- 0:00:44
      263000 -- (-718.477) [-715.251] (-714.815) (-718.718) * (-718.279) [-719.680] (-715.434) (-715.240) -- 0:00:44
      263500 -- (-717.663) (-714.992) [-716.417] (-717.863) * (-717.065) [-716.237] (-716.973) (-717.414) -- 0:00:44
      264000 -- (-718.455) (-714.993) [-715.528] (-720.081) * (-717.692) (-714.853) (-715.849) [-715.147] -- 0:00:44
      264500 -- [-715.496] (-715.697) (-714.684) (-717.529) * (-726.769) (-715.473) (-715.560) [-717.563] -- 0:00:44
      265000 -- (-718.726) (-715.827) [-717.876] (-716.807) * (-717.083) (-715.772) (-721.246) [-716.053] -- 0:00:44

      Average standard deviation of split frequencies: 0.011846

      265500 -- (-715.172) (-722.040) (-716.597) [-717.494] * (-715.617) (-714.901) (-716.974) [-715.054] -- 0:00:44
      266000 -- (-715.227) [-716.973] (-715.882) (-718.017) * (-718.865) (-716.140) (-718.433) [-716.681] -- 0:00:44
      266500 -- [-715.150] (-722.321) (-716.921) (-718.257) * (-715.860) (-716.182) [-715.525] (-719.559) -- 0:00:44
      267000 -- (-715.581) [-717.704] (-715.545) (-721.225) * (-715.749) [-715.479] (-715.775) (-716.605) -- 0:00:43
      267500 -- (-714.663) (-717.829) (-718.463) [-714.346] * (-715.171) [-716.968] (-718.250) (-716.335) -- 0:00:46
      268000 -- (-715.245) (-718.441) [-716.230] (-715.896) * (-714.572) (-717.143) (-716.909) [-716.396] -- 0:00:46
      268500 -- (-715.377) [-715.256] (-719.220) (-715.323) * (-716.409) (-717.816) [-716.390] (-717.165) -- 0:00:46
      269000 -- [-718.421] (-721.182) (-715.736) (-717.046) * [-717.826] (-719.596) (-715.476) (-716.618) -- 0:00:46
      269500 -- (-718.696) [-719.605] (-716.330) (-721.039) * (-719.613) [-715.466] (-715.240) (-716.266) -- 0:00:46
      270000 -- (-715.833) [-715.858] (-716.930) (-715.904) * (-717.706) (-715.427) [-714.599] (-716.291) -- 0:00:45

      Average standard deviation of split frequencies: 0.012191

      270500 -- (-721.545) [-716.615] (-716.409) (-719.125) * (-716.369) [-719.027] (-715.629) (-720.466) -- 0:00:45
      271000 -- (-716.910) [-715.660] (-715.813) (-719.463) * (-717.368) (-717.712) (-717.882) [-714.780] -- 0:00:45
      271500 -- (-719.201) (-718.174) (-715.626) [-718.514] * (-715.883) (-722.458) [-716.321] (-716.216) -- 0:00:45
      272000 -- (-715.954) (-715.319) (-715.548) [-715.909] * (-715.380) [-718.136] (-715.257) (-719.626) -- 0:00:45
      272500 -- (-716.749) (-720.038) [-715.514] (-719.522) * (-718.095) (-716.650) (-716.130) [-716.573] -- 0:00:45
      273000 -- (-718.168) [-718.105] (-718.066) (-716.842) * (-718.780) [-716.654] (-724.157) (-718.434) -- 0:00:45
      273500 -- (-717.500) (-715.481) [-718.293] (-715.701) * (-716.869) (-717.324) (-717.924) [-715.854] -- 0:00:45
      274000 -- (-718.949) [-715.154] (-714.546) (-714.869) * (-715.344) (-719.123) [-715.493] (-716.771) -- 0:00:45
      274500 -- [-715.128] (-715.090) (-716.741) (-715.253) * (-716.070) [-716.510] (-715.546) (-718.706) -- 0:00:44
      275000 -- (-717.605) (-716.335) (-715.331) [-716.042] * (-716.112) (-716.052) (-715.917) [-716.544] -- 0:00:44

      Average standard deviation of split frequencies: 0.011529

      275500 -- [-716.703] (-722.026) (-717.262) (-720.845) * [-715.227] (-720.903) (-720.531) (-717.025) -- 0:00:44
      276000 -- (-718.458) (-717.406) (-716.707) [-715.426] * (-714.498) (-718.048) (-716.679) [-718.100] -- 0:00:44
      276500 -- (-716.726) (-715.518) [-716.665] (-715.791) * [-715.167] (-719.293) (-717.044) (-718.601) -- 0:00:44
      277000 -- [-714.583] (-719.085) (-717.938) (-720.397) * [-717.433] (-716.850) (-715.459) (-716.625) -- 0:00:44
      277500 -- (-716.630) (-717.134) (-716.575) [-715.358] * (-715.964) (-717.757) [-715.945] (-717.159) -- 0:00:44
      278000 -- (-714.680) (-718.000) (-716.204) [-715.163] * [-716.170] (-718.070) (-715.094) (-719.061) -- 0:00:44
      278500 -- (-716.039) (-717.414) (-716.103) [-716.125] * (-717.099) (-716.996) (-717.656) [-718.958] -- 0:00:44
      279000 -- (-715.461) (-718.817) (-716.039) [-717.981] * (-719.138) (-720.330) (-715.301) [-714.476] -- 0:00:43
      279500 -- (-715.763) (-722.480) [-717.809] (-715.737) * (-718.164) [-716.247] (-716.087) (-715.325) -- 0:00:43
      280000 -- (-719.554) [-716.950] (-720.317) (-714.933) * [-720.019] (-717.228) (-720.908) (-717.733) -- 0:00:43

      Average standard deviation of split frequencies: 0.012317

      280500 -- (-721.268) (-719.256) (-714.900) [-716.714] * (-717.598) (-716.724) (-715.726) [-717.982] -- 0:00:43
      281000 -- [-716.159] (-720.926) (-714.729) (-718.188) * (-717.132) (-718.348) [-715.250] (-715.230) -- 0:00:43
      281500 -- (-719.114) [-716.910] (-714.661) (-718.240) * (-718.383) (-714.996) [-716.426] (-716.284) -- 0:00:43
      282000 -- (-718.886) (-719.129) [-715.593] (-714.670) * (-716.200) [-715.009] (-715.267) (-715.259) -- 0:00:43
      282500 -- (-716.162) [-719.477] (-716.724) (-714.613) * [-718.200] (-716.069) (-715.956) (-718.277) -- 0:00:43
      283000 -- (-718.806) (-720.390) (-717.157) [-719.751] * (-719.951) [-716.086] (-717.527) (-720.495) -- 0:00:43
      283500 -- (-721.077) [-714.973] (-724.216) (-722.333) * (-721.719) [-716.565] (-715.373) (-718.780) -- 0:00:42
      284000 -- [-714.328] (-718.649) (-721.954) (-722.297) * (-716.005) (-718.084) [-717.700] (-716.873) -- 0:00:45
      284500 -- (-714.222) (-722.424) (-714.977) [-720.562] * (-715.551) (-719.973) (-715.665) [-715.397] -- 0:00:45
      285000 -- [-717.546] (-721.613) (-715.729) (-715.835) * (-715.245) (-717.069) [-714.489] (-716.214) -- 0:00:45

      Average standard deviation of split frequencies: 0.011435

      285500 -- (-718.837) (-722.862) [-715.003] (-715.675) * [-718.116] (-714.896) (-716.544) (-718.278) -- 0:00:45
      286000 -- (-717.367) (-716.513) (-718.020) [-716.599] * (-716.012) [-715.191] (-714.581) (-718.077) -- 0:00:44
      286500 -- [-716.688] (-715.751) (-715.543) (-715.183) * (-717.685) [-717.725] (-714.591) (-716.677) -- 0:00:44
      287000 -- (-715.189) (-719.842) [-715.299] (-718.119) * (-719.259) (-716.991) [-715.160] (-717.752) -- 0:00:44
      287500 -- (-716.511) (-721.444) [-715.793] (-716.982) * (-720.048) [-714.988] (-716.293) (-716.257) -- 0:00:44
      288000 -- [-716.270] (-715.031) (-715.959) (-716.984) * (-714.648) [-714.520] (-717.084) (-714.311) -- 0:00:44
      288500 -- (-717.473) (-715.936) (-715.610) [-715.734] * (-721.748) (-717.167) (-718.569) [-714.674] -- 0:00:44
      289000 -- (-718.547) [-715.832] (-717.394) (-719.981) * [-715.137] (-715.624) (-715.707) (-716.727) -- 0:00:44
      289500 -- [-718.081] (-716.259) (-718.821) (-720.699) * (-716.757) (-722.328) (-717.934) [-716.880] -- 0:00:44
      290000 -- [-719.130] (-714.780) (-716.014) (-720.479) * [-716.208] (-718.644) (-715.948) (-714.886) -- 0:00:44

      Average standard deviation of split frequencies: 0.011543

      290500 -- (-718.981) [-714.849] (-716.124) (-718.663) * [-715.042] (-717.293) (-717.878) (-719.834) -- 0:00:43
      291000 -- [-714.790] (-716.999) (-716.623) (-716.967) * (-718.512) [-716.368] (-714.887) (-720.034) -- 0:00:43
      291500 -- [-714.467] (-714.242) (-716.468) (-716.601) * (-716.543) (-717.521) (-717.739) [-716.106] -- 0:00:43
      292000 -- [-718.381] (-720.901) (-714.476) (-714.599) * (-716.537) [-716.439] (-721.746) (-718.117) -- 0:00:43
      292500 -- [-716.559] (-716.703) (-714.676) (-719.495) * (-715.850) [-716.388] (-717.793) (-716.213) -- 0:00:43
      293000 -- (-715.497) [-717.920] (-720.900) (-724.243) * (-715.155) (-718.312) [-718.516] (-716.383) -- 0:00:43
      293500 -- (-716.337) [-717.417] (-717.173) (-718.119) * (-718.269) (-716.148) (-714.833) [-715.162] -- 0:00:43
      294000 -- (-716.099) (-717.327) (-717.247) [-714.872] * [-717.263] (-718.237) (-715.687) (-715.496) -- 0:00:43
      294500 -- (-715.380) (-717.688) [-717.122] (-717.211) * (-715.099) (-717.734) [-715.576] (-716.751) -- 0:00:43
      295000 -- [-719.474] (-714.759) (-719.941) (-716.195) * (-716.155) (-722.429) [-715.924] (-715.857) -- 0:00:43

      Average standard deviation of split frequencies: 0.011523

      295500 -- [-721.296] (-720.130) (-719.237) (-716.662) * [-715.479] (-720.252) (-714.851) (-716.870) -- 0:00:42
      296000 -- [-715.577] (-720.354) (-716.029) (-716.904) * (-717.628) (-716.022) (-716.242) [-714.910] -- 0:00:42
      296500 -- (-714.624) (-718.000) (-718.903) [-719.600] * [-717.570] (-715.309) (-717.676) (-718.419) -- 0:00:42
      297000 -- (-714.501) (-717.667) [-716.699] (-718.874) * (-718.761) [-716.785] (-721.621) (-724.283) -- 0:00:42
      297500 -- (-715.078) (-718.825) [-716.833] (-720.459) * (-716.675) [-715.943] (-718.536) (-717.402) -- 0:00:42
      298000 -- (-715.416) [-717.810] (-718.831) (-716.563) * (-715.049) (-717.194) [-716.984] (-717.659) -- 0:00:42
      298500 -- (-716.824) (-716.726) [-716.852] (-715.161) * [-715.871] (-716.939) (-716.015) (-719.935) -- 0:00:42
      299000 -- (-716.476) (-714.994) (-716.103) [-716.246] * (-714.639) (-714.922) [-720.082] (-717.474) -- 0:00:42
      299500 -- (-715.634) (-717.666) [-715.508] (-717.679) * [-716.344] (-715.561) (-720.392) (-716.935) -- 0:00:42
      300000 -- (-715.772) (-715.169) (-715.319) [-717.791] * (-716.124) (-716.345) [-716.240] (-718.172) -- 0:00:44

      Average standard deviation of split frequencies: 0.010053

      300500 -- (-716.449) [-715.007] (-714.804) (-718.001) * (-720.094) (-721.422) (-716.198) [-716.626] -- 0:00:44
      301000 -- [-715.634] (-716.976) (-717.774) (-716.218) * (-717.286) (-714.652) (-718.298) [-714.185] -- 0:00:44
      301500 -- (-717.157) [-717.866] (-717.061) (-715.491) * (-716.108) (-716.043) (-717.196) [-715.531] -- 0:00:44
      302000 -- [-716.017] (-715.869) (-717.151) (-715.530) * [-717.061] (-715.233) (-716.000) (-716.601) -- 0:00:43
      302500 -- [-715.213] (-715.942) (-716.373) (-715.700) * (-718.405) [-716.922] (-716.592) (-719.135) -- 0:00:43
      303000 -- (-714.863) (-715.879) [-715.866] (-716.768) * (-718.020) (-714.557) [-715.490] (-715.192) -- 0:00:43
      303500 -- [-716.557] (-714.575) (-716.971) (-719.513) * [-716.372] (-716.813) (-716.353) (-717.853) -- 0:00:43
      304000 -- [-717.459] (-714.503) (-716.465) (-716.855) * (-716.451) (-715.713) (-717.410) [-717.878] -- 0:00:43
      304500 -- (-719.056) (-714.367) (-716.071) [-718.721] * (-717.790) [-714.560] (-721.359) (-715.201) -- 0:00:43
      305000 -- (-717.737) [-714.572] (-716.870) (-715.710) * (-715.912) (-715.182) (-718.154) [-715.327] -- 0:00:43

      Average standard deviation of split frequencies: 0.009787

      305500 -- [-714.693] (-714.476) (-716.876) (-716.379) * (-717.808) [-716.130] (-718.082) (-715.079) -- 0:00:43
      306000 -- (-717.391) [-715.545] (-718.554) (-714.910) * (-722.263) (-718.163) [-719.687] (-716.465) -- 0:00:43
      306500 -- [-718.340] (-715.422) (-715.449) (-715.138) * [-718.595] (-715.752) (-715.379) (-715.308) -- 0:00:42
      307000 -- [-716.167] (-718.088) (-715.547) (-718.291) * (-716.561) [-715.581] (-716.072) (-716.041) -- 0:00:42
      307500 -- (-714.636) (-716.960) (-716.260) [-714.863] * [-718.469] (-716.091) (-715.001) (-716.920) -- 0:00:42
      308000 -- (-716.003) [-717.435] (-716.216) (-717.183) * (-717.064) (-716.621) (-715.940) [-716.522] -- 0:00:42
      308500 -- (-715.368) (-718.210) (-717.853) [-716.070] * (-715.136) (-717.141) (-719.133) [-716.027] -- 0:00:42
      309000 -- [-716.105] (-717.564) (-717.506) (-714.879) * (-718.376) (-716.582) [-715.817] (-719.279) -- 0:00:42
      309500 -- (-719.169) [-715.664] (-717.872) (-717.253) * (-715.978) [-718.624] (-718.757) (-717.986) -- 0:00:42
      310000 -- (-717.852) [-714.668] (-715.764) (-716.154) * (-719.234) [-714.440] (-715.434) (-715.221) -- 0:00:42

      Average standard deviation of split frequencies: 0.010053

      310500 -- (-716.907) (-714.897) (-716.188) [-715.445] * (-718.872) (-715.289) [-715.774] (-718.312) -- 0:00:42
      311000 -- (-715.879) [-714.555] (-716.118) (-716.462) * (-714.917) (-716.147) [-715.131] (-715.243) -- 0:00:42
      311500 -- [-719.293] (-717.783) (-716.575) (-716.596) * (-715.714) [-717.968] (-719.085) (-716.452) -- 0:00:41
      312000 -- (-716.363) [-714.962] (-716.552) (-716.288) * [-718.029] (-716.451) (-717.539) (-716.798) -- 0:00:41
      312500 -- [-720.352] (-719.688) (-715.402) (-717.792) * (-717.303) (-718.578) [-715.467] (-716.645) -- 0:00:41
      313000 -- (-720.169) [-715.055] (-716.039) (-717.138) * (-714.942) (-715.291) (-717.528) [-716.964] -- 0:00:41
      313500 -- (-719.223) [-716.324] (-720.573) (-718.440) * (-715.852) (-715.732) [-717.856] (-716.180) -- 0:00:41
      314000 -- [-717.499] (-716.414) (-719.123) (-715.429) * (-717.643) [-718.142] (-716.905) (-715.701) -- 0:00:41
      314500 -- (-718.633) (-715.857) [-717.277] (-716.635) * (-715.583) [-716.144] (-716.619) (-715.130) -- 0:00:41
      315000 -- (-717.419) (-716.553) (-719.298) [-714.748] * (-716.239) (-715.588) (-718.124) [-715.205] -- 0:00:41

      Average standard deviation of split frequencies: 0.009324

      315500 -- (-718.680) (-716.019) (-715.558) [-717.107] * (-722.081) (-716.138) (-719.830) [-717.623] -- 0:00:41
      316000 -- (-716.191) [-716.150] (-715.585) (-720.157) * (-719.461) (-721.081) [-718.158] (-717.153) -- 0:00:41
      316500 -- (-716.712) (-715.888) [-717.106] (-720.637) * (-720.408) [-718.375] (-719.355) (-717.307) -- 0:00:43
      317000 -- (-714.921) (-715.417) (-719.472) [-716.242] * (-718.250) (-720.970) (-719.156) [-714.603] -- 0:00:43
      317500 -- (-714.583) (-718.504) (-727.711) [-714.907] * (-714.797) (-715.895) (-717.124) [-715.842] -- 0:00:42
      318000 -- (-714.945) (-717.078) (-716.512) [-716.122] * (-717.373) (-718.088) (-721.759) [-716.409] -- 0:00:42
      318500 -- (-715.793) (-716.568) (-714.745) [-717.126] * (-717.760) [-715.747] (-721.810) (-716.884) -- 0:00:42
      319000 -- (-716.242) [-715.423] (-717.746) (-717.354) * (-718.680) (-716.052) [-716.287] (-714.643) -- 0:00:42
      319500 -- (-720.628) (-715.603) [-715.264] (-715.184) * [-716.979] (-716.911) (-720.805) (-715.858) -- 0:00:42
      320000 -- (-720.370) [-715.612] (-715.283) (-715.057) * [-715.647] (-716.646) (-719.335) (-716.032) -- 0:00:42

      Average standard deviation of split frequencies: 0.008637

      320500 -- [-718.028] (-714.713) (-718.183) (-716.762) * [-715.278] (-714.448) (-719.017) (-715.598) -- 0:00:42
      321000 -- (-715.183) (-716.529) [-716.427] (-716.319) * [-715.791] (-718.030) (-716.025) (-715.849) -- 0:00:42
      321500 -- [-715.543] (-715.670) (-716.303) (-715.754) * (-716.850) (-717.869) [-717.933] (-714.904) -- 0:00:42
      322000 -- (-714.858) (-717.034) [-715.583] (-715.352) * (-715.088) [-719.459] (-716.365) (-717.764) -- 0:00:42
      322500 -- [-718.828] (-714.811) (-714.540) (-715.781) * (-715.826) (-718.364) [-716.494] (-716.262) -- 0:00:42
      323000 -- (-718.581) (-721.211) (-718.048) [-718.415] * (-716.837) (-714.363) (-714.858) [-718.366] -- 0:00:41
      323500 -- (-716.384) (-716.353) (-719.639) [-715.339] * (-715.741) [-714.402] (-716.418) (-715.200) -- 0:00:41
      324000 -- [-714.578] (-718.600) (-717.397) (-716.168) * (-716.825) (-715.309) (-716.478) [-716.137] -- 0:00:41
      324500 -- (-717.469) (-715.169) [-718.930] (-718.005) * [-716.539] (-714.999) (-715.906) (-718.205) -- 0:00:41
      325000 -- (-714.825) (-714.584) (-721.747) [-717.319] * (-714.397) [-716.171] (-716.346) (-714.389) -- 0:00:41

