--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 08:55:32 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1572/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -543.22          -545.99
2       -543.20          -546.98
--------------------------------------
TOTAL     -543.21          -546.60
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.896963    0.087761    0.358108    1.471668    0.863861   1345.51   1363.50    1.000
r(A<->C){all}   0.167083    0.021533    0.000353    0.462665    0.121481    110.92    204.03    1.000
r(A<->G){all}   0.174322    0.021422    0.000052    0.469065    0.137050    190.76    194.14    1.000
r(A<->T){all}   0.162769    0.019544    0.000051    0.453096    0.127326    149.69    218.47    1.001
r(C<->G){all}   0.170991    0.020093    0.000053    0.444861    0.135778    203.54    244.97    1.003
r(C<->T){all}   0.170012    0.022341    0.000021    0.474244    0.125078    168.91    171.48    1.000
r(G<->T){all}   0.154823    0.017442    0.000019    0.415572    0.116871    256.92    300.97    1.000
pi(A){all}      0.224926    0.000429    0.187594    0.267284    0.224310   1245.93   1306.93    1.000
pi(C){all}      0.315179    0.000522    0.271237    0.359032    0.314578   1199.67   1227.87    1.001
pi(G){all}      0.272052    0.000483    0.231833    0.317176    0.271489   1151.53   1228.64    1.000
pi(T){all}      0.187843    0.000384    0.148385    0.224088    0.187255   1081.46   1265.36    1.000
alpha{1,2}      0.431379    0.249288    0.000254    1.430248    0.251010   1122.33   1205.99    1.000
alpha{3}        0.465726    0.254131    0.000103    1.482369    0.284824   1081.51   1184.30    1.000
pinvar{all}     0.995979    0.000022    0.987186    0.999996    0.997451   1258.10   1287.55    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-528.204162
Model 2: PositiveSelection	-528.204119
Model 0: one-ratio	-528.204119
Model 7: beta	-528.204216
Model 8: beta&w>1	-528.204118


Model 0 vs 1	8.600000001024455E-5

Model 2 vs 1	8.600000001024455E-5

Model 8 vs 7	1.9599999995989492E-4
>C1
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C2
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C3
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C4
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C5
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C6
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=132 

C1              LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C2              LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C3              LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C4              LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C5              LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C6              LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
                **************************************************

C1              GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C2              GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C3              GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C4              GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C5              GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C6              GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
                **************************************************

C1              NADPTSARRNTGGRRRAANALPTHSTPAPQST
C2              NADPTSARRNTGGRRRAANALPTHSTPAPQST
C3              NADPTSARRNTGGRRRAANALPTHSTPAPQST
C4              NADPTSARRNTGGRRRAANALPTHSTPAPQST
C5              NADPTSARRNTGGRRRAANALPTHSTPAPQST
C6              NADPTSARRNTGGRRRAANALPTHSTPAPQST
                ********************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3960]--->[3960]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.462 Mb, Max= 30.662 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C2              LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C3              LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C4              LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C5              LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C6              LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
                **************************************************

C1              GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C2              GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C3              GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C4              GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C5              GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C6              GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
                **************************************************

C1              NADPTSARRNTGGRRRAANALPTHSTPAPQST
C2              NADPTSARRNTGGRRRAANALPTHSTPAPQST
C3              NADPTSARRNTGGRRRAANALPTHSTPAPQST
C4              NADPTSARRNTGGRRRAANALPTHSTPAPQST
C5              NADPTSARRNTGGRRRAANALPTHSTPAPQST
C6              NADPTSARRNTGGRRRAANALPTHSTPAPQST
                ********************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
C2              TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
C3              TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
C4              TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
C5              TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
C6              TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
                **************************************************

C1              CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
C2              CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
C3              CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
C4              CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
C5              CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
C6              CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
                **************************************************

C1              CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
C2              CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
C3              CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
C4              CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
C5              CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
C6              CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
                **************************************************

C1              GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
C2              GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
C3              GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
C4              GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
C5              GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
C6              GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
                **************************************************

C1              GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
C2              GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
C3              GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
C4              GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
C5              GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
C6              GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
                **************************************************

C1              CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
C2              CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
C3              CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
C4              CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
C5              CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
C6              CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
                **************************************************

C1              AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
C2              AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
C3              AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
C4              AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
C5              AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
C6              AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
                **************************************************

C1              CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
C2              CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
C3              CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
C4              CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
C5              CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
C6              CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
                **********************************************



>C1
TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
>C2
TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
>C3
TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
>C4
TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
>C5
TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
>C6
TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
>C1
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C2
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C3
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C4
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C5
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C6
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 396 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579856052
      Setting output file names to "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 423947795
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5616366484
      Seed = 1332197143
      Swapseed = 1579856052
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -886.266987 -- -24.965149
         Chain 2 -- -886.266987 -- -24.965149
         Chain 3 -- -886.266852 -- -24.965149
         Chain 4 -- -886.266937 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -886.266852 -- -24.965149
         Chain 2 -- -886.266852 -- -24.965149
         Chain 3 -- -886.266987 -- -24.965149
         Chain 4 -- -886.266987 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-886.267] (-886.267) (-886.267) (-886.267) * [-886.267] (-886.267) (-886.267) (-886.267) 
        500 -- (-553.728) (-554.794) (-552.137) [-554.952] * (-546.748) [-556.496] (-552.577) (-567.356) -- 0:00:00
       1000 -- [-553.268] (-550.247) (-552.539) (-548.958) * (-555.197) [-549.910] (-561.170) (-552.709) -- 0:00:00
       1500 -- (-553.315) (-551.177) [-554.125] (-547.921) * (-553.001) (-554.198) [-550.634] (-549.911) -- 0:00:00
       2000 -- (-552.000) (-554.071) (-548.896) [-552.181] * (-557.108) (-551.677) (-552.589) [-561.978] -- 0:00:00
       2500 -- (-557.230) (-556.576) [-550.150] (-559.803) * (-551.730) [-548.258] (-549.985) (-558.008) -- 0:00:00
       3000 -- (-551.866) [-550.033] (-554.207) (-555.975) * [-552.994] (-551.356) (-550.897) (-554.172) -- 0:00:00
       3500 -- (-562.978) (-552.230) (-547.169) [-550.222] * (-560.165) [-550.355] (-557.271) (-555.771) -- 0:00:00
       4000 -- (-552.774) [-548.135] (-560.164) (-553.227) * (-553.487) (-556.482) (-553.162) [-551.949] -- 0:00:00
       4500 -- [-547.860] (-549.450) (-551.051) (-553.532) * (-549.359) (-551.555) (-552.809) [-553.224] -- 0:00:00
       5000 -- (-550.507) (-556.720) (-550.433) [-550.411] * [-551.790] (-549.186) (-551.670) (-553.328) -- 0:00:00

      Average standard deviation of split frequencies: 0.081983

       5500 -- (-551.296) [-552.327] (-556.155) (-549.773) * (-553.272) [-552.384] (-553.269) (-553.089) -- 0:03:00
       6000 -- (-555.867) [-550.860] (-557.690) (-552.738) * (-551.765) (-553.938) (-546.867) [-549.679] -- 0:02:45
       6500 -- (-551.885) [-554.079] (-548.057) (-555.323) * [-550.126] (-552.229) (-556.553) (-554.473) -- 0:02:32
       7000 -- [-556.418] (-555.768) (-550.823) (-551.105) * (-548.676) (-551.633) [-551.391] (-552.613) -- 0:02:21
       7500 -- [-545.537] (-549.255) (-554.654) (-557.876) * (-556.546) (-559.972) [-548.948] (-555.203) -- 0:02:12
       8000 -- (-551.377) (-554.326) [-552.133] (-553.192) * (-555.117) (-558.768) [-553.206] (-550.421) -- 0:02:04
       8500 -- [-551.868] (-555.193) (-555.645) (-559.023) * (-550.766) (-551.121) [-548.990] (-555.883) -- 0:01:56
       9000 -- (-552.381) [-550.417] (-556.960) (-555.541) * (-560.287) [-556.465] (-549.433) (-554.218) -- 0:01:50
       9500 -- (-551.955) [-549.747] (-552.233) (-543.367) * [-548.892] (-551.923) (-557.941) (-549.298) -- 0:01:44
      10000 -- [-549.361] (-552.109) (-563.072) (-542.958) * [-550.386] (-545.107) (-552.204) (-549.152) -- 0:01:39

      Average standard deviation of split frequencies: 0.048403

      10500 -- (-549.668) (-559.116) [-553.726] (-545.559) * (-555.286) (-545.251) (-554.736) [-548.198] -- 0:01:34
      11000 -- [-548.885] (-557.254) (-551.462) (-542.021) * (-557.830) (-543.026) (-551.184) [-550.390] -- 0:01:29
      11500 -- [-553.607] (-552.808) (-558.146) (-543.955) * (-554.263) (-542.340) [-548.278] (-552.490) -- 0:01:25
      12000 -- [-548.925] (-561.524) (-558.693) (-545.873) * (-554.227) (-545.150) [-548.834] (-554.303) -- 0:01:22
      12500 -- (-552.977) (-549.496) [-558.487] (-542.711) * [-554.691] (-543.765) (-552.056) (-548.414) -- 0:01:19
      13000 -- [-547.676] (-554.419) (-556.554) (-550.106) * [-548.370] (-545.653) (-547.906) (-555.863) -- 0:01:15
      13500 -- (-559.715) [-549.966] (-558.653) (-551.054) * [-550.154] (-542.578) (-560.483) (-553.155) -- 0:01:13
      14000 -- (-551.659) [-551.399] (-555.361) (-545.288) * (-557.887) (-545.991) (-547.764) [-557.894] -- 0:01:10
      14500 -- (-553.710) [-551.500] (-553.889) (-548.051) * (-552.540) (-545.386) (-544.144) [-559.464] -- 0:01:07
      15000 -- (-549.926) (-555.897) [-556.541] (-544.377) * (-551.325) [-545.789] (-544.919) (-557.030) -- 0:01:05