      Average standard deviation of split frequencies: 0.009272

      325500 -- (-717.697) [-716.746] (-715.725) (-716.551) * (-714.574) (-717.230) (-716.108) [-714.615] -- 0:00:41
      326000 -- (-719.666) [-717.273] (-715.934) (-719.355) * (-714.850) [-714.632] (-716.719) (-716.799) -- 0:00:41
      326500 -- [-715.953] (-721.760) (-720.208) (-714.962) * (-715.086) [-716.637] (-715.519) (-716.898) -- 0:00:41
      327000 -- [-718.786] (-717.554) (-717.677) (-714.344) * (-716.114) [-715.098] (-716.678) (-720.093) -- 0:00:41
      327500 -- (-715.734) [-715.415] (-718.512) (-715.223) * (-714.511) (-715.751) [-716.806] (-719.040) -- 0:00:41
      328000 -- (-718.780) (-716.656) (-715.949) [-715.460] * [-714.879] (-717.748) (-717.296) (-716.564) -- 0:00:40
      328500 -- [-714.959] (-716.662) (-716.399) (-715.605) * (-721.018) (-722.005) [-716.248] (-720.717) -- 0:00:40
      329000 -- [-725.747] (-715.469) (-717.230) (-718.574) * (-720.586) (-725.076) (-716.890) [-716.884] -- 0:00:40
      329500 -- (-726.723) (-715.286) [-718.121] (-717.580) * [-718.453] (-722.568) (-716.237) (-717.239) -- 0:00:40
      330000 -- (-721.885) (-715.692) (-715.800) [-716.146] * (-719.562) (-717.588) (-716.129) [-715.027] -- 0:00:40

      Average standard deviation of split frequencies: 0.009392

      330500 -- (-719.355) [-717.054] (-716.436) (-715.124) * (-716.874) (-715.411) [-716.514] (-715.388) -- 0:00:40
      331000 -- [-717.951] (-718.743) (-716.590) (-716.677) * (-721.282) (-716.790) (-715.734) [-716.667] -- 0:00:40
      331500 -- (-716.588) [-718.845] (-718.002) (-717.380) * [-716.325] (-716.255) (-716.443) (-718.427) -- 0:00:40
      332000 -- [-718.637] (-715.602) (-717.702) (-716.744) * (-716.135) (-720.129) [-716.983] (-716.761) -- 0:00:40
      332500 -- (-715.809) (-714.260) (-717.561) [-718.190] * (-716.652) (-718.055) [-720.935] (-717.383) -- 0:00:40
      333000 -- [-715.886] (-715.822) (-717.291) (-718.339) * (-718.700) (-717.790) (-719.973) [-715.315] -- 0:00:42
      333500 -- [-715.244] (-714.308) (-717.419) (-717.954) * [-718.672] (-716.590) (-717.287) (-717.131) -- 0:00:41
      334000 -- (-715.247) [-714.732] (-719.266) (-715.423) * [-716.053] (-718.305) (-716.168) (-716.399) -- 0:00:41
      334500 -- (-717.620) (-716.859) [-718.089] (-715.364) * [-716.163] (-719.465) (-715.121) (-717.896) -- 0:00:41
      335000 -- (-717.548) (-716.775) [-717.299] (-716.171) * (-721.846) (-718.135) (-715.615) [-716.896] -- 0:00:41

      Average standard deviation of split frequencies: 0.009909

      335500 -- [-716.169] (-716.151) (-714.908) (-715.791) * (-718.155) (-720.115) (-717.398) [-719.300] -- 0:00:41
      336000 -- (-715.770) (-720.079) [-715.312] (-721.535) * (-715.834) [-718.026] (-717.080) (-716.591) -- 0:00:41
      336500 -- (-716.899) (-717.228) (-717.371) [-717.284] * [-715.427] (-715.523) (-715.377) (-715.566) -- 0:00:41
      337000 -- [-718.973] (-718.104) (-717.607) (-717.141) * (-721.154) (-716.660) [-715.295] (-715.750) -- 0:00:41
      337500 -- [-716.655] (-715.946) (-716.333) (-717.275) * (-718.943) (-719.515) [-721.002] (-716.235) -- 0:00:41
      338000 -- (-717.672) (-715.660) [-716.374] (-716.445) * (-718.095) [-720.807] (-715.336) (-715.857) -- 0:00:41
      338500 -- (-716.747) [-717.221] (-716.727) (-715.454) * [-719.506] (-715.245) (-716.157) (-714.877) -- 0:00:41
      339000 -- (-718.128) [-718.802] (-719.897) (-718.125) * (-715.550) [-716.655] (-716.202) (-715.249) -- 0:00:40
      339500 -- (-715.505) (-715.831) (-716.060) [-714.638] * (-717.818) [-716.449] (-722.169) (-716.859) -- 0:00:40
      340000 -- [-715.525] (-716.790) (-717.292) (-717.654) * (-714.544) [-717.518] (-715.408) (-719.304) -- 0:00:40

      Average standard deviation of split frequencies: 0.009946

      340500 -- [-717.754] (-716.235) (-718.444) (-717.421) * [-715.104] (-718.073) (-715.998) (-715.832) -- 0:00:40
      341000 -- (-717.130) [-717.680] (-717.247) (-717.783) * (-715.797) [-715.283] (-718.677) (-716.514) -- 0:00:40
      341500 -- (-719.570) (-719.263) [-718.754] (-717.818) * (-720.841) (-720.311) [-718.472] (-715.144) -- 0:00:40
      342000 -- [-716.148] (-718.680) (-718.387) (-718.331) * (-714.970) (-717.637) (-719.460) [-720.109] -- 0:00:40
      342500 -- (-718.314) (-716.360) [-715.816] (-716.752) * [-720.398] (-718.530) (-720.741) (-716.114) -- 0:00:40
      343000 -- [-717.707] (-717.057) (-715.874) (-716.351) * (-715.263) (-716.974) (-715.528) [-718.121] -- 0:00:40
      343500 -- (-716.133) (-715.736) [-715.659] (-715.554) * [-716.786] (-721.248) (-718.955) (-717.644) -- 0:00:40
      344000 -- [-717.922] (-716.351) (-719.037) (-714.630) * (-714.853) [-720.169] (-715.427) (-716.616) -- 0:00:40
      344500 -- (-714.829) (-717.864) (-716.564) [-715.169] * (-714.853) (-716.974) [-714.799] (-721.173) -- 0:00:39
      345000 -- (-715.799) (-716.709) [-716.986] (-715.565) * (-721.240) (-716.907) (-714.683) [-720.209] -- 0:00:39

      Average standard deviation of split frequencies: 0.009537

      345500 -- (-717.148) [-715.850] (-715.543) (-716.137) * (-717.371) (-716.446) [-716.955] (-716.154) -- 0:00:39
      346000 -- (-720.228) (-715.047) (-719.935) [-720.150] * [-716.015] (-716.436) (-715.900) (-716.730) -- 0:00:39
      346500 -- (-716.404) [-715.740] (-715.881) (-718.697) * [-717.610] (-718.163) (-717.600) (-717.211) -- 0:00:39
      347000 -- (-718.327) (-717.113) (-719.543) [-719.293] * (-722.147) (-719.082) [-714.813] (-717.554) -- 0:00:39
      347500 -- (-717.326) [-716.551] (-715.356) (-716.503) * (-721.609) (-721.494) (-715.024) [-716.385] -- 0:00:39
      348000 -- (-718.895) (-715.378) (-715.265) [-719.343] * (-716.636) [-715.683] (-716.300) (-716.847) -- 0:00:39
      348500 -- [-719.521] (-715.591) (-716.467) (-717.371) * (-717.691) (-715.701) [-715.928] (-715.297) -- 0:00:39
      349000 -- (-715.814) (-716.502) (-716.600) [-718.579] * (-715.869) [-715.751] (-716.704) (-718.088) -- 0:00:41
      349500 -- (-717.027) (-716.032) [-717.195] (-717.718) * (-716.488) [-715.760] (-717.204) (-717.732) -- 0:00:40
      350000 -- (-718.304) (-716.485) [-719.157] (-718.614) * (-719.886) [-715.131] (-715.608) (-716.852) -- 0:00:40

      Average standard deviation of split frequencies: 0.009326

      350500 -- [-714.977] (-719.902) (-716.616) (-718.596) * [-718.267] (-717.267) (-717.930) (-715.588) -- 0:00:40
      351000 -- (-715.987) [-717.717] (-716.421) (-716.247) * (-718.904) (-718.955) (-718.998) [-716.996] -- 0:00:40
      351500 -- (-721.494) (-716.806) [-719.312] (-715.636) * (-716.516) [-716.107] (-715.708) (-714.642) -- 0:00:40
      352000 -- (-715.717) [-717.903] (-716.916) (-715.203) * (-716.236) (-719.364) (-715.460) [-714.827] -- 0:00:40
      352500 -- [-715.012] (-715.510) (-714.675) (-715.384) * (-720.942) [-722.761] (-716.665) (-715.464) -- 0:00:40
      353000 -- (-716.028) (-716.456) [-715.202] (-715.983) * (-717.593) (-714.705) (-716.446) [-714.664] -- 0:00:40
      353500 -- (-715.687) [-715.779] (-715.639) (-717.393) * (-723.499) (-714.852) (-715.896) [-717.406] -- 0:00:40
      354000 -- [-715.176] (-720.689) (-718.277) (-719.863) * (-716.598) [-716.298] (-716.571) (-718.828) -- 0:00:40
      354500 -- [-716.299] (-716.914) (-717.817) (-716.451) * [-716.620] (-717.000) (-715.418) (-717.512) -- 0:00:40
      355000 -- (-717.543) [-716.485] (-714.996) (-719.522) * [-716.466] (-717.898) (-715.438) (-721.244) -- 0:00:39

      Average standard deviation of split frequencies: 0.009186

      355500 -- [-718.899] (-716.712) (-714.826) (-718.863) * (-715.100) [-717.604] (-718.119) (-717.670) -- 0:00:39
      356000 -- (-716.290) (-715.029) (-716.700) [-715.387] * [-714.990] (-716.963) (-716.369) (-716.151) -- 0:00:39
      356500 -- [-716.508] (-716.324) (-717.980) (-716.947) * (-715.488) (-714.721) [-715.229] (-715.987) -- 0:00:39
      357000 -- [-716.009] (-718.882) (-714.950) (-718.751) * (-714.960) (-716.875) [-715.118] (-717.889) -- 0:00:39
      357500 -- [-718.459] (-717.470) (-715.900) (-716.505) * (-715.747) (-715.582) [-715.159] (-717.847) -- 0:00:39
      358000 -- [-716.677] (-720.527) (-715.109) (-715.507) * (-715.890) (-717.537) [-714.273] (-715.585) -- 0:00:39
      358500 -- (-715.874) (-715.591) (-717.665) [-718.271] * (-715.661) [-718.957] (-714.414) (-716.564) -- 0:00:39
      359000 -- (-716.600) [-717.780] (-715.692) (-715.944) * (-715.614) (-717.700) (-716.032) [-718.083] -- 0:00:39
      359500 -- (-716.633) (-714.653) (-717.211) [-715.186] * (-717.943) (-717.442) (-720.382) [-714.668] -- 0:00:39
      360000 -- (-717.170) [-717.181] (-720.507) (-715.926) * [-716.112] (-716.931) (-716.131) (-716.826) -- 0:00:39

      Average standard deviation of split frequencies: 0.009231

      360500 -- (-719.263) (-718.652) [-716.923] (-716.106) * (-717.028) (-715.836) [-715.109] (-721.090) -- 0:00:39
      361000 -- (-716.736) [-717.374] (-716.845) (-715.876) * [-715.092] (-715.760) (-719.115) (-719.040) -- 0:00:38
      361500 -- (-714.930) [-714.741] (-716.355) (-725.857) * (-716.201) [-717.498] (-717.979) (-716.120) -- 0:00:38
      362000 -- [-715.148] (-715.730) (-716.268) (-724.472) * (-717.068) (-718.189) [-720.259] (-717.239) -- 0:00:38
      362500 -- (-719.234) (-716.741) [-716.953] (-725.632) * (-719.088) [-718.937] (-717.298) (-718.633) -- 0:00:38
      363000 -- (-716.149) (-716.804) (-717.277) [-719.437] * (-714.526) (-717.940) [-717.294] (-716.182) -- 0:00:38
      363500 -- (-715.165) [-717.424] (-714.962) (-716.050) * (-717.834) (-718.691) [-715.963] (-715.044) -- 0:00:38
      364000 -- (-716.281) (-716.053) [-716.387] (-716.283) * [-717.684] (-718.818) (-718.101) (-717.137) -- 0:00:38
      364500 -- (-716.161) (-720.779) [-716.175] (-716.224) * (-716.622) (-718.244) (-715.010) [-717.034] -- 0:00:38
      365000 -- (-718.041) [-716.448] (-716.702) (-717.467) * (-715.879) (-717.805) [-715.018] (-716.490) -- 0:00:38

      Average standard deviation of split frequencies: 0.009257

      365500 -- (-719.220) (-718.040) [-715.441] (-719.332) * (-718.144) [-715.421] (-714.343) (-717.371) -- 0:00:39
      366000 -- (-716.640) (-715.112) [-714.791] (-715.881) * (-715.530) (-715.011) (-718.570) [-715.106] -- 0:00:39
      366500 -- (-716.405) (-717.501) (-716.129) [-717.108] * (-715.299) (-715.045) [-717.329] (-715.459) -- 0:00:39
      367000 -- (-715.209) (-717.486) (-716.466) [-717.405] * [-718.095] (-716.016) (-715.700) (-715.408) -- 0:00:39
      367500 -- [-716.167] (-716.051) (-717.769) (-717.427) * (-717.106) (-716.568) (-715.109) [-715.549] -- 0:00:39
      368000 -- (-716.544) (-718.216) [-715.529] (-721.686) * (-715.803) (-717.364) [-715.727] (-717.125) -- 0:00:39
      368500 -- (-717.777) (-714.800) (-722.134) [-716.534] * [-716.688] (-716.993) (-714.383) (-718.199) -- 0:00:39
      369000 -- (-718.877) (-718.962) (-719.452) [-716.431] * (-723.397) [-714.806] (-716.263) (-719.114) -- 0:00:39
      369500 -- [-716.287] (-717.406) (-715.283) (-719.482) * (-717.107) (-717.857) [-716.448] (-716.475) -- 0:00:39
      370000 -- (-717.904) (-717.947) [-715.134] (-715.875) * (-715.690) [-717.756] (-717.164) (-717.821) -- 0:00:39

      Average standard deviation of split frequencies: 0.009459

      370500 -- (-714.614) [-719.271] (-715.190) (-716.092) * [-714.993] (-717.726) (-718.227) (-720.696) -- 0:00:39
      371000 -- (-716.074) [-716.322] (-715.931) (-716.343) * (-717.266) (-714.514) (-720.033) [-716.012] -- 0:00:38
      371500 -- (-717.970) (-716.745) (-714.316) [-715.579] * (-717.600) (-718.766) [-718.843] (-717.551) -- 0:00:38
      372000 -- (-718.293) (-717.479) (-717.952) [-714.839] * (-716.163) (-717.847) (-717.526) [-716.198] -- 0:00:38
      372500 -- (-715.268) (-714.498) [-719.956] (-716.809) * (-716.088) (-720.969) (-715.695) [-716.036] -- 0:00:38
      373000 -- (-718.032) (-716.829) (-716.175) [-716.162] * [-715.790] (-721.074) (-717.187) (-718.033) -- 0:00:38
      373500 -- [-714.879] (-715.190) (-717.268) (-716.964) * (-722.420) (-716.764) (-715.239) [-717.043] -- 0:00:38
      374000 -- (-716.008) [-716.080] (-714.335) (-715.209) * (-715.700) [-715.795] (-719.426) (-730.159) -- 0:00:38
      374500 -- (-715.694) [-716.075] (-715.130) (-717.700) * (-717.305) (-717.555) (-719.668) [-721.622] -- 0:00:38
      375000 -- (-722.484) (-719.836) [-716.723] (-715.328) * (-719.642) (-721.989) [-717.380] (-716.384) -- 0:00:38

      Average standard deviation of split frequencies: 0.009168

      375500 -- (-714.743) [-715.271] (-716.083) (-717.483) * (-717.601) (-719.745) [-716.862] (-721.596) -- 0:00:38
      376000 -- (-716.611) [-717.281] (-714.828) (-715.455) * (-718.841) [-716.276] (-717.156) (-715.057) -- 0:00:38
      376500 -- (-717.191) (-721.204) [-719.053] (-719.941) * (-718.891) [-714.745] (-715.936) (-714.929) -- 0:00:38
      377000 -- (-716.614) [-716.499] (-718.785) (-723.032) * (-716.437) [-716.092] (-716.338) (-715.051) -- 0:00:38
      377500 -- (-719.732) [-715.492] (-716.344) (-715.920) * (-718.205) (-715.032) [-718.051] (-716.011) -- 0:00:37
      378000 -- (-718.778) (-717.453) (-718.836) [-715.661] * [-717.911] (-716.495) (-715.769) (-714.381) -- 0:00:37
      378500 -- (-716.849) [-716.483] (-717.833) (-716.698) * (-717.304) (-717.982) (-715.438) [-715.803] -- 0:00:37
      379000 -- (-716.665) [-715.967] (-714.637) (-716.802) * (-715.527) (-716.201) [-715.403] (-714.439) -- 0:00:37
      379500 -- (-719.190) [-715.223] (-715.225) (-720.329) * (-718.280) (-719.495) (-716.051) [-715.487] -- 0:00:37
      380000 -- (-719.208) (-715.532) (-719.442) [-715.758] * [-718.853] (-718.105) (-717.698) (-716.273) -- 0:00:37

      Average standard deviation of split frequencies: 0.009288

      380500 -- (-717.268) (-719.542) (-714.894) [-716.712] * (-714.824) (-714.449) (-719.212) [-716.268] -- 0:00:37
      381000 -- [-718.067] (-717.585) (-716.702) (-715.497) * (-715.734) [-716.650] (-716.227) (-715.367) -- 0:00:37
      381500 -- [-716.237] (-721.182) (-717.789) (-718.752) * (-717.226) [-714.548] (-715.422) (-719.869) -- 0:00:37
      382000 -- [-716.238] (-716.951) (-715.434) (-715.128) * (-715.359) [-716.573] (-716.294) (-715.433) -- 0:00:38
      382500 -- (-716.021) [-716.597] (-716.665) (-715.677) * (-717.579) (-715.862) [-716.746] (-714.908) -- 0:00:38
      383000 -- (-718.748) [-714.479] (-716.600) (-714.752) * (-715.461) [-714.807] (-717.039) (-714.404) -- 0:00:38
      383500 -- (-716.624) (-718.621) [-716.228] (-718.047) * [-714.715] (-717.615) (-715.962) (-716.672) -- 0:00:38
      384000 -- (-717.039) (-716.257) [-715.847] (-719.316) * (-715.896) (-718.800) (-719.851) [-715.758] -- 0:00:38
      384500 -- [-715.972] (-714.839) (-715.622) (-727.459) * [-717.913] (-719.158) (-719.067) (-720.082) -- 0:00:38
      385000 -- (-718.397) [-714.629] (-715.012) (-720.021) * (-718.303) (-715.750) (-715.845) [-714.731] -- 0:00:38