      Average standard deviation of split frequencies: 0.055979

      15500 -- (-558.354) (-552.815) (-551.984) [-542.978] * (-554.625) (-542.111) [-544.915] (-557.609) -- 0:01:03
      16000 -- (-555.569) [-552.723] (-563.606) (-544.021) * (-548.229) [-544.437] (-544.632) (-549.879) -- 0:01:01
      16500 -- (-558.435) (-556.215) [-550.221] (-545.602) * (-552.513) (-544.734) [-544.208] (-552.193) -- 0:00:59
      17000 -- (-550.362) [-552.434] (-553.034) (-542.227) * [-551.377] (-543.209) (-546.930) (-558.056) -- 0:00:57
      17500 -- (-554.284) (-550.212) [-546.512] (-542.911) * (-555.182) (-543.814) [-543.476] (-547.997) -- 0:00:56
      18000 -- (-554.097) (-556.662) [-550.007] (-542.734) * (-560.080) [-544.965] (-543.291) (-558.170) -- 0:00:54
      18500 -- [-551.815] (-557.516) (-547.506) (-549.172) * (-553.064) (-542.513) [-543.151] (-554.787) -- 0:00:53
      19000 -- [-547.998] (-557.475) (-554.308) (-542.330) * (-553.126) [-543.087] (-544.869) (-555.175) -- 0:00:51
      19500 -- (-558.392) (-556.805) (-550.793) [-545.281] * (-554.686) (-542.487) (-545.227) [-554.679] -- 0:00:50
      20000 -- (-550.354) [-553.839] (-551.009) (-544.345) * (-552.792) [-542.667] (-543.000) (-546.854) -- 0:00:49

      Average standard deviation of split frequencies: 0.058826

      20500 -- (-552.015) (-553.284) [-555.599] (-543.741) * (-554.323) [-545.774] (-543.335) (-552.841) -- 0:00:47
      21000 -- (-555.897) (-551.042) [-550.182] (-542.591) * (-549.032) [-543.893] (-544.826) (-551.255) -- 0:00:46
      21500 -- (-555.289) (-546.394) (-554.916) [-542.082] * (-547.758) (-544.160) [-545.078] (-551.019) -- 0:00:45
      22000 -- (-552.078) (-547.679) [-552.878] (-544.549) * (-553.218) (-543.588) (-543.986) [-549.871] -- 0:01:28
      22500 -- (-550.972) (-546.574) [-557.996] (-543.768) * (-552.252) (-545.137) (-543.386) [-555.907] -- 0:01:26
      23000 -- (-555.243) (-551.240) (-550.671) [-543.146] * [-549.439] (-544.282) (-545.068) (-558.410) -- 0:01:24
      23500 -- (-550.564) (-542.106) [-551.436] (-543.304) * (-552.416) (-543.731) [-544.552] (-552.490) -- 0:01:23
      24000 -- [-557.160] (-543.757) (-549.097) (-544.388) * (-554.364) [-542.831] (-543.987) (-549.641) -- 0:01:21
      24500 -- (-563.314) (-542.280) (-552.495) [-545.635] * (-562.318) (-543.554) (-543.645) [-555.351] -- 0:01:19
      25000 -- [-545.647] (-544.202) (-557.369) (-544.366) * (-555.341) (-546.044) [-544.218] (-558.602) -- 0:01:18

      Average standard deviation of split frequencies: 0.044503

      25500 -- (-542.600) (-547.488) (-552.014) [-544.692] * (-561.171) [-543.326] (-542.092) (-561.975) -- 0:01:16
      26000 -- (-542.850) (-555.632) (-550.719) [-544.030] * (-554.724) [-545.368] (-547.455) (-549.287) -- 0:01:14
      26500 -- (-545.824) (-553.799) [-553.466] (-543.387) * (-545.012) (-545.942) [-543.254] (-562.709) -- 0:01:13
      27000 -- (-550.352) (-543.986) (-553.415) [-543.089] * (-544.181) [-546.330] (-547.638) (-561.649) -- 0:01:12
      27500 -- [-544.568] (-543.370) (-549.336) (-544.398) * (-542.399) (-547.609) (-545.719) [-557.335] -- 0:01:10
      28000 -- (-542.956) (-542.519) [-552.876] (-545.631) * (-542.555) [-544.619] (-545.288) (-550.753) -- 0:01:09
      28500 -- (-544.400) [-541.848] (-554.971) (-543.877) * (-542.119) (-542.853) [-546.557] (-554.829) -- 0:01:08
      29000 -- (-543.916) (-543.730) [-551.768] (-542.649) * [-544.347] (-543.981) (-546.524) (-559.137) -- 0:01:06
      29500 -- (-542.914) [-542.930] (-553.488) (-542.760) * (-543.673) (-544.550) [-546.307] (-560.078) -- 0:01:05
      30000 -- (-544.478) [-545.393] (-548.387) (-542.734) * [-542.398] (-543.628) (-542.749) (-559.942) -- 0:01:04

      Average standard deviation of split frequencies: 0.030744

      30500 -- (-544.611) (-545.504) [-558.019] (-542.498) * (-544.000) (-543.138) [-542.369] (-549.753) -- 0:01:03
      31000 -- [-542.670] (-543.542) (-553.951) (-542.367) * [-541.809] (-542.648) (-542.698) (-557.855) -- 0:01:02
      31500 -- (-547.814) (-544.243) [-550.533] (-544.698) * (-541.868) [-545.594] (-545.059) (-554.196) -- 0:01:01
      32000 -- (-545.639) [-547.046] (-550.643) (-543.205) * (-541.699) (-545.257) [-548.646] (-554.821) -- 0:01:00
      32500 -- [-543.803] (-545.433) (-550.411) (-544.819) * (-544.003) (-544.398) [-542.616] (-557.680) -- 0:00:59
      33000 -- (-544.267) [-544.801] (-549.223) (-543.637) * (-543.186) (-543.991) [-542.711] (-553.589) -- 0:00:58
      33500 -- (-546.412) (-544.894) (-554.386) [-545.113] * [-542.904] (-543.187) (-543.231) (-554.996) -- 0:00:57
      34000 -- (-546.577) (-546.833) (-548.665) [-543.518] * (-542.536) (-542.002) (-542.469) [-553.174] -- 0:00:56
      34500 -- (-546.664) (-547.323) [-551.887] (-542.730) * [-542.373] (-543.475) (-542.136) (-553.029) -- 0:00:55
      35000 -- [-546.843] (-543.735) (-555.901) (-544.603) * (-547.309) (-545.706) (-542.613) [-547.521] -- 0:00:55

      Average standard deviation of split frequencies: 0.037216

      35500 -- (-542.977) (-542.828) (-552.112) [-542.443] * (-547.817) [-549.372] (-543.215) (-559.148) -- 0:00:54
      36000 -- (-543.287) [-543.215] (-560.559) (-545.681) * (-547.172) [-544.553] (-541.991) (-563.065) -- 0:00:53
      36500 -- (-546.327) (-542.653) [-553.803] (-542.068) * [-543.689] (-545.028) (-543.822) (-552.260) -- 0:00:52
      37000 -- (-543.733) (-542.681) [-554.764] (-547.392) * (-541.916) [-543.827] (-544.663) (-559.930) -- 0:00:52
      37500 -- (-541.984) (-545.204) (-559.675) [-544.266] * (-542.742) (-543.016) [-543.227] (-564.010) -- 0:00:51
      38000 -- [-544.369] (-543.509) (-563.360) (-544.833) * [-542.103] (-543.036) (-543.515) (-553.229) -- 0:00:50
      38500 -- (-545.312) [-541.987] (-566.214) (-545.883) * (-544.298) [-544.156] (-543.686) (-554.391) -- 0:00:49
      39000 -- [-544.240] (-543.708) (-551.306) (-548.202) * (-546.638) (-543.296) [-542.568] (-558.833) -- 0:01:13
      39500 -- [-544.392] (-543.225) (-548.734) (-546.259) * [-541.827] (-545.552) (-544.632) (-542.216) -- 0:01:12
      40000 -- (-543.333) [-542.733] (-549.148) (-544.851) * (-543.443) (-546.444) (-546.816) [-543.143] -- 0:01:12

      Average standard deviation of split frequencies: 0.034094

      40500 -- (-544.581) (-543.529) [-546.966] (-544.101) * (-545.861) [-546.321] (-546.362) (-544.840) -- 0:01:11
      41000 -- (-544.501) [-543.351] (-543.614) (-542.645) * (-544.404) [-542.852] (-544.557) (-542.691) -- 0:01:10
      41500 -- (-544.641) (-544.580) (-544.092) [-542.354] * (-545.372) [-543.560] (-543.038) (-544.182) -- 0:01:09
      42000 -- (-546.322) (-546.402) [-544.903] (-543.105) * (-546.860) (-543.187) (-542.854) [-542.561] -- 0:01:08
      42500 -- (-542.744) (-545.062) (-547.776) [-545.834] * [-543.957] (-544.427) (-543.083) (-543.736) -- 0:01:07
      43000 -- (-544.154) (-543.621) (-546.633) [-542.373] * (-542.750) (-544.276) (-542.624) [-545.635] -- 0:01:06
      43500 -- (-546.364) (-544.347) (-543.548) [-545.804] * (-542.589) (-545.502) (-542.858) [-543.549] -- 0:01:05
      44000 -- (-544.826) [-544.533] (-543.871) (-545.706) * (-543.839) (-546.800) (-542.054) [-542.091] -- 0:01:05
      44500 -- [-543.771] (-545.420) (-545.938) (-544.511) * [-543.561] (-542.197) (-541.648) (-543.759) -- 0:01:04
      45000 -- (-542.390) (-543.555) (-546.011) [-545.787] * (-542.339) (-544.097) [-543.562] (-542.342) -- 0:01:03