      Average standard deviation of split frequencies: 0.009541

      385500 -- (-716.858) (-719.349) [-716.365] (-719.046) * [-717.919] (-719.952) (-716.335) (-716.309) -- 0:00:38
      386000 -- (-716.350) [-717.800] (-717.362) (-718.709) * (-719.156) (-718.229) [-715.289] (-715.470) -- 0:00:38
      386500 -- (-716.956) (-716.588) (-716.660) [-718.996] * (-714.596) [-716.951] (-721.792) (-718.001) -- 0:00:38
      387000 -- (-717.031) [-715.051] (-714.818) (-716.694) * (-714.501) (-716.490) [-714.417] (-717.531) -- 0:00:38
      387500 -- (-717.720) (-715.192) [-715.518] (-716.292) * (-715.637) [-714.643] (-714.894) (-716.206) -- 0:00:37
      388000 -- (-716.751) (-715.172) (-716.573) [-716.456] * (-718.123) (-715.134) (-714.660) [-715.186] -- 0:00:37
      388500 -- (-716.199) (-719.007) (-715.393) [-715.656] * (-715.607) (-717.830) [-716.143] (-717.610) -- 0:00:37
      389000 -- (-716.008) [-716.899] (-717.484) (-716.190) * (-714.191) (-719.826) (-717.284) [-718.292] -- 0:00:37
      389500 -- [-715.019] (-724.309) (-716.532) (-718.452) * (-719.216) (-715.246) (-724.146) [-715.644] -- 0:00:37
      390000 -- (-715.966) (-716.322) [-715.156] (-721.214) * (-718.840) (-715.625) (-715.612) [-716.312] -- 0:00:37

      Average standard deviation of split frequencies: 0.009276

      390500 -- [-716.624] (-715.906) (-722.096) (-715.809) * (-716.054) [-717.454] (-726.117) (-714.782) -- 0:00:37
      391000 -- (-716.972) [-717.012] (-716.296) (-719.024) * (-715.710) (-717.344) (-714.566) [-716.384] -- 0:00:37
      391500 -- (-715.693) (-718.373) [-716.178] (-716.175) * (-716.010) (-718.949) (-715.220) [-715.046] -- 0:00:37
      392000 -- [-715.168] (-717.786) (-720.015) (-720.371) * [-715.924] (-715.283) (-717.753) (-716.102) -- 0:00:37
      392500 -- (-717.282) [-716.732] (-714.964) (-718.191) * (-715.883) (-717.017) [-717.106] (-716.845) -- 0:00:37
      393000 -- (-717.638) (-717.884) [-717.595] (-720.255) * (-718.784) (-717.381) [-720.683] (-717.193) -- 0:00:37
      393500 -- [-717.806] (-714.289) (-715.555) (-718.148) * [-716.790] (-720.784) (-723.608) (-717.647) -- 0:00:36
      394000 -- (-718.821) [-716.632] (-720.097) (-717.133) * (-719.194) (-719.065) [-717.078] (-719.898) -- 0:00:36
      394500 -- [-715.406] (-718.142) (-719.710) (-716.394) * [-715.540] (-718.097) (-716.802) (-718.797) -- 0:00:36
      395000 -- (-715.315) [-715.729] (-720.318) (-718.296) * (-716.085) (-714.549) (-715.368) [-715.721] -- 0:00:36

      Average standard deviation of split frequencies: 0.009821

      395500 -- (-717.861) [-715.298] (-716.039) (-716.134) * [-716.863] (-716.143) (-716.351) (-716.665) -- 0:00:36
      396000 -- (-717.214) [-717.980] (-717.587) (-716.156) * [-722.966] (-718.191) (-715.550) (-719.539) -- 0:00:36
      396500 -- (-716.643) (-716.134) [-718.415] (-721.858) * (-715.537) (-715.495) [-715.944] (-715.627) -- 0:00:36
      397000 -- (-716.775) [-715.435] (-717.276) (-716.852) * (-715.361) (-717.475) [-716.842] (-715.487) -- 0:00:36
      397500 -- [-715.699] (-714.838) (-716.237) (-716.313) * (-718.870) [-717.120] (-715.723) (-717.466) -- 0:00:37
      398000 -- (-715.968) (-715.199) (-715.985) [-717.660] * (-720.159) [-719.828] (-715.630) (-718.347) -- 0:00:37
      398500 -- [-715.956] (-716.453) (-715.450) (-716.833) * (-718.203) (-720.431) (-715.643) [-715.452] -- 0:00:37
      399000 -- (-718.797) [-717.704] (-717.796) (-715.690) * (-714.863) [-720.303] (-717.606) (-715.912) -- 0:00:37
      399500 -- (-720.123) (-717.191) [-716.390] (-720.850) * (-715.436) (-715.559) [-716.946] (-716.479) -- 0:00:37
      400000 -- [-715.347] (-718.525) (-717.084) (-721.745) * [-715.872] (-717.951) (-715.187) (-719.216) -- 0:00:37

      Average standard deviation of split frequencies: 0.009265

      400500 -- (-717.060) [-714.934] (-715.172) (-720.316) * [-718.737] (-717.628) (-720.199) (-716.451) -- 0:00:37
      401000 -- (-717.427) (-716.485) (-716.230) [-720.679] * (-718.663) [-716.422] (-719.390) (-718.005) -- 0:00:37
      401500 -- [-715.650] (-717.816) (-717.862) (-717.997) * (-716.265) [-719.951] (-716.836) (-716.671) -- 0:00:37
      402000 -- (-716.449) (-718.552) [-719.894] (-716.913) * (-715.547) (-716.340) [-715.736] (-717.485) -- 0:00:37
      402500 -- (-718.517) [-716.454] (-715.143) (-717.547) * (-715.486) (-716.893) (-715.339) [-718.616] -- 0:00:37
      403000 -- (-719.921) [-715.385] (-717.140) (-724.062) * (-714.288) (-716.833) (-714.617) [-721.912] -- 0:00:37
      403500 -- (-719.188) [-715.511] (-718.237) (-719.625) * (-715.349) (-715.836) [-717.520] (-715.558) -- 0:00:36
      404000 -- (-715.913) (-715.754) [-718.433] (-719.372) * (-715.503) (-716.104) (-717.944) [-715.523] -- 0:00:36
      404500 -- (-715.750) (-718.206) (-716.704) [-715.877] * (-719.054) (-715.519) [-716.001] (-721.384) -- 0:00:36
      405000 -- [-715.454] (-719.486) (-716.251) (-717.659) * (-718.741) (-717.188) (-715.877) [-720.951] -- 0:00:36

      Average standard deviation of split frequencies: 0.009652

      405500 -- [-716.819] (-718.543) (-716.718) (-720.128) * (-715.858) (-719.822) [-717.170] (-719.288) -- 0:00:36
      406000 -- (-714.588) (-716.270) (-716.957) [-716.172] * (-716.984) [-717.490] (-716.178) (-716.078) -- 0:00:36
      406500 -- [-716.911] (-715.929) (-718.572) (-718.914) * (-717.752) (-717.194) [-717.361] (-715.861) -- 0:00:36
      407000 -- (-721.991) [-715.733] (-716.957) (-715.666) * (-716.971) [-715.557] (-719.163) (-715.410) -- 0:00:36
      407500 -- (-718.321) [-715.484] (-719.790) (-716.423) * (-719.637) (-720.855) [-719.380] (-720.699) -- 0:00:36
      408000 -- (-715.622) (-718.410) [-716.374] (-717.282) * (-717.038) [-715.757] (-717.603) (-719.177) -- 0:00:36
      408500 -- (-718.448) [-719.838] (-718.186) (-715.356) * (-718.588) (-716.955) [-715.004] (-716.664) -- 0:00:36
      409000 -- [-719.023] (-716.020) (-715.761) (-715.268) * [-716.435] (-716.985) (-715.515) (-718.330) -- 0:00:36
      409500 -- (-717.188) [-715.291] (-715.335) (-718.080) * [-715.929] (-716.568) (-715.798) (-716.547) -- 0:00:36
      410000 -- (-718.282) (-715.529) (-716.802) [-716.290] * (-715.943) [-715.496] (-716.873) (-716.939) -- 0:00:35

      Average standard deviation of split frequencies: 0.009614

      410500 -- (-717.409) (-715.236) [-716.559] (-716.159) * [-715.404] (-716.148) (-717.800) (-720.296) -- 0:00:35
      411000 -- [-718.533] (-715.471) (-715.827) (-716.174) * (-721.414) (-718.044) [-717.304] (-714.660) -- 0:00:35
      411500 -- (-718.323) [-714.834] (-715.121) (-716.231) * (-716.707) (-718.433) (-714.917) [-719.102] -- 0:00:35
      412000 -- (-715.828) (-717.612) [-714.815] (-716.373) * (-718.634) [-719.057] (-718.556) (-721.538) -- 0:00:35
      412500 -- [-715.418] (-718.789) (-718.608) (-715.489) * (-715.930) (-715.231) [-717.291] (-717.584) -- 0:00:35
      413000 -- (-716.677) (-716.754) [-716.338] (-714.295) * (-716.594) (-714.955) (-717.036) [-715.049] -- 0:00:35
      413500 -- (-714.722) [-715.497] (-715.697) (-715.995) * (-716.695) (-716.209) (-717.206) [-715.734] -- 0:00:35
      414000 -- [-715.846] (-718.272) (-716.896) (-714.908) * (-717.781) (-722.658) [-717.774] (-715.004) -- 0:00:35
      414500 -- (-717.280) [-715.755] (-718.588) (-717.027) * (-718.478) [-722.611] (-715.440) (-714.800) -- 0:00:36
      415000 -- (-716.022) [-715.264] (-716.481) (-716.875) * (-716.147) (-715.861) (-715.011) [-718.306] -- 0:00:36

      Average standard deviation of split frequencies: 0.009349

      415500 -- (-719.620) (-717.090) (-714.811) [-722.751] * [-714.843] (-715.309) (-716.693) (-716.066) -- 0:00:36
      416000 -- (-716.621) [-718.737] (-717.414) (-716.772) * (-716.266) [-715.132] (-717.407) (-717.645) -- 0:00:36
      416500 -- (-715.819) (-716.103) (-715.755) [-715.195] * [-722.380] (-714.824) (-715.870) (-715.866) -- 0:00:36
      417000 -- (-715.132) [-718.482] (-714.929) (-717.954) * (-715.939) (-716.344) [-716.027] (-716.194) -- 0:00:36
      417500 -- [-715.734] (-718.109) (-717.469) (-716.641) * (-715.046) [-716.304] (-715.942) (-715.725) -- 0:00:36
      418000 -- (-717.734) (-719.529) (-719.402) [-717.278] * (-717.787) (-714.893) (-715.035) [-715.337] -- 0:00:36
      418500 -- (-716.147) (-716.535) (-716.336) [-715.315] * (-716.050) (-716.886) (-716.119) [-714.650] -- 0:00:36
      419000 -- (-715.923) (-717.892) (-719.242) [-715.005] * (-715.507) (-716.214) (-716.580) [-715.032] -- 0:00:36
      419500 -- (-714.890) [-714.696] (-715.816) (-714.897) * (-715.565) (-714.475) [-715.095] (-715.267) -- 0:00:35
      420000 -- (-716.642) [-717.226] (-715.469) (-714.892) * (-715.520) [-719.069] (-717.331) (-715.129) -- 0:00:35

      Average standard deviation of split frequencies: 0.009385

      420500 -- [-715.763] (-717.447) (-720.164) (-716.100) * [-714.494] (-714.668) (-715.869) (-716.086) -- 0:00:35
      421000 -- (-714.533) (-715.294) (-718.302) [-715.697] * (-716.870) [-714.908] (-717.661) (-720.354) -- 0:00:35
      421500 -- (-716.338) [-716.861] (-720.426) (-715.300) * [-716.602] (-716.250) (-714.670) (-717.363) -- 0:00:35
      422000 -- (-717.209) (-715.611) [-715.642] (-719.195) * [-717.474] (-718.495) (-715.364) (-719.535) -- 0:00:35
      422500 -- (-717.221) [-715.141] (-717.329) (-716.128) * (-722.079) (-715.741) (-715.477) [-717.896] -- 0:00:35
      423000 -- (-716.086) (-721.556) (-717.263) [-716.110] * [-719.313] (-717.022) (-714.548) (-715.707) -- 0:00:35
      423500 -- [-716.827] (-719.204) (-716.266) (-714.732) * [-715.139] (-717.146) (-714.999) (-715.682) -- 0:00:35
      424000 -- (-716.207) [-718.588] (-717.718) (-718.939) * (-714.917) (-719.828) [-714.988] (-716.638) -- 0:00:35
      424500 -- (-718.019) (-719.281) [-718.040] (-714.568) * (-717.671) (-717.110) (-717.414) [-716.445] -- 0:00:35
      425000 -- [-715.764] (-721.787) (-715.074) (-717.607) * (-717.105) (-717.450) [-715.523] (-715.245) -- 0:00:35

      Average standard deviation of split frequencies: 0.008576

      425500 -- (-715.199) (-718.554) (-715.069) [-715.956] * (-721.091) [-717.547] (-715.906) (-714.647) -- 0:00:35
      426000 -- [-717.146] (-719.120) (-714.407) (-716.160) * (-718.270) [-714.985] (-715.559) (-716.195) -- 0:00:35
      426500 -- (-714.616) (-714.802) [-719.556] (-718.436) * (-718.106) (-717.457) (-715.212) [-716.007] -- 0:00:34
      427000 -- (-716.269) (-716.285) (-717.537) [-716.616] * (-717.556) (-719.924) (-717.391) [-716.334] -- 0:00:34
      427500 -- (-718.496) (-714.982) (-716.195) [-714.751] * (-717.794) (-716.217) (-717.886) [-719.499] -- 0:00:34
      428000 -- (-715.395) (-716.152) [-718.703] (-715.235) * (-716.770) (-715.840) (-721.507) [-720.858] -- 0:00:34
      428500 -- (-716.876) [-715.454] (-716.948) (-716.238) * (-715.790) (-717.049) [-715.690] (-717.132) -- 0:00:34
      429000 -- (-715.916) (-716.701) (-717.886) [-716.546] * [-717.110] (-716.283) (-716.159) (-714.425) -- 0:00:34
      429500 -- (-715.831) (-715.157) (-715.800) [-717.417] * (-714.971) (-716.366) [-715.846] (-716.809) -- 0:00:34
      430000 -- [-715.185] (-717.208) (-716.622) (-718.396) * (-717.874) (-714.659) [-715.435] (-715.906) -- 0:00:34

      Average standard deviation of split frequencies: 0.008894

      430500 -- [-715.333] (-717.715) (-717.076) (-717.094) * [-716.895] (-715.770) (-714.504) (-715.433) -- 0:00:34
      431000 -- [-715.719] (-716.598) (-727.667) (-719.843) * [-715.539] (-717.745) (-715.758) (-715.424) -- 0:00:35
      431500 -- [-715.263] (-716.779) (-716.771) (-715.681) * (-715.772) (-718.394) [-715.387] (-717.822) -- 0:00:35
      432000 -- (-718.439) (-717.153) (-718.981) [-716.460] * (-716.329) [-715.368] (-720.990) (-720.560) -- 0:00:35
      432500 -- [-716.631] (-714.764) (-714.683) (-716.679) * (-715.212) [-716.321] (-716.865) (-717.502) -- 0:00:35
      433000 -- (-715.585) (-715.487) (-718.567) [-716.383] * (-716.392) (-715.283) (-716.140) [-719.613] -- 0:00:35
      433500 -- (-714.722) (-717.198) [-715.563] (-716.493) * [-714.696] (-717.077) (-715.781) (-715.568) -- 0:00:35
      434000 -- (-717.815) [-714.385] (-714.935) (-717.373) * (-716.465) (-715.788) (-716.236) [-714.243] -- 0:00:35
      434500 -- [-717.100] (-715.816) (-718.447) (-716.743) * (-714.862) (-715.603) (-716.618) [-716.498] -- 0:00:35
      435000 -- (-716.020) (-714.357) [-718.639] (-715.782) * [-715.707] (-716.932) (-720.481) (-719.206) -- 0:00:35

      Average standard deviation of split frequencies: 0.008785

      435500 -- [-718.810] (-716.474) (-718.981) (-716.041) * [-714.734] (-715.803) (-719.145) (-717.199) -- 0:00:34
      436000 -- [-716.991] (-714.766) (-718.331) (-716.221) * [-714.690] (-714.673) (-718.728) (-718.458) -- 0:00:34
      436500 -- [-718.040] (-718.178) (-716.506) (-714.870) * (-719.005) [-714.667] (-714.647) (-718.200) -- 0:00:34
      437000 -- (-717.378) (-714.324) [-714.791] (-715.801) * (-717.386) [-718.693] (-715.349) (-716.071) -- 0:00:34
      437500 -- (-717.595) (-715.276) (-715.155) [-714.792] * (-717.357) (-715.317) (-719.587) [-717.007] -- 0:00:34
      438000 -- (-720.598) (-715.306) (-717.381) [-716.200] * (-716.960) [-718.528] (-715.653) (-716.378) -- 0:00:34
      438500 -- (-718.270) [-715.085] (-717.377) (-716.596) * [-715.397] (-714.373) (-716.915) (-716.622) -- 0:00:34
      439000 -- (-719.973) (-715.621) [-716.576] (-715.551) * [-716.441] (-714.896) (-721.350) (-715.858) -- 0:00:34
      439500 -- [-718.204] (-716.469) (-714.987) (-724.547) * (-716.813) [-715.484] (-716.262) (-716.765) -- 0:00:34
      440000 -- (-718.041) (-716.052) [-715.723] (-718.179) * (-714.577) [-715.879] (-716.520) (-718.956) -- 0:00:34

      Average standard deviation of split frequencies: 0.008424

      440500 -- [-716.623] (-715.746) (-718.951) (-716.356) * (-714.855) (-717.647) (-717.985) [-718.186] -- 0:00:34
      441000 -- (-714.718) (-716.708) (-720.149) [-717.008] * (-716.591) (-717.482) (-717.238) [-722.653] -- 0:00:34
      441500 -- [-718.814] (-715.497) (-714.993) (-716.040) * [-717.009] (-718.017) (-715.320) (-719.114) -- 0:00:34
      442000 -- (-716.535) (-714.594) (-714.493) [-718.054] * [-717.994] (-719.434) (-714.491) (-719.205) -- 0:00:34
      442500 -- [-714.374] (-716.755) (-714.343) (-718.795) * (-716.952) (-718.115) [-715.931] (-719.463) -- 0:00:34
      443000 -- (-716.508) (-720.738) (-718.089) [-715.187] * [-717.367] (-715.799) (-718.179) (-723.470) -- 0:00:33
      443500 -- (-716.476) [-717.058] (-718.673) (-717.708) * (-723.305) [-721.716] (-717.809) (-721.153) -- 0:00:33
      444000 -- (-716.364) (-716.980) [-716.404] (-716.760) * (-720.456) (-714.790) (-714.534) [-717.231] -- 0:00:33
      444500 -- [-714.981] (-714.878) (-714.260) (-715.106) * [-716.958] (-714.867) (-714.350) (-715.144) -- 0:00:33
      445000 -- (-715.105) (-715.189) (-717.714) [-714.719] * (-716.642) [-716.470] (-717.085) (-715.958) -- 0:00:33

      Average standard deviation of split frequencies: 0.008456

      445500 -- (-715.588) (-718.199) (-715.158) [-718.618] * [-715.218] (-719.207) (-715.974) (-715.963) -- 0:00:33
      446000 -- [-717.385] (-718.648) (-719.777) (-716.168) * [-719.978] (-718.712) (-716.912) (-719.295) -- 0:00:33
      446500 -- (-716.984) (-718.457) (-715.977) [-714.954] * [-718.562] (-715.752) (-717.123) (-717.094) -- 0:00:33
      447000 -- (-718.224) (-714.452) (-719.008) [-714.912] * (-717.971) [-718.191] (-717.828) (-715.249) -- 0:00:33
      447500 -- (-718.247) (-714.543) (-717.651) [-716.674] * (-720.967) [-717.626] (-719.502) (-715.562) -- 0:00:34
      448000 -- [-716.942] (-715.901) (-717.017) (-717.738) * (-716.961) (-720.831) (-716.313) [-718.414] -- 0:00:34
      448500 -- (-715.353) [-716.100] (-716.104) (-715.694) * (-715.014) (-716.346) [-717.217] (-717.118) -- 0:00:34
      449000 -- (-716.205) [-716.453] (-716.339) (-716.189) * [-714.874] (-717.469) (-714.517) (-715.056) -- 0:00:34
      449500 -- (-716.419) (-717.231) (-715.612) [-717.959] * [-715.026] (-715.419) (-718.650) (-719.175) -- 0:00:34
      450000 -- (-715.708) [-714.667] (-718.558) (-715.368) * (-716.040) [-717.404] (-717.528) (-718.973) -- 0:00:34

      Average standard deviation of split frequencies: 0.008826

      450500 -- (-715.322) (-715.489) (-716.385) [-718.734] * (-716.176) (-716.842) [-715.213] (-715.437) -- 0:00:34
      451000 -- [-715.804] (-717.347) (-717.701) (-716.397) * (-716.010) [-715.886] (-718.593) (-719.415) -- 0:00:34
      451500 -- (-717.179) [-715.131] (-719.520) (-718.869) * [-716.354] (-717.773) (-714.898) (-715.711) -- 0:00:34
      452000 -- (-717.044) (-714.752) [-723.595] (-718.241) * (-716.050) (-717.593) (-716.739) [-715.414] -- 0:00:33
      452500 -- (-717.183) (-720.019) (-716.448) [-716.194] * (-717.048) [-718.091] (-717.711) (-717.728) -- 0:00:33
      453000 -- [-714.845] (-720.183) (-718.621) (-716.386) * (-715.558) (-717.812) (-718.862) [-716.447] -- 0:00:33
      453500 -- (-714.845) [-717.045] (-722.890) (-716.040) * (-715.932) (-717.205) (-720.400) [-716.118] -- 0:00:33
      454000 -- (-715.477) (-717.794) (-716.259) [-717.336] * (-716.287) [-715.861] (-722.792) (-714.982) -- 0:00:33
      454500 -- (-719.087) (-715.460) (-721.171) [-715.866] * (-716.857) (-714.885) (-715.875) [-719.537] -- 0:00:33
      455000 -- [-714.661] (-719.459) (-720.259) (-719.217) * [-715.508] (-722.166) (-717.394) (-719.879) -- 0:00:33

      Average standard deviation of split frequencies: 0.008852

      455500 -- (-714.728) (-719.752) (-717.116) [-717.953] * (-716.108) (-715.098) (-716.010) [-716.438] -- 0:00:33
      456000 -- (-719.743) (-716.319) (-720.606) [-722.674] * (-718.561) (-717.916) (-717.153) [-716.167] -- 0:00:33
      456500 -- (-717.803) (-717.873) (-717.279) [-716.529] * [-716.998] (-715.289) (-720.035) (-716.142) -- 0:00:33
      457000 -- (-715.039) [-716.303] (-718.255) (-715.268) * (-715.319) [-716.096] (-721.397) (-715.110) -- 0:00:33
      457500 -- (-716.524) (-716.834) (-715.512) [-717.405] * (-714.939) (-714.830) (-718.070) [-715.757] -- 0:00:33
      458000 -- (-715.102) (-722.943) [-714.604] (-717.020) * (-718.146) (-714.784) (-715.466) [-716.875] -- 0:00:33
      458500 -- (-717.063) [-716.668] (-717.630) (-715.818) * (-718.361) (-717.583) (-719.128) [-716.367] -- 0:00:33
      459000 -- [-715.349] (-720.631) (-717.914) (-715.530) * [-716.513] (-716.497) (-718.457) (-714.761) -- 0:00:33
      459500 -- [-716.296] (-717.824) (-718.442) (-715.351) * (-717.261) (-720.500) (-716.682) [-715.059] -- 0:00:32
      460000 -- (-714.543) (-717.180) (-719.475) [-719.548] * (-720.514) (-717.114) [-717.903] (-716.372) -- 0:00:32

      Average standard deviation of split frequencies: 0.009402

      460500 -- [-716.278] (-720.367) (-719.876) (-715.569) * (-716.309) (-718.293) (-717.282) [-716.515] -- 0:00:32
      461000 -- (-715.169) [-718.943] (-716.739) (-716.656) * [-715.123] (-718.682) (-717.994) (-715.487) -- 0:00:32
      461500 -- (-716.381) [-716.663] (-717.489) (-716.818) * [-715.797] (-716.612) (-716.358) (-717.245) -- 0:00:32
      462000 -- [-715.452] (-719.841) (-715.731) (-717.443) * (-716.873) (-721.026) (-716.226) [-716.208] -- 0:00:32
      462500 -- (-720.021) (-715.542) [-715.972] (-717.896) * (-715.868) (-717.487) [-716.256] (-721.314) -- 0:00:32
      463000 -- (-715.442) [-714.312] (-715.550) (-715.103) * (-717.895) (-721.327) (-719.313) [-716.742] -- 0:00:32
      463500 -- (-715.507) (-717.064) (-719.754) [-716.314] * (-720.252) (-717.702) (-719.827) [-714.787] -- 0:00:32
      464000 -- (-715.210) (-719.015) (-716.175) [-723.022] * (-719.007) (-718.069) [-715.283] (-717.328) -- 0:00:32
      464500 -- (-715.935) [-715.607] (-715.226) (-719.430) * (-717.089) (-718.983) [-717.366] (-715.242) -- 0:00:33
      465000 -- (-718.729) (-715.352) [-716.046] (-719.081) * (-719.939) (-717.136) [-718.777] (-715.754) -- 0:00:33

      Average standard deviation of split frequencies: 0.009357

      465500 -- (-714.576) [-716.299] (-717.545) (-718.194) * (-720.407) (-717.218) [-716.666] (-716.898) -- 0:00:33
      466000 -- [-714.999] (-719.372) (-716.176) (-715.519) * (-718.820) [-716.779] (-716.183) (-716.307) -- 0:00:33
      466500 -- (-714.469) [-716.530] (-719.860) (-716.861) * (-717.879) [-716.353] (-717.862) (-717.331) -- 0:00:33
      467000 -- (-714.772) (-715.976) [-717.247] (-716.207) * (-719.030) (-716.118) [-716.684] (-715.660) -- 0:00:33
      467500 -- [-717.063] (-714.425) (-717.725) (-719.061) * (-717.274) [-717.142] (-716.433) (-719.666) -- 0:00:33
      468000 -- [-717.996] (-715.261) (-715.819) (-715.757) * [-717.609] (-717.948) (-716.690) (-715.785) -- 0:00:32
      468500 -- (-716.615) (-718.288) [-715.687] (-715.184) * (-714.707) (-717.832) [-714.261] (-716.468) -- 0:00:32
      469000 -- (-716.871) (-716.082) (-715.050) [-714.798] * (-714.683) (-717.668) (-714.836) [-716.163] -- 0:00:32
      469500 -- (-716.764) (-716.139) (-715.733) [-714.496] * (-715.007) [-718.617] (-717.842) (-715.577) -- 0:00:32
      470000 -- (-716.873) (-720.847) (-716.815) [-717.297] * [-714.968] (-719.782) (-715.451) (-714.407) -- 0:00:32

      Average standard deviation of split frequencies: 0.009640

      470500 -- (-715.765) (-716.622) [-717.760] (-719.081) * (-716.549) (-714.971) (-715.978) [-719.051] -- 0:00:32
      471000 -- (-717.572) (-715.589) [-720.024] (-717.752) * [-717.381] (-722.271) (-722.567) (-720.931) -- 0:00:32
      471500 -- (-723.754) (-715.387) [-715.650] (-718.234) * (-720.152) [-717.388] (-720.594) (-716.757) -- 0:00:32
      472000 -- (-718.048) (-716.882) (-716.114) [-719.589] * (-717.479) (-717.937) (-716.693) [-717.713] -- 0:00:32
      472500 -- [-717.405] (-716.495) (-715.441) (-716.279) * [-720.585] (-716.003) (-722.451) (-716.626) -- 0:00:32
      473000 -- (-718.672) (-715.221) (-716.496) [-714.976] * (-715.594) (-717.355) [-715.630] (-715.849) -- 0:00:32
      473500 -- (-721.935) (-715.251) [-716.370] (-716.887) * (-720.034) (-717.433) (-715.731) [-716.628] -- 0:00:32
      474000 -- (-717.448) (-717.980) [-717.401] (-717.891) * (-715.910) (-718.455) (-716.646) [-716.309] -- 0:00:32
      474500 -- (-717.146) (-720.096) (-718.882) [-716.170] * (-717.352) [-715.179] (-716.210) (-718.010) -- 0:00:32
      475000 -- (-717.269) [-718.873] (-717.863) (-716.888) * (-716.042) [-715.470] (-717.513) (-715.273) -- 0:00:32

      Average standard deviation of split frequencies: 0.010027

      475500 -- (-717.981) [-717.020] (-718.808) (-715.908) * (-719.815) [-715.215] (-715.842) (-715.513) -- 0:00:31
      476000 -- (-716.510) [-715.359] (-715.343) (-716.238) * [-717.915] (-715.499) (-717.090) (-716.554) -- 0:00:31
      476500 -- (-716.103) (-716.633) [-715.667] (-717.856) * (-719.259) [-716.642] (-715.614) (-717.076) -- 0:00:31
      477000 -- [-715.590] (-717.135) (-716.810) (-716.684) * (-718.459) [-715.659] (-715.702) (-718.495) -- 0:00:31
      477500 -- (-722.411) [-717.094] (-715.562) (-714.818) * (-716.981) [-715.584] (-714.800) (-718.328) -- 0:00:31
      478000 -- (-718.287) (-717.076) [-715.460] (-715.921) * (-717.043) (-715.925) (-716.718) [-716.179] -- 0:00:31
      478500 -- (-715.533) (-716.023) (-716.521) [-716.255] * (-719.333) (-718.223) (-717.018) [-715.405] -- 0:00:31
      479000 -- (-719.408) [-716.835] (-718.916) (-715.285) * (-716.180) (-715.983) (-717.267) [-716.611] -- 0:00:31
      479500 -- (-716.751) [-716.093] (-718.958) (-717.473) * (-719.048) (-717.129) [-715.204] (-720.929) -- 0:00:31
      480000 -- [-715.501] (-721.066) (-716.420) (-714.896) * [-715.792] (-717.558) (-716.202) (-719.270) -- 0:00:31

      Average standard deviation of split frequencies: 0.010114

      480500 -- (-716.087) (-714.289) [-716.513] (-719.183) * (-719.132) (-716.510) [-717.090] (-717.183) -- 0:00:31
      481000 -- (-717.028) (-715.186) [-715.013] (-714.864) * (-719.970) [-714.686] (-716.475) (-719.192) -- 0:00:32
      481500 -- (-717.854) (-716.660) [-716.059] (-717.712) * [-716.573] (-716.823) (-718.451) (-718.706) -- 0:00:32
      482000 -- (-715.885) (-716.001) [-715.889] (-717.366) * (-716.047) (-715.645) (-715.685) [-715.963] -- 0:00:32
      482500 -- (-716.817) [-717.493] (-719.039) (-717.495) * (-714.962) [-717.488] (-714.396) (-716.343) -- 0:00:32
      483000 -- (-715.834) [-715.816] (-716.940) (-715.639) * (-717.269) [-717.966] (-715.550) (-716.777) -- 0:00:32
      483500 -- (-716.180) (-715.095) [-714.333] (-718.194) * (-715.123) (-717.233) (-715.323) [-716.646] -- 0:00:32
      484000 -- (-716.898) [-715.008] (-718.216) (-715.284) * (-715.725) [-717.760] (-717.126) (-715.551) -- 0:00:31
      484500 -- (-715.429) [-715.682] (-719.546) (-715.967) * [-716.316] (-715.551) (-721.017) (-715.606) -- 0:00:31
      485000 -- [-717.632] (-716.573) (-724.382) (-715.818) * (-717.802) (-717.091) [-721.596] (-716.462) -- 0:00:31

      Average standard deviation of split frequencies: 0.010605

      485500 -- (-718.985) (-716.156) [-714.796] (-715.470) * (-715.109) [-715.397] (-720.672) (-714.838) -- 0:00:31
      486000 -- (-716.563) [-714.871] (-716.963) (-720.525) * (-715.332) (-720.352) [-718.273] (-717.738) -- 0:00:31
      486500 -- [-715.170] (-717.079) (-714.630) (-715.601) * (-716.102) [-716.174] (-717.579) (-718.788) -- 0:00:31
      487000 -- (-717.839) (-715.900) [-715.941] (-715.511) * (-721.718) (-716.554) (-717.557) [-718.909] -- 0:00:31
      487500 -- [-715.102] (-715.420) (-717.761) (-720.684) * (-720.846) (-716.918) [-717.462] (-716.074) -- 0:00:31
      488000 -- (-719.395) (-718.156) (-715.575) [-717.209] * [-715.592] (-717.376) (-717.109) (-714.995) -- 0:00:31
      488500 -- (-720.828) [-718.111] (-717.315) (-715.578) * (-717.927) (-717.035) [-717.613] (-719.153) -- 0:00:31
      489000 -- (-719.109) (-719.752) [-716.999] (-718.714) * (-717.903) [-715.626] (-718.219) (-718.443) -- 0:00:31
      489500 -- (-721.707) (-717.426) [-716.671] (-718.880) * (-716.967) [-715.906] (-722.163) (-717.027) -- 0:00:31
      490000 -- (-719.185) (-718.033) (-717.809) [-716.199] * (-715.970) [-716.789] (-718.560) (-716.213) -- 0:00:31

      Average standard deviation of split frequencies: 0.010376

      490500 -- (-715.572) (-719.335) (-718.593) [-716.282] * (-720.062) [-716.961] (-716.472) (-717.994) -- 0:00:31
      491000 -- [-715.663] (-716.899) (-716.249) (-717.720) * (-714.883) (-716.232) (-716.826) [-716.855] -- 0:00:31
      491500 -- (-721.387) [-717.761] (-716.723) (-716.519) * (-714.996) (-716.012) [-715.826] (-715.522) -- 0:00:31
      492000 -- [-716.745] (-716.221) (-717.119) (-715.561) * (-716.224) (-717.590) (-718.470) [-716.015] -- 0:00:30
      492500 -- [-717.269] (-717.313) (-717.265) (-715.559) * (-715.929) (-717.934) [-715.307] (-715.636) -- 0:00:30
      493000 -- (-715.192) (-719.127) [-715.971] (-717.077) * [-715.463] (-717.152) (-715.871) (-716.324) -- 0:00:30
      493500 -- (-717.114) (-723.051) [-714.529] (-714.839) * (-715.156) (-720.657) [-717.786] (-716.311) -- 0:00:30
      494000 -- [-715.438] (-714.960) (-715.248) (-715.761) * [-715.916] (-717.132) (-717.898) (-717.482) -- 0:00:30
      494500 -- (-716.146) (-720.867) (-717.287) [-716.333] * (-717.730) (-716.629) (-714.673) [-716.132] -- 0:00:30
      495000 -- (-714.625) [-716.149] (-716.894) (-717.205) * (-715.927) (-714.740) [-715.810] (-714.615) -- 0:00:30

      Average standard deviation of split frequencies: 0.009504

      495500 -- [-716.211] (-717.985) (-717.589) (-716.903) * [-715.283] (-715.276) (-717.355) (-714.907) -- 0:00:30
      496000 -- [-718.921] (-715.876) (-715.686) (-716.416) * (-717.898) [-716.823] (-717.253) (-715.257) -- 0:00:30
      496500 -- (-714.799) (-715.900) [-716.482] (-717.277) * (-715.841) (-721.430) (-719.883) [-716.003] -- 0:00:30
      497000 -- [-715.551] (-718.552) (-716.024) (-718.402) * (-720.887) (-718.710) (-716.138) [-716.170] -- 0:00:30
      497500 -- (-717.587) [-715.590] (-717.738) (-716.195) * (-717.883) (-718.957) [-716.166] (-715.653) -- 0:00:31
      498000 -- (-717.082) (-722.819) (-719.686) [-716.524] * (-715.410) [-718.806] (-717.269) (-715.774) -- 0:00:31
      498500 -- (-716.791) (-715.124) (-719.860) [-717.218] * (-715.994) [-716.202] (-715.490) (-715.663) -- 0:00:31
      499000 -- (-716.135) (-714.914) [-716.302] (-715.465) * [-715.992] (-715.633) (-714.532) (-715.906) -- 0:00:31
      499500 -- (-716.844) (-718.082) [-716.311] (-715.882) * [-715.571] (-715.308) (-714.944) (-721.069) -- 0:00:31
      500000 -- (-716.873) (-718.574) (-719.140) [-716.966] * (-716.551) (-715.494) [-714.950] (-720.003) -- 0:00:31

      Average standard deviation of split frequencies: 0.009416

      500500 -- (-723.845) [-715.701] (-715.801) (-718.180) * (-716.141) (-716.958) [-717.143] (-716.855) -- 0:00:30
      501000 -- [-717.815] (-721.970) (-715.114) (-723.468) * (-714.494) (-718.969) (-718.275) [-715.384] -- 0:00:30
      501500 -- [-715.987] (-720.174) (-718.556) (-718.340) * [-719.040] (-715.197) (-716.663) (-715.940) -- 0:00:30
      502000 -- (-718.654) [-715.676] (-717.734) (-720.334) * (-722.646) (-717.229) (-715.448) [-715.622] -- 0:00:30
      502500 -- [-717.200] (-716.822) (-714.918) (-715.643) * (-718.260) (-715.977) (-719.572) [-717.820] -- 0:00:30
      503000 -- [-716.751] (-715.699) (-718.850) (-718.414) * (-717.488) (-716.823) [-718.494] (-720.660) -- 0:00:30
      503500 -- [-715.944] (-718.822) (-715.331) (-716.504) * (-715.649) (-715.861) (-717.975) [-716.440] -- 0:00:30
      504000 -- (-719.590) [-715.092] (-717.630) (-716.396) * (-717.125) [-715.219] (-720.605) (-714.761) -- 0:00:30
      504500 -- (-715.099) (-716.557) (-715.920) [-716.762] * [-718.774] (-717.556) (-719.250) (-715.761) -- 0:00:30
      505000 -- (-716.822) [-715.877] (-715.295) (-714.694) * (-717.787) [-716.204] (-717.248) (-716.708) -- 0:00:30