      Average standard deviation of split frequencies: 0.031283

      45500 -- (-544.569) [-543.444] (-545.335) (-545.680) * [-541.958] (-547.501) (-547.215) (-544.258) -- 0:01:02
      46000 -- [-542.699] (-546.858) (-547.160) (-543.475) * (-544.584) (-543.426) [-544.360] (-546.776) -- 0:01:02
      46500 -- [-542.995] (-553.138) (-545.242) (-546.760) * [-548.268] (-543.799) (-544.262) (-543.633) -- 0:01:01
      47000 -- (-542.917) (-546.953) [-542.452] (-544.221) * (-543.291) (-542.195) (-543.034) [-544.518] -- 0:01:00
      47500 -- (-542.295) (-544.338) [-542.896] (-542.077) * (-543.482) (-545.224) [-543.313] (-543.970) -- 0:01:00
      48000 -- [-543.378] (-545.239) (-543.026) (-542.663) * (-544.815) (-544.615) (-545.003) [-544.441] -- 0:00:59
      48500 -- (-545.212) [-544.056] (-543.115) (-544.642) * (-544.871) (-543.774) (-544.935) [-542.990] -- 0:00:58
      49000 -- [-543.030] (-544.558) (-543.186) (-543.219) * (-544.328) [-546.713] (-544.566) (-544.229) -- 0:00:58
      49500 -- [-542.471] (-544.470) (-546.236) (-544.919) * (-543.088) (-547.629) (-543.421) [-543.736] -- 0:00:57
      50000 -- (-542.656) (-543.475) [-544.691] (-542.174) * (-542.422) (-551.978) [-542.868] (-542.518) -- 0:00:57

      Average standard deviation of split frequencies: 0.030497

      50500 -- (-547.035) (-544.795) (-544.989) [-542.629] * (-542.591) (-547.349) (-545.106) [-544.368] -- 0:00:56
      51000 -- (-542.686) (-543.290) (-545.070) [-544.183] * (-542.509) (-550.134) (-545.731) [-542.037] -- 0:00:55
      51500 -- (-544.347) (-543.151) [-544.014] (-544.760) * (-544.232) (-543.423) (-543.408) [-542.953] -- 0:00:55
      52000 -- (-548.411) (-542.206) (-547.890) [-544.483] * (-543.136) [-544.321] (-546.120) (-542.835) -- 0:00:54
      52500 -- (-544.989) (-544.721) (-543.162) [-545.140] * (-543.177) [-544.002] (-548.161) (-544.530) -- 0:00:54
      53000 -- (-545.395) (-542.713) [-545.830] (-546.096) * (-542.195) [-544.034] (-542.893) (-545.092) -- 0:00:53
      53500 -- [-541.670] (-543.282) (-545.067) (-542.835) * (-542.391) [-542.259] (-544.698) (-545.427) -- 0:00:53
      54000 -- (-542.078) (-544.038) [-544.518] (-547.632) * [-541.769] (-544.759) (-548.502) (-544.885) -- 0:00:52
      54500 -- [-543.103] (-542.975) (-543.280) (-543.146) * (-542.628) [-542.747] (-544.550) (-542.654) -- 0:00:52
      55000 -- (-542.807) (-545.343) [-541.862] (-544.403) * (-546.157) [-544.526] (-541.582) (-541.917) -- 0:00:51

      Average standard deviation of split frequencies: 0.029684

      55500 -- (-543.768) (-542.550) [-541.899] (-543.150) * (-544.272) (-545.174) (-543.908) [-543.560] -- 0:00:51
      56000 -- (-544.361) [-542.382] (-544.400) (-543.246) * (-542.893) (-545.318) (-544.564) [-542.759] -- 0:01:07
      56500 -- (-544.544) [-546.973] (-544.620) (-543.307) * (-547.556) [-544.463] (-543.564) (-544.693) -- 0:01:06
      57000 -- [-543.707] (-544.755) (-541.925) (-548.895) * (-550.011) [-545.022] (-542.279) (-543.350) -- 0:01:06
      57500 -- (-547.126) [-544.824] (-543.274) (-552.049) * [-545.853] (-545.273) (-543.243) (-544.645) -- 0:01:05
      58000 -- [-544.283] (-544.802) (-543.824) (-542.952) * [-544.185] (-544.503) (-545.914) (-542.621) -- 0:01:04
      58500 -- [-542.748] (-543.595) (-548.310) (-547.107) * (-543.285) [-542.408] (-548.720) (-545.411) -- 0:01:04
      59000 -- (-544.566) (-543.619) [-542.454] (-545.570) * (-543.560) [-542.093] (-541.621) (-548.760) -- 0:01:03
      59500 -- [-544.729] (-543.820) (-547.013) (-543.666) * (-542.344) (-541.621) (-544.040) [-545.314] -- 0:01:03
      60000 -- [-544.139] (-545.162) (-545.524) (-543.049) * (-542.733) [-544.302] (-544.697) (-544.209) -- 0:01:02