      Average standard deviation of split frequencies: 0.008559

      505500 -- [-716.649] (-716.969) (-716.159) (-715.926) * (-714.625) (-714.181) [-716.725] (-718.190) -- 0:00:30
      506000 -- (-715.764) [-717.364] (-716.295) (-715.910) * (-719.475) (-715.502) [-717.043] (-716.571) -- 0:00:30
      506500 -- [-718.271] (-715.940) (-718.939) (-715.262) * (-715.702) (-717.315) [-717.094] (-715.234) -- 0:00:30
      507000 -- (-718.879) (-715.274) [-715.772] (-717.955) * (-715.352) [-715.202] (-716.226) (-717.878) -- 0:00:30
      507500 -- [-716.892] (-714.523) (-718.458) (-717.512) * [-719.363] (-715.365) (-716.539) (-718.618) -- 0:00:30
      508000 -- (-714.433) [-714.528] (-716.877) (-722.982) * (-719.141) (-718.824) (-714.375) [-727.009] -- 0:00:30
      508500 -- (-717.001) [-715.512] (-716.319) (-718.283) * (-717.657) (-716.106) [-720.258] (-723.615) -- 0:00:29
      509000 -- [-716.195] (-715.010) (-717.919) (-715.899) * [-714.970] (-716.299) (-722.006) (-716.876) -- 0:00:29
      509500 -- (-715.685) (-716.141) (-719.187) [-715.810] * [-714.519] (-714.542) (-716.220) (-720.953) -- 0:00:29
      510000 -- [-717.153] (-724.623) (-717.558) (-716.805) * (-716.935) (-716.439) [-716.328] (-714.941) -- 0:00:29

      Average standard deviation of split frequencies: 0.008885

      510500 -- (-715.826) [-716.167] (-715.755) (-718.157) * (-716.858) (-719.099) (-716.047) [-715.993] -- 0:00:29
      511000 -- (-716.051) (-715.556) (-716.047) [-716.280] * (-715.892) [-715.166] (-716.829) (-716.279) -- 0:00:29
      511500 -- [-715.892] (-716.177) (-717.694) (-718.689) * (-718.716) (-714.976) (-715.859) [-715.517] -- 0:00:29
      512000 -- (-718.862) [-717.626] (-716.276) (-717.757) * (-719.099) [-717.040] (-719.892) (-715.650) -- 0:00:29
      512500 -- (-719.973) (-716.978) (-722.185) [-715.989] * (-717.029) [-718.040] (-716.634) (-717.628) -- 0:00:29
      513000 -- (-715.169) (-718.783) [-715.541] (-721.579) * (-716.703) (-717.985) [-714.993] (-721.855) -- 0:00:29
      513500 -- [-716.660] (-718.933) (-714.469) (-717.167) * (-715.613) (-717.762) (-719.275) [-717.737] -- 0:00:29
      514000 -- [-717.527] (-717.470) (-717.328) (-715.719) * (-715.022) (-718.782) (-721.953) [-715.526] -- 0:00:30
      514500 -- [-717.070] (-714.785) (-714.931) (-717.369) * [-716.872] (-715.065) (-715.406) (-719.503) -- 0:00:30
      515000 -- (-716.734) [-714.789] (-717.404) (-718.326) * (-715.965) [-715.913] (-716.917) (-715.662) -- 0:00:30

      Average standard deviation of split frequencies: 0.008964

      515500 -- (-717.290) (-719.589) (-716.618) [-715.811] * [-716.913] (-714.646) (-717.522) (-716.548) -- 0:00:30
      516000 -- (-716.850) (-715.764) [-718.127] (-715.351) * [-718.780] (-716.676) (-716.890) (-714.883) -- 0:00:30
      516500 -- [-715.812] (-714.442) (-720.148) (-716.509) * (-715.069) (-715.147) (-714.548) [-719.789] -- 0:00:29
      517000 -- (-717.542) (-714.442) (-716.995) [-717.700] * (-717.275) (-714.554) [-715.432] (-715.878) -- 0:00:29
      517500 -- (-715.685) [-714.666] (-717.364) (-717.750) * (-717.002) (-715.336) (-716.981) [-716.294] -- 0:00:29
      518000 -- (-716.450) (-714.823) [-715.110] (-716.384) * (-715.855) [-714.847] (-717.900) (-715.465) -- 0:00:29
      518500 -- (-717.308) (-715.125) [-715.945] (-721.831) * [-716.674] (-718.224) (-716.404) (-718.198) -- 0:00:29
      519000 -- (-715.534) [-715.575] (-715.482) (-723.569) * [-717.306] (-717.646) (-718.852) (-717.596) -- 0:00:29
      519500 -- [-717.150] (-715.889) (-716.646) (-717.592) * (-715.293) (-718.392) [-720.030] (-719.401) -- 0:00:29
      520000 -- [-717.166] (-718.592) (-715.618) (-716.022) * [-717.336] (-719.661) (-718.806) (-715.900) -- 0:00:29

      Average standard deviation of split frequencies: 0.008884

      520500 -- (-722.615) (-717.142) (-716.190) [-716.069] * (-718.028) (-715.147) (-714.230) [-714.827] -- 0:00:29
      521000 -- (-719.631) [-715.614] (-715.470) (-716.710) * (-717.487) (-719.094) [-716.225] (-714.694) -- 0:00:29
      521500 -- (-717.207) [-714.336] (-716.432) (-715.452) * (-714.931) (-715.248) (-716.126) [-714.690] -- 0:00:29
      522000 -- (-715.817) (-717.715) [-716.697] (-716.258) * [-716.408] (-716.189) (-718.448) (-716.101) -- 0:00:29
      522500 -- [-716.503] (-719.950) (-717.460) (-720.106) * (-716.365) [-715.292] (-716.354) (-716.475) -- 0:00:29
      523000 -- (-715.436) (-715.142) (-720.417) [-714.777] * (-716.111) [-717.106] (-720.410) (-718.090) -- 0:00:29
      523500 -- (-715.773) [-718.746] (-716.330) (-717.447) * (-719.109) (-714.675) (-715.900) [-715.225] -- 0:00:29
      524000 -- (-715.689) (-719.558) (-718.007) [-718.269] * (-715.253) (-717.391) [-715.221] (-717.148) -- 0:00:29
      524500 -- (-717.163) (-720.206) (-715.302) [-719.314] * (-716.433) (-715.289) (-718.428) [-716.095] -- 0:00:29
      525000 -- [-716.795] (-715.070) (-716.551) (-720.163) * (-714.764) [-715.714] (-719.328) (-715.989) -- 0:00:28

      Average standard deviation of split frequencies: 0.008794

      525500 -- [-717.322] (-718.969) (-718.299) (-714.541) * (-716.159) [-717.305] (-722.993) (-715.508) -- 0:00:28
      526000 -- (-718.671) [-715.598] (-720.221) (-717.614) * [-717.172] (-717.287) (-720.605) (-715.498) -- 0:00:28
      526500 -- [-716.199] (-718.249) (-718.587) (-715.539) * (-715.814) [-715.381] (-715.366) (-715.891) -- 0:00:28
      527000 -- (-715.580) (-716.531) [-715.046] (-717.890) * (-714.907) [-716.169] (-715.769) (-718.774) -- 0:00:28
      527500 -- (-718.598) (-717.314) (-717.709) [-715.920] * (-717.426) (-716.162) [-716.786] (-717.134) -- 0:00:28
      528000 -- (-718.246) (-715.460) [-715.624] (-718.214) * (-716.582) (-716.066) [-715.807] (-717.721) -- 0:00:28
      528500 -- (-717.191) (-716.246) (-715.064) [-720.345] * (-716.399) (-715.622) [-716.875] (-718.006) -- 0:00:28
      529000 -- (-718.398) (-717.561) [-718.607] (-717.091) * (-718.710) [-718.260] (-716.082) (-714.956) -- 0:00:29
      529500 -- (-715.843) [-717.943] (-716.507) (-720.430) * (-719.576) (-719.667) [-717.722] (-718.871) -- 0:00:29
      530000 -- [-718.248] (-717.887) (-715.436) (-724.530) * (-716.250) (-715.850) (-716.199) [-715.615] -- 0:00:29

      Average standard deviation of split frequencies: 0.009494

      530500 -- [-716.037] (-715.824) (-716.033) (-718.961) * (-716.579) [-720.416] (-717.676) (-715.961) -- 0:00:29
      531000 -- (-718.043) [-715.977] (-715.567) (-716.467) * [-715.082] (-722.034) (-715.070) (-715.286) -- 0:00:29
      531500 -- [-716.231] (-716.358) (-719.675) (-717.392) * (-716.553) (-715.663) (-717.421) [-715.201] -- 0:00:29
      532000 -- (-715.706) (-715.700) (-716.079) [-716.214] * (-716.361) (-716.350) [-714.940] (-717.185) -- 0:00:29
      532500 -- (-714.914) (-716.356) [-716.223] (-722.684) * [-718.250] (-717.238) (-715.560) (-717.832) -- 0:00:28
      533000 -- [-714.937] (-714.579) (-715.528) (-720.967) * [-716.219] (-717.296) (-718.932) (-720.088) -- 0:00:28
      533500 -- [-716.027] (-717.633) (-720.011) (-714.716) * (-716.396) [-722.039] (-716.712) (-720.962) -- 0:00:28
      534000 -- [-716.100] (-719.176) (-716.763) (-714.698) * (-716.224) [-714.547] (-717.516) (-715.649) -- 0:00:28
      534500 -- (-715.894) [-717.036] (-715.312) (-715.990) * [-715.697] (-714.214) (-715.059) (-714.857) -- 0:00:28
      535000 -- (-721.266) (-714.658) (-716.849) [-715.910] * (-716.415) [-715.763] (-716.115) (-715.843) -- 0:00:28

      Average standard deviation of split frequencies: 0.009454

      535500 -- (-715.161) (-714.718) [-716.742] (-715.778) * (-720.455) [-715.777] (-714.641) (-715.350) -- 0:00:28
      536000 -- (-716.606) [-717.672] (-715.798) (-716.474) * (-718.045) (-715.879) [-715.055] (-715.102) -- 0:00:28
      536500 -- (-723.599) [-717.119] (-716.312) (-717.914) * (-715.761) (-718.597) [-715.750] (-714.821) -- 0:00:28
      537000 -- [-719.692] (-717.574) (-716.514) (-720.196) * (-714.381) (-717.601) (-717.877) [-717.132] -- 0:00:28
      537500 -- (-719.851) (-718.726) [-715.341] (-716.298) * (-717.386) (-718.317) (-715.417) [-719.477] -- 0:00:28
      538000 -- (-724.372) (-721.797) (-719.081) [-715.063] * (-718.829) (-721.785) (-714.991) [-715.107] -- 0:00:28
      538500 -- (-716.448) (-717.367) (-720.108) [-715.917] * (-715.797) [-716.041] (-717.127) (-714.348) -- 0:00:28
      539000 -- (-718.408) (-719.930) (-718.332) [-716.781] * (-718.095) (-718.967) [-716.405] (-716.547) -- 0:00:28
      539500 -- (-715.689) (-716.969) [-715.145] (-718.946) * (-719.386) (-715.854) [-715.242] (-716.496) -- 0:00:28
      540000 -- (-714.271) [-715.397] (-715.827) (-715.762) * (-717.981) (-719.893) [-718.288] (-715.487) -- 0:00:28

      Average standard deviation of split frequencies: 0.009645

      540500 -- [-716.186] (-718.689) (-716.627) (-716.099) * (-717.270) (-717.539) (-716.802) [-716.309] -- 0:00:28
      541000 -- (-716.086) (-715.952) [-715.379] (-715.210) * [-716.078] (-718.479) (-716.548) (-717.599) -- 0:00:27
      541500 -- (-716.105) (-714.917) [-715.594] (-717.696) * (-715.451) (-716.586) [-715.945] (-717.194) -- 0:00:27
      542000 -- (-718.068) (-715.197) [-716.948] (-716.233) * (-714.947) [-715.964] (-718.577) (-717.880) -- 0:00:27
      542500 -- (-715.952) (-716.227) [-715.806] (-715.240) * [-715.154] (-717.677) (-717.826) (-720.173) -- 0:00:27
      543000 -- (-717.756) (-715.720) [-715.745] (-715.530) * (-714.778) (-718.117) (-716.558) [-716.509] -- 0:00:27
      543500 -- (-714.956) (-718.415) [-715.102] (-715.324) * (-714.767) (-716.320) (-718.399) [-714.703] -- 0:00:27
      544000 -- [-716.588] (-716.395) (-716.791) (-720.364) * (-720.456) [-715.285] (-717.664) (-716.767) -- 0:00:27
      544500 -- (-721.936) (-715.441) (-716.128) [-717.614] * (-717.098) [-715.839] (-714.942) (-718.433) -- 0:00:27
      545000 -- (-717.910) [-715.865] (-715.476) (-726.201) * (-716.759) (-718.056) (-715.459) [-715.265] -- 0:00:27

      Average standard deviation of split frequencies: 0.009551

      545500 -- (-718.540) (-714.972) (-717.808) [-714.582] * (-718.870) [-715.498] (-715.663) (-714.458) -- 0:00:28
      546000 -- (-717.134) (-715.617) [-717.747] (-718.777) * (-714.577) [-716.041] (-715.948) (-714.859) -- 0:00:28
      546500 -- (-714.993) [-717.445] (-717.062) (-715.859) * [-718.571] (-715.602) (-716.427) (-722.983) -- 0:00:28
      547000 -- (-717.149) [-718.640] (-717.109) (-716.406) * (-717.513) [-714.347] (-721.796) (-719.143) -- 0:00:28
      547500 -- [-718.473] (-717.530) (-717.058) (-715.799) * (-715.664) (-715.696) [-717.770] (-717.059) -- 0:00:28
      548000 -- [-720.476] (-717.027) (-717.864) (-718.783) * [-714.943] (-715.285) (-718.234) (-717.071) -- 0:00:28
      548500 -- (-716.697) (-717.605) [-715.654] (-714.804) * (-716.187) (-717.054) (-719.277) [-715.448] -- 0:00:27
      549000 -- (-722.911) (-718.658) (-718.075) [-715.274] * (-716.724) (-718.180) [-716.904] (-715.607) -- 0:00:27
      549500 -- (-720.630) (-719.258) (-720.350) [-718.357] * (-714.658) (-716.921) (-718.778) [-716.646] -- 0:00:27
      550000 -- (-716.875) (-717.999) (-722.122) [-717.870] * (-714.756) [-715.073] (-717.299) (-714.971) -- 0:00:27

      Average standard deviation of split frequencies: 0.008828

      550500 -- [-714.689] (-715.208) (-720.627) (-715.430) * (-715.110) [-715.096] (-717.768) (-714.994) -- 0:00:27
      551000 -- (-717.637) [-715.127] (-721.606) (-716.377) * (-715.606) (-715.720) [-716.537] (-716.622) -- 0:00:27
      551500 -- [-717.849] (-714.899) (-720.146) (-716.173) * [-716.659] (-716.719) (-719.954) (-716.419) -- 0:00:27
      552000 -- (-718.055) (-715.126) [-720.945] (-717.204) * [-717.245] (-716.114) (-718.301) (-718.887) -- 0:00:27
      552500 -- (-714.832) (-716.104) (-715.149) [-716.967] * (-716.424) [-716.714] (-716.017) (-717.782) -- 0:00:27
      553000 -- (-716.531) [-715.575] (-716.355) (-714.611) * [-714.623] (-716.256) (-716.463) (-714.990) -- 0:00:27
      553500 -- [-714.450] (-716.715) (-720.887) (-715.960) * (-719.367) (-716.432) (-718.493) [-715.014] -- 0:00:27
      554000 -- (-715.444) (-716.513) (-716.221) [-717.447] * (-720.622) [-716.287] (-721.992) (-721.513) -- 0:00:27
      554500 -- (-714.685) (-715.974) [-715.247] (-716.191) * [-717.162] (-716.530) (-716.072) (-717.257) -- 0:00:27
      555000 -- (-715.878) [-715.434] (-715.623) (-715.512) * (-719.274) (-716.230) (-715.691) [-715.664] -- 0:00:27

      Average standard deviation of split frequencies: 0.008214

      555500 -- [-715.250] (-715.178) (-715.872) (-716.915) * (-722.259) [-715.893] (-715.447) (-717.343) -- 0:00:27
      556000 -- (-715.707) (-715.037) [-715.128] (-715.407) * (-716.342) [-716.890] (-718.061) (-719.046) -- 0:00:27
      556500 -- (-715.201) [-715.097] (-717.782) (-718.885) * (-714.646) [-717.471] (-717.240) (-717.295) -- 0:00:27
      557000 -- [-715.931] (-715.957) (-715.881) (-715.697) * (-714.873) (-715.183) (-716.151) [-716.468] -- 0:00:27
      557500 -- (-717.081) (-714.963) [-719.580] (-715.081) * [-715.271] (-714.487) (-718.213) (-717.792) -- 0:00:26
      558000 -- (-714.438) [-718.888] (-720.833) (-717.248) * (-716.100) [-715.746] (-722.616) (-716.334) -- 0:00:26
      558500 -- (-715.797) [-715.799] (-717.806) (-717.793) * [-715.924] (-717.623) (-723.204) (-715.438) -- 0:00:26
      559000 -- (-719.832) (-714.651) [-716.905] (-716.936) * [-715.859] (-715.744) (-718.629) (-717.296) -- 0:00:26
      559500 -- (-720.343) (-719.889) (-717.482) [-714.966] * (-715.856) (-716.150) [-719.658] (-715.822) -- 0:00:26
      560000 -- (-716.537) (-715.241) [-716.685] (-714.422) * (-719.743) [-715.300] (-716.650) (-716.635) -- 0:00:26

      Average standard deviation of split frequencies: 0.007935

      560500 -- (-717.749) (-715.219) [-716.688] (-717.500) * (-721.161) [-715.376] (-717.817) (-721.960) -- 0:00:26
      561000 -- (-715.892) (-718.137) [-718.489] (-718.886) * (-720.766) (-716.055) (-716.972) [-714.208] -- 0:00:26
      561500 -- (-715.995) (-720.071) [-714.814] (-717.786) * (-716.228) (-715.913) (-715.939) [-715.134] -- 0:00:27
      562000 -- [-716.848] (-716.619) (-714.815) (-718.644) * (-715.343) (-717.046) [-718.025] (-714.358) -- 0:00:27
      562500 -- (-716.114) (-715.946) [-718.996] (-716.426) * [-715.176] (-719.482) (-718.701) (-715.228) -- 0:00:27
      563000 -- (-716.824) (-715.107) [-719.749] (-714.944) * (-719.263) [-719.571] (-716.170) (-715.189) -- 0:00:27
      563500 -- (-715.536) (-714.600) [-717.451] (-719.706) * (-715.538) (-715.263) [-715.303] (-716.584) -- 0:00:27
      564000 -- (-717.485) [-718.869] (-715.639) (-716.256) * (-717.934) (-717.072) (-717.407) [-715.891] -- 0:00:27
      564500 -- [-716.422] (-715.622) (-714.805) (-717.334) * (-718.796) (-715.548) (-715.877) [-715.443] -- 0:00:27
      565000 -- (-716.515) (-716.917) [-715.943] (-716.233) * (-716.354) [-719.257] (-717.710) (-716.340) -- 0:00:26