      Average standard deviation of split frequencies: 0.025038

      60500 -- [-543.145] (-544.043) (-543.382) (-543.277) * (-541.729) [-545.616] (-543.762) (-542.247) -- 0:01:02
      61000 -- [-544.400] (-544.045) (-547.774) (-543.552) * (-543.658) (-543.101) (-543.287) [-543.426] -- 0:01:01
      61500 -- [-543.424] (-546.850) (-544.972) (-543.873) * (-545.331) [-542.571] (-541.660) (-544.340) -- 0:01:01
      62000 -- (-542.645) (-544.652) [-544.260] (-544.204) * (-546.040) (-544.024) [-541.621] (-542.752) -- 0:01:00
      62500 -- (-546.992) (-546.176) (-544.202) [-542.872] * (-543.280) [-543.566] (-546.341) (-544.625) -- 0:01:00
      63000 -- (-547.015) (-545.915) [-543.116] (-543.706) * [-543.015] (-543.351) (-545.799) (-543.510) -- 0:00:59
      63500 -- (-544.823) (-543.707) (-544.645) [-543.035] * (-547.387) [-545.277] (-545.348) (-545.898) -- 0:00:58
      64000 -- (-544.000) (-543.435) [-546.354] (-542.569) * (-545.271) (-543.174) [-544.835] (-545.264) -- 0:00:58
      64500 -- (-547.976) [-547.715] (-547.805) (-543.419) * [-547.900] (-545.829) (-553.290) (-543.576) -- 0:00:58
      65000 -- (-545.614) (-548.669) (-545.750) [-545.356] * (-543.927) (-544.677) [-542.809] (-545.151) -- 0:00:57

      Average standard deviation of split frequencies: 0.022179

      65500 -- (-545.656) (-549.890) [-543.420] (-544.952) * [-543.320] (-545.331) (-543.399) (-547.045) -- 0:00:57
      66000 -- (-548.132) (-544.585) [-543.570] (-548.376) * [-542.976] (-547.610) (-545.843) (-545.429) -- 0:00:56
      66500 -- (-546.879) [-542.894] (-546.154) (-546.661) * (-547.196) [-545.876] (-545.381) (-548.005) -- 0:00:56
      67000 -- (-549.913) (-542.609) (-542.686) [-545.930] * (-544.433) (-542.729) [-546.810] (-545.835) -- 0:00:55
      67500 -- (-543.227) (-541.946) [-542.144] (-542.580) * (-543.318) [-544.195] (-542.580) (-544.223) -- 0:00:55
      68000 -- [-542.570] (-545.496) (-542.753) (-545.336) * (-542.999) [-544.375] (-544.047) (-546.482) -- 0:00:54
      68500 -- [-544.189] (-542.233) (-543.916) (-546.583) * (-544.630) [-545.297] (-544.267) (-547.091) -- 0:00:54
      69000 -- [-545.047] (-543.055) (-544.735) (-547.655) * [-543.405] (-544.409) (-543.652) (-542.846) -- 0:00:53
      69500 -- (-545.025) (-542.833) [-545.514] (-543.590) * (-544.452) [-545.515] (-546.805) (-546.065) -- 0:00:53
      70000 -- [-545.779] (-542.575) (-547.029) (-543.906) * (-547.940) (-542.723) (-543.508) [-547.131] -- 0:00:53

      Average standard deviation of split frequencies: 0.019059

      70500 -- (-543.805) (-545.027) [-543.924] (-547.704) * (-546.020) [-544.532] (-545.953) (-547.021) -- 0:00:52
      71000 -- (-543.648) (-543.119) (-543.934) [-543.490] * (-547.977) (-545.625) (-547.429) [-544.379] -- 0:00:52
      71500 -- (-543.165) (-542.491) [-543.721] (-545.457) * (-543.207) (-544.087) (-545.790) [-545.928] -- 0:00:51
      72000 -- (-543.779) (-543.575) [-544.459] (-544.101) * (-541.854) (-547.157) [-543.598] (-543.099) -- 0:00:51
      72500 -- (-544.607) (-546.168) [-542.194] (-544.499) * [-545.359] (-543.298) (-543.972) (-546.161) -- 0:00:51
      73000 -- (-544.995) (-544.350) (-542.870) [-544.655] * (-541.952) (-543.592) [-542.882] (-545.547) -- 0:01:03
      73500 -- [-542.316] (-545.544) (-544.630) (-545.504) * (-542.130) [-543.464] (-545.981) (-545.942) -- 0:01:03
      74000 -- (-541.888) (-543.622) [-543.063] (-546.655) * (-544.233) (-542.860) [-544.413] (-544.299) -- 0:01:02
      74500 -- (-544.324) [-541.843] (-544.554) (-543.394) * (-548.879) (-547.308) (-543.075) [-544.563] -- 0:01:02
      75000 -- (-542.504) (-542.004) (-542.934) [-542.652] * (-542.489) (-545.726) [-543.505] (-543.104) -- 0:01:01

      Average standard deviation of split frequencies: 0.023505

      75500 -- (-541.656) (-542.457) (-542.664) [-543.231] * (-546.629) [-545.905] (-546.544) (-547.035) -- 0:01:01
      76000 -- (-548.255) (-544.731) (-543.484) [-545.381] * (-542.800) (-544.091) [-543.210] (-543.263) -- 0:01:00
      76500 -- (-543.554) (-541.833) [-542.892] (-544.790) * (-543.037) [-545.947] (-546.027) (-543.543) -- 0:01:00
      77000 -- (-541.616) (-542.731) (-543.068) [-542.801] * (-541.723) (-545.901) (-545.761) [-544.704] -- 0:00:59
      77500 -- [-542.082] (-544.254) (-545.347) (-544.250) * [-545.097] (-545.593) (-547.137) (-543.783) -- 0:00:59
      78000 -- (-545.447) (-543.723) [-542.128] (-547.817) * (-543.781) (-546.219) (-544.104) [-543.512] -- 0:00:59
      78500 -- (-546.355) (-546.675) (-546.321) [-544.363] * (-542.376) [-542.294] (-548.130) (-542.946) -- 0:00:58
      79000 -- (-544.633) [-545.312] (-547.976) (-545.464) * (-543.821) [-544.993] (-544.822) (-542.168) -- 0:00:58
      79500 -- (-545.564) (-545.837) (-547.064) [-543.988] * (-545.504) (-542.926) (-544.387) [-543.502] -- 0:00:57
      80000 -- (-543.832) (-542.787) [-544.308] (-543.937) * (-545.905) [-549.961] (-543.801) (-544.844) -- 0:00:57

      Average standard deviation of split frequencies: 0.025973

      80500 -- (-543.397) (-542.912) [-544.747] (-542.562) * (-544.707) (-541.867) (-543.301) [-543.150] -- 0:00:57
      81000 -- (-546.141) (-546.960) (-545.490) [-543.110] * (-544.820) (-543.176) [-542.488] (-542.480) -- 0:00:56
      81500 -- [-550.876] (-545.942) (-543.556) (-542.049) * (-544.916) (-543.087) (-542.480) [-542.344] -- 0:00:56
      82000 -- (-554.889) (-544.779) (-543.189) [-545.366] * (-545.341) [-545.347] (-545.484) (-542.967) -- 0:00:55
      82500 -- (-546.457) (-546.207) (-543.670) [-542.387] * [-544.552] (-546.649) (-544.843) (-542.745) -- 0:00:55
      83000 -- (-547.774) [-542.288] (-542.968) (-542.443) * (-544.388) (-545.938) (-544.456) [-545.585] -- 0:00:55
      83500 -- [-543.018] (-542.267) (-544.423) (-548.834) * (-543.973) (-544.818) (-543.665) [-543.983] -- 0:00:54
      84000 -- (-544.803) (-544.106) [-542.234] (-549.021) * [-543.554] (-548.748) (-542.912) (-543.127) -- 0:00:54
      84500 -- (-547.013) (-545.099) [-542.537] (-545.378) * (-543.717) (-545.338) (-544.847) [-543.983] -- 0:00:54
      85000 -- [-545.317] (-543.198) (-544.010) (-544.842) * (-543.966) (-543.529) [-542.286] (-547.497) -- 0:00:53

      Average standard deviation of split frequencies: 0.021926

      85500 -- (-546.296) [-544.651] (-543.962) (-543.585) * (-543.882) (-545.462) [-543.459] (-544.905) -- 0:00:53
      86000 -- (-543.546) (-545.299) [-543.954] (-545.250) * (-542.767) [-543.184] (-546.169) (-545.551) -- 0:00:53
      86500 -- (-546.670) [-543.752] (-548.355) (-544.413) * (-543.621) (-544.636) (-544.861) [-545.165] -- 0:00:52
      87000 -- (-544.312) (-545.615) (-543.246) [-544.157] * (-544.070) (-543.508) [-542.182] (-543.172) -- 0:00:52
      87500 -- (-543.265) (-544.207) [-543.074] (-542.840) * (-542.727) (-545.159) [-542.253] (-548.020) -- 0:00:52
      88000 -- [-544.894] (-543.738) (-544.873) (-547.114) * (-543.995) (-543.844) [-542.258] (-544.915) -- 0:00:51
      88500 -- (-544.199) (-542.307) [-542.210] (-544.372) * (-542.249) (-543.077) (-543.030) [-543.487] -- 0:00:51
      89000 -- (-544.224) (-542.153) [-544.841] (-543.290) * (-543.471) (-543.576) (-545.768) [-544.063] -- 0:00:51
      89500 -- (-542.230) (-543.704) (-545.835) [-544.136] * (-542.018) (-543.978) [-548.392] (-544.553) -- 0:00:50
      90000 -- (-543.782) (-543.274) (-544.193) [-542.749] * (-543.895) [-542.440] (-545.241) (-543.184) -- 0:01:00

      Average standard deviation of split frequencies: 0.023917

      90500 -- [-543.731] (-543.327) (-542.616) (-543.529) * [-546.265] (-546.319) (-543.121) (-543.643) -- 0:01:00
      91000 -- [-543.023] (-541.707) (-543.507) (-542.731) * (-547.048) (-542.653) [-542.704] (-542.105) -- 0:00:59
      91500 -- [-543.124] (-543.614) (-545.277) (-542.241) * (-543.046) [-544.425] (-543.285) (-545.430) -- 0:00:59
      92000 -- (-543.290) (-546.810) (-545.401) [-544.235] * (-542.529) (-546.310) (-541.978) [-545.188] -- 0:00:59
      92500 -- [-543.807] (-543.038) (-544.252) (-545.724) * (-544.222) [-542.397] (-542.289) (-547.149) -- 0:00:58
      93000 -- (-543.996) (-543.351) (-542.585) [-545.292] * (-542.198) [-543.182] (-542.384) (-543.920) -- 0:00:58
      93500 -- (-542.393) (-543.444) (-543.732) [-542.164] * (-542.568) [-545.350] (-542.110) (-546.546) -- 0:00:58
      94000 -- (-544.625) [-546.949] (-545.378) (-543.961) * (-541.877) (-543.943) [-544.617] (-543.309) -- 0:00:57
      94500 -- [-542.056] (-547.372) (-542.547) (-542.891) * (-543.243) (-544.915) (-542.575) [-545.856] -- 0:00:57
      95000 -- [-541.654] (-543.937) (-542.769) (-545.800) * (-542.617) (-547.589) [-543.811] (-542.279) -- 0:00:57