      Average standard deviation of split frequencies: 0.008173

      565500 -- [-715.981] (-718.180) (-717.250) (-717.426) * [-714.728] (-716.910) (-715.100) (-714.800) -- 0:00:26
      566000 -- (-717.668) (-716.717) (-719.000) [-717.519] * (-718.020) [-717.070] (-716.433) (-717.079) -- 0:00:26
      566500 -- (-715.567) (-718.348) (-715.111) [-715.748] * (-718.043) [-719.523] (-714.730) (-716.946) -- 0:00:26
      567000 -- [-717.357] (-719.901) (-722.355) (-714.713) * (-717.220) [-715.766] (-717.039) (-716.571) -- 0:00:26
      567500 -- [-718.293] (-715.273) (-726.353) (-716.841) * [-714.576] (-715.221) (-715.284) (-719.606) -- 0:00:26
      568000 -- (-715.387) [-719.041] (-727.439) (-717.545) * [-714.504] (-716.419) (-715.042) (-718.855) -- 0:00:26
      568500 -- [-722.207] (-716.909) (-717.513) (-717.230) * [-715.235] (-716.628) (-715.320) (-715.152) -- 0:00:26
      569000 -- (-718.543) (-716.583) (-716.592) [-715.536] * [-715.353] (-716.906) (-716.250) (-716.238) -- 0:00:26
      569500 -- (-722.536) (-716.945) (-716.549) [-717.121] * (-716.717) (-716.901) (-716.607) [-716.413] -- 0:00:26
      570000 -- (-716.458) [-720.129] (-716.481) (-716.424) * [-716.505] (-716.210) (-717.774) (-721.499) -- 0:00:26

      Average standard deviation of split frequencies: 0.008415

      570500 -- (-717.328) (-715.660) (-715.838) [-715.511] * (-718.031) [-717.826] (-717.393) (-716.640) -- 0:00:26
      571000 -- (-718.009) (-715.816) (-717.592) [-717.103] * (-717.708) [-719.473] (-716.425) (-714.824) -- 0:00:26
      571500 -- [-716.488] (-716.011) (-717.118) (-715.842) * [-715.910] (-716.786) (-714.820) (-715.652) -- 0:00:26
      572000 -- (-719.671) (-717.139) [-715.986] (-715.547) * (-715.795) (-714.602) [-715.377] (-715.782) -- 0:00:26
      572500 -- (-719.125) [-722.143] (-716.832) (-719.744) * (-714.601) [-714.782] (-716.662) (-719.906) -- 0:00:26
      573000 -- (-716.396) (-714.415) (-714.806) [-716.129] * [-715.115] (-716.908) (-718.572) (-718.251) -- 0:00:26
      573500 -- [-716.278] (-716.014) (-718.004) (-715.876) * (-714.461) (-720.241) [-717.614] (-714.809) -- 0:00:26
      574000 -- (-715.081) [-716.373] (-720.838) (-716.420) * [-717.494] (-720.126) (-717.055) (-714.595) -- 0:00:25
      574500 -- (-716.541) (-717.057) [-719.562] (-715.884) * (-719.697) [-716.196] (-716.379) (-716.155) -- 0:00:25
      575000 -- (-716.073) (-716.959) (-715.107) [-717.411] * (-717.799) (-715.691) (-717.743) [-715.405] -- 0:00:25

      Average standard deviation of split frequencies: 0.008031

      575500 -- (-717.251) (-716.610) (-720.275) [-716.657] * (-717.283) (-715.143) [-715.123] (-715.797) -- 0:00:25
      576000 -- (-719.388) (-716.371) [-718.221] (-719.690) * (-718.300) [-715.497] (-719.536) (-715.595) -- 0:00:25
      576500 -- [-715.685] (-716.507) (-715.975) (-717.068) * (-714.591) [-715.147] (-722.279) (-717.123) -- 0:00:25
      577000 -- [-714.439] (-717.556) (-716.416) (-715.432) * (-716.619) [-717.787] (-721.294) (-716.347) -- 0:00:25
      577500 -- (-714.362) (-716.237) [-720.102] (-723.410) * [-715.156] (-718.042) (-720.460) (-715.148) -- 0:00:25
      578000 -- [-715.220] (-716.941) (-720.268) (-721.997) * (-722.728) (-723.304) [-717.050] (-717.100) -- 0:00:26
      578500 -- (-717.510) (-718.876) [-716.768] (-717.755) * (-721.158) [-716.688] (-716.472) (-720.483) -- 0:00:26
      579000 -- (-716.046) (-719.532) [-714.983] (-718.697) * (-717.140) (-716.773) [-722.574] (-720.689) -- 0:00:26
      579500 -- (-719.624) (-717.038) [-715.800] (-715.797) * (-716.653) (-719.088) (-715.509) [-715.725] -- 0:00:26
      580000 -- (-716.216) (-717.656) [-714.683] (-716.517) * [-715.147] (-715.782) (-718.157) (-717.352) -- 0:00:26

      Average standard deviation of split frequencies: 0.008064

      580500 -- (-716.139) [-715.658] (-715.498) (-718.881) * (-718.192) [-716.092] (-715.451) (-716.268) -- 0:00:26
      581000 -- (-716.890) (-715.508) [-715.578] (-716.299) * (-716.378) (-718.213) [-716.648] (-718.500) -- 0:00:25
      581500 -- (-716.023) (-715.213) [-716.639] (-714.467) * (-718.654) (-718.357) [-717.559] (-715.223) -- 0:00:25
      582000 -- (-716.853) (-717.677) (-715.602) [-714.867] * (-718.496) (-717.157) (-719.994) [-716.404] -- 0:00:25
      582500 -- [-716.580] (-718.057) (-714.400) (-714.947) * (-719.578) (-720.809) (-716.146) [-716.298] -- 0:00:25
      583000 -- (-715.779) [-715.778] (-714.476) (-714.157) * [-715.387] (-716.200) (-717.547) (-715.511) -- 0:00:25
      583500 -- [-716.088] (-715.871) (-714.758) (-717.446) * (-716.086) (-717.334) (-718.798) [-716.319] -- 0:00:25
      584000 -- (-720.258) [-717.972] (-714.709) (-720.388) * [-715.907] (-715.956) (-714.963) (-717.730) -- 0:00:25
      584500 -- (-715.343) (-720.833) (-718.956) [-721.046] * (-716.400) (-717.116) (-716.497) [-720.402] -- 0:00:25
      585000 -- [-715.167] (-717.411) (-715.335) (-717.653) * (-714.683) [-715.836] (-717.601) (-720.194) -- 0:00:25

      Average standard deviation of split frequencies: 0.008296

      585500 -- [-717.604] (-721.135) (-715.000) (-717.142) * (-716.180) (-715.664) (-718.805) [-720.152] -- 0:00:25
      586000 -- (-716.864) [-715.883] (-715.432) (-715.003) * (-720.216) (-717.612) (-716.246) [-715.996] -- 0:00:25
      586500 -- (-714.812) [-718.043] (-722.274) (-716.717) * (-716.046) [-714.611] (-720.106) (-719.779) -- 0:00:25
      587000 -- (-714.786) (-719.173) (-716.284) [-717.267] * (-717.471) (-719.974) [-716.200] (-719.603) -- 0:00:25
      587500 -- [-714.986] (-716.030) (-714.640) (-718.340) * (-717.704) [-718.583] (-716.757) (-715.926) -- 0:00:25
      588000 -- [-716.112] (-716.783) (-717.768) (-715.596) * [-714.504] (-716.880) (-719.119) (-718.521) -- 0:00:25
      588500 -- (-716.778) [-715.312] (-718.720) (-717.395) * (-716.027) [-717.891] (-722.686) (-717.974) -- 0:00:25
      589000 -- (-715.421) (-716.544) (-717.131) [-715.305] * [-715.586] (-716.173) (-721.605) (-719.925) -- 0:00:25
      589500 -- [-715.307] (-715.287) (-716.474) (-715.089) * (-721.690) (-722.459) [-720.775] (-718.858) -- 0:00:25
      590000 -- (-715.655) (-715.066) [-720.916] (-715.606) * [-714.820] (-719.509) (-718.279) (-718.538) -- 0:00:25

      Average standard deviation of split frequencies: 0.007931

      590500 -- (-716.472) (-716.432) [-718.170] (-715.087) * (-714.680) [-714.740] (-721.559) (-718.793) -- 0:00:24
      591000 -- (-719.280) (-722.213) (-715.688) [-717.877] * (-716.327) (-715.456) (-717.010) [-716.367] -- 0:00:24
      591500 -- (-719.192) [-715.887] (-717.481) (-716.113) * (-715.734) (-718.470) (-714.785) [-714.915] -- 0:00:24
      592000 -- (-718.323) (-715.505) (-716.424) [-714.907] * (-715.282) (-723.419) (-715.544) [-715.728] -- 0:00:24
      592500 -- (-717.539) (-716.056) (-716.606) [-716.716] * (-715.760) [-716.605] (-722.616) (-719.013) -- 0:00:24
      593000 -- (-715.466) (-718.194) [-714.701] (-715.861) * (-717.550) [-715.469] (-718.042) (-717.045) -- 0:00:24
      593500 -- (-715.266) [-714.966] (-715.846) (-715.140) * (-725.149) (-718.217) (-715.069) [-716.741] -- 0:00:24
      594000 -- (-716.456) (-717.203) (-714.962) [-715.679] * [-714.546] (-715.205) (-714.948) (-719.292) -- 0:00:24
      594500 -- (-715.067) (-716.389) (-716.556) [-714.494] * (-715.420) (-717.016) (-714.325) [-716.348] -- 0:00:25
      595000 -- (-716.324) [-718.461] (-715.485) (-715.936) * (-716.330) (-717.659) (-715.211) [-715.978] -- 0:00:25

      Average standard deviation of split frequencies: 0.007909

      595500 -- (-716.605) (-717.118) [-715.597] (-719.021) * (-718.915) [-717.895] (-715.100) (-719.081) -- 0:00:25
      596000 -- [-719.859] (-718.743) (-715.486) (-718.695) * (-718.164) [-717.397] (-714.668) (-716.555) -- 0:00:25
      596500 -- (-717.477) (-716.057) [-716.934] (-719.247) * [-715.904] (-714.745) (-718.176) (-718.886) -- 0:00:25
      597000 -- [-716.385] (-715.454) (-716.382) (-717.243) * [-717.806] (-721.111) (-718.212) (-719.239) -- 0:00:24
      597500 -- (-717.957) [-714.519] (-717.202) (-718.086) * (-716.568) (-726.040) (-717.697) [-717.902] -- 0:00:24
      598000 -- [-716.361] (-715.518) (-716.355) (-716.935) * (-715.934) (-717.438) (-716.183) [-716.276] -- 0:00:24
      598500 -- [-717.130] (-719.284) (-715.488) (-714.551) * [-715.979] (-717.855) (-720.516) (-715.974) -- 0:00:24
      599000 -- [-714.793] (-715.000) (-716.942) (-715.914) * (-715.401) (-715.110) (-716.182) [-715.082] -- 0:00:24
      599500 -- (-718.395) (-715.428) [-714.644] (-714.891) * [-716.839] (-716.572) (-718.443) (-716.858) -- 0:00:24
      600000 -- (-718.405) [-717.854] (-715.801) (-714.886) * (-717.145) (-716.254) [-715.169] (-715.730) -- 0:00:24

      Average standard deviation of split frequencies: 0.008142

      600500 -- (-719.964) (-719.614) [-714.331] (-716.005) * [-716.943] (-718.000) (-715.605) (-715.195) -- 0:00:24
      601000 -- [-716.868] (-718.274) (-714.923) (-716.145) * (-716.802) (-715.782) (-716.386) [-716.965] -- 0:00:24
      601500 -- (-717.623) (-717.775) (-720.662) [-715.563] * (-716.274) (-715.584) [-717.248] (-714.950) -- 0:00:24
      602000 -- (-719.969) (-716.589) (-717.002) [-715.304] * (-716.224) (-717.832) (-719.879) [-715.570] -- 0:00:24
      602500 -- [-715.425] (-716.144) (-716.867) (-717.730) * (-718.276) (-721.653) [-715.659] (-716.635) -- 0:00:24
      603000 -- (-714.758) [-717.822] (-715.233) (-715.938) * (-717.031) (-716.963) [-715.472] (-716.410) -- 0:00:24
      603500 -- (-716.869) [-716.935] (-716.984) (-714.843) * (-716.807) [-716.660] (-714.640) (-716.723) -- 0:00:24
      604000 -- (-719.091) [-715.406] (-715.235) (-715.432) * (-717.682) (-719.677) [-715.212] (-717.962) -- 0:00:24
      604500 -- (-715.981) [-715.192] (-716.405) (-714.644) * [-715.377] (-716.541) (-716.882) (-716.861) -- 0:00:24
      605000 -- [-715.164] (-717.461) (-721.396) (-717.136) * (-715.703) (-715.976) [-715.967] (-718.270) -- 0:00:24

      Average standard deviation of split frequencies: 0.008265

      605500 -- (-715.140) [-718.006] (-718.738) (-716.884) * (-718.536) (-716.186) [-714.904] (-715.332) -- 0:00:24
      606000 -- [-718.069] (-716.740) (-719.026) (-716.548) * (-718.993) [-715.678] (-714.944) (-718.070) -- 0:00:24
      606500 -- [-719.541] (-717.802) (-717.138) (-716.366) * (-716.225) [-715.658] (-716.414) (-715.907) -- 0:00:24
      607000 -- (-717.938) (-716.382) [-716.359] (-719.244) * (-718.601) [-714.758] (-717.098) (-715.450) -- 0:00:23
      607500 -- (-718.702) (-718.620) [-719.083] (-717.473) * [-717.485] (-719.620) (-718.837) (-714.582) -- 0:00:23
      608000 -- [-716.681] (-716.496) (-715.025) (-716.846) * (-714.810) [-715.659] (-718.482) (-714.613) -- 0:00:23
      608500 -- (-715.696) (-718.889) [-716.586] (-716.889) * [-714.880] (-716.111) (-719.390) (-715.503) -- 0:00:23
      609000 -- (-715.565) [-715.766] (-718.281) (-718.729) * (-718.911) (-717.900) (-717.002) [-716.026] -- 0:00:23
      609500 -- (-717.648) [-715.162] (-720.772) (-718.005) * (-717.130) [-716.575] (-715.637) (-716.655) -- 0:00:23
      610000 -- [-716.780] (-715.654) (-718.619) (-715.555) * (-718.489) [-715.925] (-716.016) (-716.483) -- 0:00:23

      Average standard deviation of split frequencies: 0.008829

      610500 -- (-716.307) (-718.545) [-715.465] (-718.222) * [-716.878] (-715.852) (-715.162) (-717.887) -- 0:00:23
      611000 -- (-714.414) [-719.024] (-722.081) (-720.693) * (-716.364) (-717.487) [-715.577] (-717.270) -- 0:00:24
      611500 -- (-718.701) (-717.160) (-721.877) [-716.549] * (-714.938) [-716.426] (-716.188) (-715.123) -- 0:00:24
      612000 -- (-715.570) (-716.308) [-717.289] (-718.903) * (-718.533) (-714.827) [-715.035] (-715.251) -- 0:00:24
      612500 -- (-717.586) (-716.062) [-715.782] (-715.011) * (-716.353) (-715.471) (-714.899) [-714.905] -- 0:00:24
      613000 -- (-719.839) (-716.251) [-717.333] (-714.797) * [-715.993] (-715.671) (-714.388) (-716.729) -- 0:00:23
      613500 -- (-715.310) [-716.956] (-719.252) (-715.837) * (-717.787) [-716.285] (-717.053) (-716.691) -- 0:00:23
      614000 -- (-716.136) (-717.965) [-717.454] (-717.654) * (-718.650) [-716.381] (-715.132) (-717.059) -- 0:00:23
      614500 -- (-718.614) (-718.148) (-716.529) [-717.618] * (-717.526) (-714.763) [-715.486] (-714.972) -- 0:00:23
      615000 -- (-717.243) (-720.915) [-717.032] (-714.540) * (-714.618) (-716.852) [-715.795] (-720.319) -- 0:00:23

      Average standard deviation of split frequencies: 0.008992

      615500 -- [-716.064] (-717.304) (-717.662) (-714.292) * (-714.963) [-716.293] (-719.730) (-720.147) -- 0:00:23
      616000 -- (-716.382) (-716.306) (-719.568) [-718.668] * (-715.649) [-716.732] (-716.033) (-716.109) -- 0:00:23
      616500 -- (-720.251) [-715.307] (-715.969) (-715.323) * (-714.826) (-715.017) [-716.498] (-716.426) -- 0:00:23
      617000 -- [-719.288] (-715.431) (-718.703) (-716.972) * [-715.186] (-717.890) (-718.666) (-716.334) -- 0:00:23
      617500 -- (-717.034) [-721.011] (-716.812) (-718.901) * (-717.008) (-717.831) [-717.966] (-716.933) -- 0:00:23
      618000 -- (-718.726) (-716.810) [-718.764] (-717.638) * (-716.752) (-716.914) [-716.992] (-714.636) -- 0:00:23
      618500 -- (-715.669) (-719.467) [-718.343] (-723.130) * (-716.344) (-718.146) (-715.649) [-714.500] -- 0:00:23
      619000 -- (-715.930) (-720.143) [-715.970] (-716.482) * [-717.301] (-716.599) (-718.709) (-714.203) -- 0:00:23
      619500 -- [-716.438] (-719.737) (-717.364) (-716.796) * (-717.924) (-716.123) (-714.320) [-716.552] -- 0:00:23
      620000 -- (-718.850) [-717.175] (-716.502) (-719.025) * (-714.865) (-716.873) (-715.834) [-715.241] -- 0:00:23

      Average standard deviation of split frequencies: 0.008402

      620500 -- (-718.319) (-717.012) (-718.199) [-716.528] * (-716.231) [-718.234] (-715.648) (-716.776) -- 0:00:23
      621000 -- [-719.817] (-718.438) (-720.488) (-718.222) * (-719.426) [-715.552] (-717.824) (-715.247) -- 0:00:23
      621500 -- (-716.592) (-722.818) [-716.840] (-719.585) * (-715.810) (-716.336) (-716.012) [-714.881] -- 0:00:23
      622000 -- (-720.242) [-716.405] (-716.567) (-716.007) * [-715.827] (-722.495) (-716.268) (-715.821) -- 0:00:23
      622500 -- (-719.422) [-714.651] (-715.530) (-714.713) * (-716.049) [-716.791] (-715.919) (-715.156) -- 0:00:23
      623000 -- [-718.077] (-716.485) (-717.202) (-717.216) * (-716.886) (-716.904) (-715.484) [-715.403] -- 0:00:22
      623500 -- [-720.821] (-714.706) (-716.335) (-719.860) * (-714.754) [-716.385] (-716.478) (-716.158) -- 0:00:22
      624000 -- (-716.649) (-719.602) [-714.978] (-718.444) * (-716.381) (-715.708) [-716.582] (-717.528) -- 0:00:22
      624500 -- [-717.048] (-718.447) (-715.446) (-716.491) * (-716.936) (-715.641) [-715.604] (-716.800) -- 0:00:22
      625000 -- (-719.709) [-718.255] (-717.948) (-715.044) * (-717.567) (-714.994) [-714.933] (-715.313) -- 0:00:22

      Average standard deviation of split frequencies: 0.008142

      625500 -- [-718.980] (-717.683) (-714.805) (-715.441) * (-715.874) (-715.371) [-715.768] (-714.794) -- 0:00:22
      626000 -- (-720.568) (-717.990) (-714.936) [-722.375] * (-716.923) [-714.928] (-717.733) (-715.533) -- 0:00:22
      626500 -- (-719.715) [-717.390] (-718.438) (-718.349) * [-715.571] (-714.306) (-715.598) (-715.270) -- 0:00:22
      627000 -- (-718.273) [-717.062] (-715.817) (-716.708) * [-716.175] (-715.386) (-714.854) (-714.815) -- 0:00:23
      627500 -- (-716.511) [-717.529] (-715.166) (-714.948) * (-715.433) (-716.631) [-715.166] (-714.478) -- 0:00:23
      628000 -- (-716.164) [-716.475] (-715.726) (-722.132) * (-717.257) (-718.714) [-714.706] (-714.448) -- 0:00:23
      628500 -- (-716.207) (-715.259) [-715.244] (-718.072) * (-716.755) (-718.009) (-716.122) [-715.560] -- 0:00:23
      629000 -- (-715.045) [-715.238] (-715.760) (-715.466) * [-717.185] (-715.519) (-717.627) (-715.361) -- 0:00:23
      629500 -- [-719.921] (-716.646) (-719.023) (-719.103) * (-716.673) (-719.182) (-723.362) [-716.295] -- 0:00:22
      630000 -- (-716.221) (-718.759) [-719.668] (-719.830) * (-717.612) (-716.584) (-717.051) [-715.587] -- 0:00:22

      Average standard deviation of split frequencies: 0.007942

      630500 -- (-714.836) (-715.690) (-717.164) [-715.736] * (-716.936) [-715.709] (-714.607) (-714.558) -- 0:00:22
      631000 -- (-715.818) (-717.416) [-718.327] (-722.765) * (-718.500) (-716.331) [-714.841] (-717.213) -- 0:00:22
      631500 -- [-714.719] (-714.937) (-716.068) (-716.343) * (-720.436) [-716.552] (-719.833) (-719.279) -- 0:00:22
      632000 -- (-714.578) [-718.424] (-718.374) (-716.494) * (-715.640) [-715.526] (-718.391) (-715.738) -- 0:00:22
      632500 -- (-718.097) (-717.487) (-714.772) [-714.710] * (-716.854) (-715.840) [-714.791] (-716.870) -- 0:00:22
      633000 -- (-715.552) (-715.900) (-720.461) [-714.918] * (-716.805) [-717.135] (-714.768) (-717.307) -- 0:00:22
      633500 -- (-717.190) [-715.725] (-717.372) (-716.746) * [-715.068] (-716.653) (-716.483) (-716.622) -- 0:00:22
      634000 -- (-719.145) (-718.046) [-717.269] (-717.027) * (-720.605) (-716.102) (-718.385) [-716.296] -- 0:00:22
      634500 -- (-716.061) (-718.130) (-724.001) [-714.247] * (-717.637) (-716.655) [-715.748] (-715.261) -- 0:00:22
      635000 -- (-714.842) (-716.631) [-716.221] (-715.986) * (-716.213) (-717.317) [-714.862] (-715.406) -- 0:00:22

      Average standard deviation of split frequencies: 0.007968

      635500 -- (-717.206) (-716.053) (-715.911) [-717.596] * (-716.959) [-716.928] (-715.292) (-715.224) -- 0:00:22
      636000 -- (-715.656) (-715.871) (-716.066) [-718.888] * [-716.774] (-716.243) (-720.345) (-717.055) -- 0:00:22
      636500 -- (-716.580) (-718.062) [-715.741] (-719.905) * (-716.662) (-719.272) (-721.116) [-717.821] -- 0:00:22
      637000 -- (-715.842) [-714.799] (-719.386) (-715.252) * [-718.694] (-714.853) (-717.548) (-717.128) -- 0:00:22
      637500 -- [-715.974] (-718.602) (-718.306) (-721.357) * (-718.174) [-716.775] (-714.605) (-716.983) -- 0:00:22
      638000 -- (-719.293) [-718.757] (-718.489) (-715.990) * (-715.600) (-715.664) [-714.600] (-716.615) -- 0:00:22
      638500 -- (-721.225) (-717.464) [-717.008] (-719.589) * [-715.690] (-716.725) (-715.207) (-716.657) -- 0:00:22
      639000 -- (-716.159) [-716.115] (-719.001) (-722.681) * (-717.199) (-716.643) (-715.093) [-715.480] -- 0:00:22
      639500 -- [-716.581] (-718.092) (-717.427) (-717.886) * (-717.393) (-714.793) [-715.985] (-716.248) -- 0:00:21
      640000 -- [-715.656] (-717.737) (-716.490) (-715.973) * (-716.693) [-717.604] (-716.363) (-715.373) -- 0:00:21

      Average standard deviation of split frequencies: 0.007910

      640500 -- (-716.992) [-716.494] (-715.825) (-715.895) * (-716.839) (-718.740) [-716.139] (-715.699) -- 0:00:21
      641000 -- (-715.755) (-716.622) [-717.480] (-714.862) * (-714.924) (-718.726) (-718.069) [-717.317] -- 0:00:21
      641500 -- (-717.099) (-714.942) [-716.081] (-718.079) * (-714.778) (-715.917) (-718.221) [-714.815] -- 0:00:21
      642000 -- (-717.039) [-715.970] (-716.270) (-715.873) * [-715.961] (-719.027) (-717.548) (-714.503) -- 0:00:21
      642500 -- [-715.696] (-719.730) (-717.711) (-714.924) * [-715.391] (-721.397) (-715.892) (-717.528) -- 0:00:21
      643000 -- (-716.290) (-715.442) (-718.315) [-715.625] * (-716.195) [-718.465] (-714.929) (-721.357) -- 0:00:22
      643500 -- (-716.208) (-722.179) (-715.449) [-715.480] * (-716.911) (-717.082) (-716.561) [-715.316] -- 0:00:22
      644000 -- [-718.266] (-718.074) (-715.924) (-715.792) * (-715.322) [-715.847] (-715.100) (-716.114) -- 0:00:22
      644500 -- [-718.791] (-715.506) (-714.726) (-717.800) * (-714.888) [-717.431] (-716.008) (-714.717) -- 0:00:22
      645000 -- (-715.665) [-715.619] (-715.802) (-715.985) * (-714.843) [-716.484] (-720.510) (-715.218) -- 0:00:22

      Average standard deviation of split frequencies: 0.007855

      645500 -- (-716.325) [-715.702] (-719.059) (-715.759) * (-714.768) [-717.940] (-715.979) (-715.623) -- 0:00:21
      646000 -- (-719.297) (-716.907) [-715.653] (-715.320) * [-717.414] (-721.039) (-716.117) (-715.805) -- 0:00:21
      646500 -- (-716.464) (-717.771) (-720.690) [-715.240] * (-717.652) (-714.578) (-717.104) [-718.544] -- 0:00:21
      647000 -- (-717.994) (-715.467) (-716.233) [-715.218] * [-718.427] (-714.514) (-715.572) (-718.509) -- 0:00:21
      647500 -- (-715.587) (-716.510) [-719.310] (-715.996) * [-719.375] (-718.183) (-719.043) (-715.940) -- 0:00:21
      648000 -- [-715.356] (-719.094) (-715.893) (-715.442) * (-715.092) (-716.218) [-715.547] (-715.572) -- 0:00:21
      648500 -- (-716.854) [-717.642] (-718.868) (-716.718) * (-715.082) (-715.893) [-717.038] (-715.553) -- 0:00:21
      649000 -- (-716.952) [-714.689] (-715.462) (-715.256) * (-716.905) (-715.706) [-717.287] (-716.731) -- 0:00:21
      649500 -- (-716.576) [-716.287] (-715.510) (-716.810) * [-714.281] (-714.508) (-717.437) (-716.828) -- 0:00:21
      650000 -- (-716.418) (-715.236) (-715.272) [-718.274] * (-714.988) [-719.603] (-721.071) (-715.197) -- 0:00:21

      Average standard deviation of split frequencies: 0.007969

      650500 -- (-716.645) [-716.947] (-717.342) (-719.504) * (-717.309) (-716.226) (-719.732) [-716.948] -- 0:00:21
      651000 -- (-715.966) [-716.729] (-719.243) (-718.884) * [-717.216] (-715.741) (-718.083) (-715.812) -- 0:00:21
      651500 -- (-716.191) [-717.041] (-716.673) (-718.003) * (-720.993) (-717.046) [-720.607] (-720.248) -- 0:00:21
      652000 -- (-714.682) (-718.756) (-715.416) [-714.734] * (-723.679) [-717.597] (-717.762) (-716.431) -- 0:00:21
      652500 -- (-716.772) (-716.694) [-718.432] (-717.040) * (-716.128) (-715.521) (-715.235) [-714.911] -- 0:00:21
      653000 -- [-718.450] (-716.255) (-717.232) (-717.651) * (-718.074) (-717.452) [-717.147] (-714.896) -- 0:00:21
      653500 -- (-718.884) [-717.516] (-717.257) (-715.122) * (-716.700) [-716.531] (-716.419) (-718.309) -- 0:00:21
      654000 -- (-717.601) (-717.438) [-715.258] (-715.291) * (-719.143) [-715.290] (-717.770) (-717.756) -- 0:00:21
      654500 -- (-716.443) [-716.469] (-717.959) (-718.919) * (-716.374) [-716.845] (-717.259) (-717.338) -- 0:00:21
      655000 -- (-716.266) [-716.434] (-719.103) (-715.802) * (-716.727) [-715.444] (-715.223) (-718.635) -- 0:00:21

      Average standard deviation of split frequencies: 0.008031

      655500 -- (-717.588) (-716.552) [-716.747] (-717.123) * (-719.434) (-716.329) (-721.356) [-720.340] -- 0:00:21
      656000 -- (-717.524) [-714.437] (-716.115) (-717.457) * (-720.122) (-718.821) [-715.589] (-717.382) -- 0:00:20
      656500 -- (-716.939) (-715.210) (-716.655) [-716.750] * [-717.305] (-715.435) (-715.030) (-718.623) -- 0:00:20
      657000 -- [-717.077] (-715.436) (-716.859) (-718.754) * (-718.848) (-717.619) (-714.576) [-715.310] -- 0:00:20
      657500 -- (-715.049) (-716.309) (-716.907) [-715.575] * (-720.394) (-716.499) [-715.360] (-716.224) -- 0:00:20
      658000 -- [-714.563] (-714.468) (-716.723) (-720.798) * (-719.603) [-717.679] (-718.260) (-720.588) -- 0:00:20
      658500 -- (-719.324) (-714.550) (-716.212) [-715.907] * [-718.769] (-716.545) (-714.997) (-715.208) -- 0:00:20
      659000 -- (-716.393) (-715.229) [-715.943] (-716.994) * (-719.694) (-718.956) (-717.327) [-715.691] -- 0:00:20
      659500 -- (-716.351) [-715.947] (-716.885) (-716.011) * (-717.265) (-717.511) (-716.535) [-715.196] -- 0:00:21
      660000 -- (-716.562) (-716.778) [-716.639] (-721.368) * (-716.175) [-716.758] (-718.316) (-716.001) -- 0:00:21

      Average standard deviation of split frequencies: 0.008185

      660500 -- (-719.370) (-718.622) [-715.541] (-715.812) * (-717.682) (-716.460) [-714.778] (-717.447) -- 0:00:21
      661000 -- (-716.812) (-716.567) [-716.667] (-718.104) * (-717.351) [-715.690] (-714.809) (-717.220) -- 0:00:21
      661500 -- (-717.417) [-715.631] (-721.166) (-717.546) * (-715.854) (-716.492) (-715.912) [-716.024] -- 0:00:20
      662000 -- (-715.625) (-716.975) [-715.755] (-716.357) * (-718.181) [-715.431] (-717.359) (-724.724) -- 0:00:20
      662500 -- (-715.462) [-714.872] (-717.463) (-716.302) * [-716.888] (-715.759) (-718.083) (-721.783) -- 0:00:20
      663000 -- (-716.474) (-717.275) [-717.559] (-722.412) * [-716.556] (-716.890) (-717.566) (-716.825) -- 0:00:20
      663500 -- [-714.867] (-715.853) (-714.677) (-716.439) * [-715.354] (-716.289) (-716.659) (-718.208) -- 0:00:20
      664000 -- (-715.445) [-715.837] (-716.465) (-715.710) * (-714.992) [-714.993] (-717.069) (-715.492) -- 0:00:20
      664500 -- [-717.565] (-719.023) (-722.389) (-718.007) * [-717.805] (-716.651) (-717.043) (-717.126) -- 0:00:20
      665000 -- (-716.028) [-714.715] (-719.184) (-718.221) * (-716.051) (-718.062) (-715.230) [-715.252] -- 0:00:20

      Average standard deviation of split frequencies: 0.008327

      665500 -- (-717.009) [-716.700] (-718.759) (-715.926) * (-719.711) [-720.706] (-715.823) (-717.487) -- 0:00:20
      666000 -- (-714.914) [-719.769] (-715.394) (-715.736) * (-717.140) (-716.372) (-717.460) [-715.329] -- 0:00:20
      666500 -- (-716.385) (-718.133) (-715.828) [-718.398] * (-719.120) (-715.296) (-715.695) [-715.311] -- 0:00:20
      667000 -- (-714.718) (-717.534) (-716.518) [-717.172] * (-716.045) [-714.610] (-714.611) (-718.318) -- 0:00:20
      667500 -- (-717.799) (-714.292) [-716.700] (-716.688) * (-716.975) (-714.529) (-715.580) [-715.828] -- 0:00:20
      668000 -- (-717.168) [-715.470] (-715.873) (-714.907) * (-715.536) [-714.503] (-715.178) (-716.249) -- 0:00:20
      668500 -- (-717.910) [-716.778] (-715.981) (-717.660) * (-714.247) (-719.784) (-715.636) [-716.639] -- 0:00:20
      669000 -- (-717.834) (-718.557) (-717.212) [-714.497] * (-717.804) (-722.030) (-716.257) [-714.571] -- 0:00:20
      669500 -- (-716.608) (-721.059) (-715.825) [-714.436] * (-716.127) (-719.730) [-715.013] (-720.448) -- 0:00:20
      670000 -- [-715.503] (-718.830) (-717.312) (-714.604) * (-721.926) (-718.331) (-716.542) [-715.120] -- 0:00:20

      Average standard deviation of split frequencies: 0.007951

      670500 -- (-715.904) (-718.515) (-717.394) [-714.493] * (-716.180) (-717.649) (-716.195) [-716.061] -- 0:00:20
      671000 -- [-716.872] (-718.770) (-716.097) (-716.786) * (-715.517) (-719.668) (-717.397) [-714.910] -- 0:00:20
      671500 -- (-715.038) (-716.883) [-716.822] (-718.646) * [-715.595] (-716.459) (-716.036) (-715.443) -- 0:00:20
      672000 -- (-715.480) (-715.595) [-715.672] (-716.559) * (-715.758) [-719.943] (-714.954) (-715.128) -- 0:00:20
      672500 -- (-723.121) [-714.555] (-716.411) (-716.559) * (-723.008) (-715.889) [-715.656] (-714.466) -- 0:00:19
      673000 -- (-716.221) [-717.972] (-715.813) (-716.232) * (-716.511) [-715.549] (-716.332) (-716.222) -- 0:00:19
      673500 -- [-715.717] (-715.590) (-715.572) (-719.920) * (-715.513) [-714.864] (-715.420) (-719.282) -- 0:00:19
      674000 -- (-716.957) (-717.314) (-715.095) [-716.962] * [-717.386] (-715.701) (-716.939) (-717.249) -- 0:00:19
      674500 -- (-717.069) [-718.407] (-721.250) (-718.158) * (-716.488) (-715.694) [-717.415] (-718.869) -- 0:00:19
      675000 -- (-720.345) (-714.523) (-717.453) [-717.996] * (-716.747) [-715.611] (-714.630) (-714.832) -- 0:00:19

      Average standard deviation of split frequencies: 0.007758

      675500 -- (-715.815) (-715.632) (-715.102) [-716.949] * (-717.969) (-716.109) [-714.829] (-717.020) -- 0:00:20
      676000 -- (-718.052) (-715.227) [-715.813] (-715.560) * (-714.501) [-717.031] (-715.615) (-716.864) -- 0:00:20
      676500 -- [-715.132] (-718.443) (-718.830) (-718.317) * (-715.886) (-714.588) (-718.219) [-719.867] -- 0:00:20
      677000 -- (-718.710) (-722.993) (-716.410) [-718.662] * [-715.664] (-716.635) (-716.056) (-717.710) -- 0:00:20
      677500 -- (-722.445) [-717.316] (-716.498) (-716.003) * (-716.395) (-719.122) [-714.696] (-716.695) -- 0:00:19
      678000 -- (-723.306) (-715.044) (-715.642) [-719.346] * [-717.902] (-719.930) (-717.930) (-717.110) -- 0:00:19
      678500 -- (-719.136) [-718.702] (-721.575) (-714.896) * (-715.378) [-717.102] (-720.691) (-716.264) -- 0:00:19
      679000 -- (-715.683) [-716.155] (-716.636) (-716.461) * (-715.340) (-715.485) [-716.658] (-716.565) -- 0:00:19
      679500 -- (-719.159) (-718.441) (-715.515) [-715.362] * (-716.136) [-716.455] (-715.156) (-715.977) -- 0:00:19
      680000 -- (-718.869) (-717.443) [-714.929] (-715.878) * (-716.024) (-717.006) [-716.177] (-717.245) -- 0:00:19

      Average standard deviation of split frequencies: 0.007835

      680500 -- [-718.528] (-715.900) (-717.213) (-717.662) * (-717.922) [-715.286] (-714.900) (-716.549) -- 0:00:19
      681000 -- (-719.323) (-718.574) (-722.854) [-718.623] * (-715.966) (-716.593) [-715.341] (-715.385) -- 0:00:19
      681500 -- (-717.575) [-715.482] (-716.055) (-721.074) * (-718.196) (-717.747) [-717.330] (-714.828) -- 0:00:19
      682000 -- (-718.232) (-720.147) [-715.775] (-717.875) * [-715.632] (-716.051) (-724.611) (-714.971) -- 0:00:19
      682500 -- [-717.911] (-716.416) (-714.495) (-717.900) * (-718.932) (-716.045) [-718.378] (-716.586) -- 0:00:19
      683000 -- (-716.974) [-719.318] (-714.915) (-718.552) * [-716.169] (-716.980) (-716.534) (-717.723) -- 0:00:19
      683500 -- (-719.177) [-717.241] (-717.749) (-716.317) * [-722.425] (-719.466) (-717.304) (-714.737) -- 0:00:19
      684000 -- (-718.861) [-716.097] (-716.978) (-715.232) * (-718.408) [-716.110] (-719.305) (-719.539) -- 0:00:19
      684500 -- (-716.406) (-715.808) [-716.583] (-716.740) * (-714.571) (-718.026) (-718.057) [-714.841] -- 0:00:19
      685000 -- (-716.723) (-717.000) [-715.216] (-716.676) * (-717.158) (-718.076) [-716.418] (-717.533) -- 0:00:19

      Average standard deviation of split frequencies: 0.008074

      685500 -- [-719.688] (-716.504) (-715.120) (-715.100) * (-719.213) [-718.912] (-716.544) (-716.521) -- 0:00:19
      686000 -- (-715.401) (-716.077) [-715.612] (-716.706) * [-715.026] (-715.695) (-716.708) (-717.518) -- 0:00:19
      686500 -- (-723.764) [-715.194] (-720.090) (-714.836) * (-715.317) (-715.956) (-715.209) [-714.514] -- 0:00:19
      687000 -- [-716.140] (-716.030) (-716.381) (-716.554) * (-721.947) [-717.258] (-718.061) (-714.784) -- 0:00:19
      687500 -- (-717.312) (-716.143) (-717.019) [-714.915] * (-721.246) (-716.727) (-720.332) [-716.178] -- 0:00:19
      688000 -- (-721.545) [-716.340] (-716.952) (-715.357) * (-715.208) [-715.122] (-716.321) (-716.472) -- 0:00:19
      688500 -- (-716.647) [-714.591] (-717.852) (-717.066) * (-716.460) [-715.460] (-714.630) (-718.689) -- 0:00:19
      689000 -- [-715.696] (-715.945) (-720.932) (-717.133) * (-718.353) (-715.622) (-714.455) [-719.906] -- 0:00:18
      689500 -- (-718.313) (-715.678) (-716.452) [-716.258] * (-718.791) [-715.814] (-715.295) (-722.152) -- 0:00:18
      690000 -- (-720.761) [-715.991] (-717.169) (-718.657) * (-717.803) [-716.032] (-716.821) (-720.865) -- 0:00:18

      Average standard deviation of split frequencies: 0.008233

      690500 -- (-715.437) (-718.935) [-716.969] (-718.417) * (-720.547) (-716.814) (-717.245) [-716.273] -- 0:00:18
      691000 -- (-717.535) (-715.666) [-716.328] (-718.298) * (-722.333) (-719.458) [-717.470] (-718.881) -- 0:00:18
      691500 -- (-716.484) (-714.922) [-716.022] (-715.247) * (-719.488) [-716.156] (-718.982) (-716.517) -- 0:00:18
      692000 -- (-716.786) (-716.053) (-718.481) [-718.444] * (-718.150) [-716.433] (-715.639) (-715.471) -- 0:00:18
      692500 -- (-715.476) (-721.733) (-715.144) [-715.280] * [-715.693] (-716.161) (-715.213) (-720.624) -- 0:00:19
      693000 -- (-715.336) (-717.993) (-718.277) [-714.602] * [-715.749] (-717.359) (-717.123) (-717.206) -- 0:00:19
      693500 -- (-716.071) (-719.246) (-717.947) [-714.684] * (-715.128) [-718.338] (-718.879) (-716.608) -- 0:00:19
      694000 -- (-715.756) [-719.780] (-715.448) (-716.972) * (-715.617) (-718.238) (-716.335) [-717.513] -- 0:00:18
      694500 -- [-716.551] (-717.370) (-718.481) (-721.485) * (-717.494) [-717.031] (-718.240) (-722.337) -- 0:00:18
      695000 -- (-716.132) (-717.531) (-715.557) [-717.444] * [-717.483] (-716.224) (-718.532) (-726.255) -- 0:00:18

      Average standard deviation of split frequencies: 0.008678

      695500 -- [-714.708] (-719.379) (-715.985) (-716.701) * (-718.407) (-719.820) (-716.327) [-714.498] -- 0:00:18
      696000 -- [-714.817] (-715.565) (-720.052) (-714.950) * (-716.460) [-717.963] (-717.945) (-716.996) -- 0:00:18
      696500 -- [-714.931] (-715.372) (-715.163) (-716.350) * (-716.843) [-716.261] (-714.972) (-716.757) -- 0:00:18
      697000 -- (-717.820) (-715.172) (-718.749) [-717.033] * [-717.886] (-715.407) (-715.035) (-715.618) -- 0:00:18
      697500 -- (-718.043) (-715.417) [-719.540] (-714.921) * (-718.751) [-717.417] (-715.727) (-718.244) -- 0:00:18
      698000 -- (-714.374) (-715.766) (-720.596) [-714.314] * [-717.873] (-718.319) (-718.566) (-717.702) -- 0:00:18
      698500 -- (-719.670) (-715.449) (-717.942) [-716.667] * (-717.880) [-715.181] (-716.863) (-715.283) -- 0:00:18
      699000 -- (-715.537) [-716.838] (-715.238) (-716.848) * [-715.306] (-715.228) (-719.600) (-716.275) -- 0:00:18
      699500 -- (-718.717) (-717.759) [-719.474] (-719.933) * (-715.317) (-721.128) [-722.406] (-716.723) -- 0:00:18
      700000 -- (-719.260) [-716.224] (-715.818) (-716.112) * [-715.576] (-724.719) (-719.826) (-715.096) -- 0:00:18

      Average standard deviation of split frequencies: 0.008494

      700500 -- [-719.282] (-716.434) (-715.194) (-714.669) * (-714.674) (-717.490) (-717.467) [-717.270] -- 0:00:18
      701000 -- [-718.968] (-715.899) (-717.180) (-717.270) * (-714.677) (-720.382) (-720.139) [-717.796] -- 0:00:18
      701500 -- (-722.065) (-716.406) [-716.380] (-714.770) * (-719.411) [-719.129] (-716.400) (-720.147) -- 0:00:18
      702000 -- (-717.704) (-715.263) [-716.401] (-715.094) * (-715.882) (-718.155) (-715.346) [-716.609] -- 0:00:18
      702500 -- [-715.836] (-715.121) (-716.755) (-716.332) * (-718.779) (-717.024) (-715.704) [-715.222] -- 0:00:18
      703000 -- (-717.483) (-719.944) [-715.483] (-716.253) * (-719.585) [-719.969] (-717.503) (-716.057) -- 0:00:18
      703500 -- (-716.355) (-718.064) (-716.454) [-715.390] * (-721.271) (-718.499) (-716.009) [-717.761] -- 0:00:18
      704000 -- (-717.337) [-716.350] (-714.561) (-715.387) * (-715.033) (-716.888) [-717.497] (-714.242) -- 0:00:18
      704500 -- (-715.271) [-716.068] (-717.234) (-717.632) * (-715.971) [-717.233] (-717.763) (-714.174) -- 0:00:18
      705000 -- [-715.040] (-723.450) (-717.406) (-716.527) * [-717.382] (-715.521) (-721.152) (-715.784) -- 0:00:17

      Average standard deviation of split frequencies: 0.008720

      705500 -- [-714.437] (-718.231) (-717.739) (-720.109) * (-715.465) (-717.574) (-719.054) [-717.544] -- 0:00:17
      706000 -- [-716.886] (-716.910) (-714.306) (-719.056) * (-716.010) (-715.197) (-718.533) [-721.952] -- 0:00:17
      706500 -- (-719.617) (-715.005) (-714.885) [-715.189] * (-715.355) (-715.429) [-717.969] (-715.452) -- 0:00:17
      707000 -- (-722.102) (-714.535) [-716.324] (-714.770) * (-715.404) (-715.269) [-718.808] (-715.771) -- 0:00:17
      707500 -- (-718.523) (-715.063) [-721.261] (-716.530) * (-717.305) (-720.181) [-714.590] (-716.356) -- 0:00:17
      708000 -- (-719.081) (-714.449) (-723.546) [-714.623] * (-720.698) (-718.798) [-714.915] (-718.365) -- 0:00:17
      708500 -- [-717.094] (-716.402) (-715.981) (-717.853) * (-717.764) (-718.605) (-715.172) [-719.381] -- 0:00:18
      709000 -- (-717.817) (-716.332) (-715.593) [-721.653] * (-717.267) (-715.441) [-718.441] (-717.768) -- 0:00:18
      709500 -- (-719.675) (-720.043) (-717.752) [-720.659] * [-715.668] (-716.269) (-715.103) (-716.254) -- 0:00:18
      710000 -- (-716.991) (-716.275) [-718.767] (-714.864) * (-721.100) [-715.667] (-715.699) (-715.516) -- 0:00:17

      Average standard deviation of split frequencies: 0.008955

      710500 -- (-715.701) [-717.433] (-718.510) (-716.110) * (-719.778) (-720.329) [-715.503] (-716.565) -- 0:00:17
      711000 -- (-717.096) [-715.577] (-725.788) (-719.422) * [-717.316] (-717.239) (-717.683) (-717.171) -- 0:00:17
      711500 -- (-717.469) (-716.568) [-715.697] (-716.147) * (-718.833) (-725.988) [-715.553] (-716.086) -- 0:00:17
      712000 -- (-718.611) (-716.885) [-716.829] (-717.494) * (-716.580) (-715.746) [-715.359] (-714.688) -- 0:00:17
      712500 -- (-716.844) (-716.044) (-717.973) [-714.545] * (-715.955) [-716.870] (-716.534) (-714.763) -- 0:00:17
      713000 -- (-719.873) (-716.438) [-717.680] (-719.156) * (-716.205) (-716.255) (-715.922) [-714.575] -- 0:00:17
      713500 -- (-715.761) [-716.784] (-718.040) (-715.412) * (-718.658) (-720.247) [-716.843] (-719.153) -- 0:00:17
      714000 -- (-715.257) (-715.995) (-715.221) [-715.137] * (-717.665) [-715.855] (-716.811) (-715.205) -- 0:00:17
      714500 -- [-715.149] (-715.939) (-721.039) (-715.261) * (-717.276) (-715.460) (-714.433) [-721.077] -- 0:00:17
      715000 -- (-717.405) (-716.358) (-722.450) [-715.957] * (-716.976) (-717.482) (-714.340) [-715.888] -- 0:00:17

      Average standard deviation of split frequencies: 0.009053

      715500 -- (-715.100) (-718.601) [-717.898] (-716.367) * (-716.708) (-717.849) (-714.748) [-714.910] -- 0:00:17
      716000 -- (-715.876) (-718.606) (-715.618) [-717.148] * (-714.966) (-716.104) (-716.864) [-715.635] -- 0:00:17
      716500 -- (-716.012) [-715.542] (-719.161) (-715.988) * (-714.335) (-715.411) (-718.312) [-717.675] -- 0:00:17
      717000 -- (-716.449) (-715.498) [-720.134] (-716.815) * (-715.419) (-716.922) (-717.541) [-714.875] -- 0:00:17
      717500 -- [-714.718] (-715.870) (-719.477) (-716.294) * (-714.660) (-717.010) (-715.865) [-716.734] -- 0:00:17
      718000 -- [-715.171] (-718.791) (-718.281) (-717.018) * (-715.344) (-715.963) [-719.756] (-714.975) -- 0:00:17
      718500 -- [-715.657] (-717.549) (-721.351) (-714.648) * [-715.879] (-717.092) (-717.868) (-715.181) -- 0:00:17
      719000 -- (-718.607) (-720.785) [-718.234] (-716.055) * (-714.734) (-716.814) [-715.306] (-716.125) -- 0:00:17
      719500 -- [-716.713] (-719.429) (-715.238) (-716.752) * (-718.738) (-716.372) (-715.739) [-717.616] -- 0:00:17
      720000 -- (-716.446) [-722.070] (-715.840) (-718.028) * (-715.797) (-715.390) (-717.116) [-717.586] -- 0:00:17

      Average standard deviation of split frequencies: 0.008953

      720500 -- [-716.173] (-716.924) (-719.315) (-714.884) * (-717.533) (-715.610) (-716.356) [-718.088] -- 0:00:17
      721000 -- (-715.893) [-717.022] (-717.508) (-715.691) * (-717.004) (-716.098) [-716.143] (-720.235) -- 0:00:17
      721500 -- (-716.345) [-717.603] (-717.081) (-717.439) * (-715.431) (-717.332) [-714.791] (-718.745) -- 0:00:16
      722000 -- [-715.017] (-719.051) (-717.848) (-716.887) * (-715.681) [-714.653] (-721.237) (-715.188) -- 0:00:16
      722500 -- (-716.336) (-721.120) (-716.906) [-718.786] * (-715.430) [-714.134] (-719.682) (-715.543) -- 0:00:16
      723000 -- (-718.971) (-718.209) [-717.447] (-715.834) * [-715.703] (-714.135) (-716.447) (-716.045) -- 0:00:16
      723500 -- (-717.583) (-716.892) [-717.153] (-718.579) * (-717.563) [-719.819] (-719.584) (-718.067) -- 0:00:16
      724000 -- (-714.374) [-716.242] (-722.648) (-722.372) * (-720.083) (-719.434) (-719.133) [-715.172] -- 0:00:16
      724500 -- (-714.379) [-715.131] (-715.057) (-717.382) * (-718.619) [-715.296] (-722.294) (-715.620) -- 0:00:16
      725000 -- (-717.018) (-721.884) (-716.478) [-714.742] * (-718.409) (-716.029) [-716.891] (-715.795) -- 0:00:16

      Average standard deviation of split frequencies: 0.008806

      725500 -- (-721.728) (-719.004) [-716.052] (-716.347) * [-717.507] (-715.394) (-718.208) (-714.814) -- 0:00:17
      726000 -- (-714.556) [-718.273] (-718.011) (-716.729) * (-717.112) (-715.529) [-719.654] (-715.162) -- 0:00:16
      726500 -- (-715.761) (-717.260) [-718.129] (-715.521) * [-717.867] (-715.476) (-718.300) (-718.557) -- 0:00:16
      727000 -- (-718.426) (-718.472) (-723.719) [-718.022] * (-717.096) (-716.077) (-715.746) [-716.348] -- 0:00:16
      727500 -- (-718.036) (-715.242) [-717.420] (-716.265) * (-718.203) (-716.075) [-717.136] (-716.072) -- 0:00:16
      728000 -- (-715.856) (-715.414) (-716.713) [-717.448] * (-719.226) [-715.360] (-714.748) (-716.552) -- 0:00:16
      728500 -- (-719.422) (-716.542) [-718.607] (-716.414) * (-721.626) [-717.158] (-720.165) (-715.029) -- 0:00:16
      729000 -- (-715.961) (-718.359) [-718.114] (-715.863) * [-714.235] (-720.732) (-718.783) (-717.631) -- 0:00:16
      729500 -- (-716.513) (-716.965) [-716.144] (-714.151) * (-716.631) (-718.649) (-717.033) [-717.842] -- 0:00:16
      730000 -- (-718.674) [-716.066] (-716.051) (-715.223) * (-717.296) [-718.932] (-716.463) (-717.545) -- 0:00:16

      Average standard deviation of split frequencies: 0.008387

      730500 -- [-716.338] (-716.522) (-717.973) (-715.198) * (-718.167) (-716.644) [-717.971] (-723.370) -- 0:00:16
      731000 -- (-717.573) (-716.311) (-715.878) [-716.785] * (-719.342) (-714.504) [-717.293] (-721.957) -- 0:00:16
      731500 -- (-716.577) (-720.193) (-716.313) [-715.846] * [-718.977] (-715.786) (-715.160) (-715.719) -- 0:00:16
      732000 -- (-718.398) [-714.490] (-717.447) (-718.793) * (-718.121) (-715.909) [-714.615] (-721.054) -- 0:00:16
      732500 -- (-714.494) [-719.152] (-716.126) (-716.206) * [-716.761] (-715.804) (-715.549) (-723.938) -- 0:00:16
      733000 -- [-716.003] (-715.597) (-717.412) (-716.999) * (-716.988) [-717.087] (-717.505) (-721.042) -- 0:00:16
      733500 -- (-715.766) (-715.617) (-714.525) [-714.791] * (-717.561) [-719.637] (-720.121) (-715.991) -- 0:00:16
      734000 -- [-715.048] (-714.650) (-716.975) (-716.728) * [-716.131] (-718.829) (-716.127) (-718.243) -- 0:00:16
      734500 -- (-714.972) [-714.650] (-716.939) (-716.476) * (-717.749) (-715.317) [-715.243] (-716.221) -- 0:00:16
      735000 -- (-717.952) (-714.390) [-716.064] (-716.744) * (-715.590) (-716.311) [-716.953] (-716.691) -- 0:00:16

      Average standard deviation of split frequencies: 0.008567

      735500 -- (-714.922) (-714.716) [-719.462] (-717.310) * (-715.247) [-716.791] (-715.584) (-715.726) -- 0:00:16
      736000 -- (-717.753) [-715.795] (-718.675) (-714.866) * (-717.900) [-715.115] (-715.643) (-715.256) -- 0:00:16
      736500 -- [-717.255] (-716.730) (-724.989) (-715.971) * [-716.751] (-716.666) (-715.926) (-714.451) -- 0:00:16
      737000 -- (-717.041) (-718.841) (-724.518) [-716.837] * [-716.285] (-716.415) (-716.036) (-719.131) -- 0:00:16
      737500 -- (-715.227) [-716.721] (-718.037) (-714.927) * (-717.160) (-717.120) (-717.550) [-715.208] -- 0:00:16
      738000 -- (-716.091) [-720.952] (-716.086) (-716.962) * [-714.681] (-715.755) (-716.019) (-718.492) -- 0:00:15
      738500 -- (-716.279) (-716.684) (-715.989) [-715.917] * (-715.018) [-715.622] (-725.818) (-714.997) -- 0:00:15
      739000 -- (-714.632) (-717.567) [-715.345] (-717.716) * (-714.960) (-715.157) (-716.906) [-717.112] -- 0:00:15
      739500 -- (-714.985) (-719.714) [-715.984] (-715.601) * (-716.043) [-715.354] (-722.284) (-715.731) -- 0:00:15
      740000 -- (-715.946) [-719.949] (-719.568) (-717.450) * (-715.362) (-719.821) [-716.054] (-715.527) -- 0:00:15

      Average standard deviation of split frequencies: 0.008019

      740500 -- (-719.343) [-715.540] (-717.227) (-719.900) * (-715.223) [-716.532] (-718.125) (-715.381) -- 0:00:15
      741000 -- (-715.878) [-714.809] (-716.875) (-715.738) * [-715.819] (-717.182) (-718.234) (-715.805) -- 0:00:15
      741500 -- (-715.474) (-716.056) [-715.697] (-717.495) * (-718.220) [-716.945] (-715.985) (-714.980) -- 0:00:15
      742000 -- (-715.253) [-721.807] (-714.653) (-717.319) * (-715.637) (-720.516) [-718.778] (-716.449) -- 0:00:15
      742500 -- (-714.733) (-720.489) (-714.733) [-715.794] * (-716.069) [-719.915] (-718.279) (-717.530) -- 0:00:15
      743000 -- (-717.677) (-718.386) (-718.875) [-714.508] * (-715.880) (-716.922) (-716.130) [-716.380] -- 0:00:15
      743500 -- (-714.471) (-718.058) (-718.842) [-715.850] * [-714.945] (-716.637) (-716.713) (-715.353) -- 0:00:15
      744000 -- (-716.139) [-715.114] (-718.266) (-718.807) * [-716.104] (-714.534) (-717.595) (-716.698) -- 0:00:15
      744500 -- (-718.524) (-716.371) [-714.793] (-717.744) * [-715.563] (-716.210) (-714.969) (-714.906) -- 0:00:15
      745000 -- [-717.383] (-717.267) (-716.701) (-716.534) * (-714.477) (-717.164) (-715.398) [-716.898] -- 0:00:15

      Average standard deviation of split frequencies: 0.008136

      745500 -- [-714.880] (-717.572) (-718.917) (-715.734) * (-714.477) [-715.881] (-718.150) (-715.783) -- 0:00:15
      746000 -- (-716.138) [-716.266] (-715.067) (-715.503) * (-716.111) (-714.796) (-717.510) [-715.943] -- 0:00:15
      746500 -- (-715.336) (-723.154) [-719.558] (-714.833) * [-716.237] (-715.327) (-717.252) (-716.246) -- 0:00:15
      747000 -- [-720.962] (-722.086) (-716.686) (-715.877) * (-717.263) (-714.235) (-717.986) [-718.265] -- 0:00:15
      747500 -- (-716.441) [-718.852] (-717.414) (-715.388)