      Average standard deviation of split frequencies: 0.024294

      95500 -- (-548.390) (-542.872) [-542.721] (-546.790) * (-544.467) (-547.182) [-543.249] (-548.012) -- 0:00:56
      96000 -- (-544.406) [-543.556] (-545.702) (-547.707) * (-544.170) (-546.838) [-543.759] (-544.392) -- 0:00:56
      96500 -- [-543.789] (-544.427) (-544.702) (-543.813) * (-543.509) (-544.718) [-543.048] (-542.082) -- 0:00:56
      97000 -- [-543.438] (-541.824) (-547.956) (-543.895) * (-543.786) (-543.624) (-545.505) [-543.569] -- 0:00:55
      97500 -- (-543.682) (-546.230) (-548.235) [-544.323] * (-543.989) (-542.667) (-551.259) [-547.278] -- 0:00:55
      98000 -- (-545.579) (-545.355) [-544.728] (-542.395) * [-543.396] (-542.141) (-546.747) (-549.262) -- 0:00:55
      98500 -- (-545.837) (-542.300) (-543.017) [-541.493] * (-544.185) [-544.929] (-545.797) (-542.980) -- 0:00:54
      99000 -- (-549.646) (-542.555) [-546.744] (-544.448) * [-541.877] (-544.177) (-544.739) (-542.630) -- 0:00:54
      99500 -- (-545.837) [-543.163] (-544.541) (-543.072) * (-542.418) (-544.122) [-544.887] (-543.968) -- 0:00:54
      100000 -- (-547.364) [-543.202] (-544.718) (-541.808) * (-544.865) (-542.616) [-543.039] (-542.946) -- 0:00:54

      Average standard deviation of split frequencies: 0.026372

      100500 -- (-546.428) (-543.350) (-546.132) [-543.438] * (-545.175) (-542.916) (-541.784) [-543.925] -- 0:00:53
      101000 -- (-545.404) (-545.616) [-544.552] (-541.597) * (-545.807) (-542.552) [-544.031] (-544.406) -- 0:00:53
      101500 -- (-543.753) (-544.601) [-542.222] (-541.770) * (-545.190) [-542.639] (-546.252) (-544.823) -- 0:00:53
      102000 -- (-545.719) (-542.335) (-541.885) [-542.698] * [-543.113] (-541.977) (-542.198) (-542.703) -- 0:00:52
      102500 -- (-542.841) (-544.274) [-542.271] (-545.232) * (-546.660) [-541.943] (-543.417) (-543.643) -- 0:00:52
      103000 -- [-544.225] (-542.601) (-542.018) (-541.792) * [-543.450] (-544.381) (-545.756) (-543.502) -- 0:00:52
      103500 -- [-542.462] (-545.447) (-542.591) (-542.000) * (-545.235) [-542.003] (-544.422) (-543.673) -- 0:00:51
      104000 -- (-542.987) [-544.063] (-542.755) (-542.766) * (-546.955) (-542.978) (-542.853) [-544.102] -- 0:00:51
      104500 -- (-543.582) (-547.516) (-545.472) [-542.036] * [-546.611] (-545.127) (-542.100) (-542.463) -- 0:00:51
      105000 -- (-543.920) [-542.485] (-543.580) (-542.327) * (-549.443) (-544.685) (-543.053) [-542.412] -- 0:00:51

      Average standard deviation of split frequencies: 0.024237

      105500 -- [-542.411] (-543.239) (-545.445) (-543.565) * (-550.288) [-545.137] (-545.037) (-542.902) -- 0:00:50
      106000 -- (-543.223) (-543.196) (-544.513) [-541.882] * (-546.033) (-543.215) (-545.349) [-542.418] -- 0:00:50
      106500 -- [-542.704] (-544.749) (-542.356) (-543.633) * [-542.075] (-542.173) (-543.660) (-544.795) -- 0:00:58
      107000 -- (-544.193) (-543.883) [-542.525] (-543.174) * (-542.337) (-542.323) [-542.158] (-542.951) -- 0:00:58
      107500 -- (-545.469) (-544.347) (-542.013) [-545.816] * [-542.258] (-545.802) (-547.021) (-549.031) -- 0:00:58
      108000 -- [-544.712] (-542.917) (-542.676) (-545.681) * (-542.529) [-548.473] (-542.017) (-548.436) -- 0:00:57
      108500 -- (-542.511) [-543.073] (-543.181) (-544.764) * (-545.222) [-543.046] (-543.231) (-546.128) -- 0:00:57
      109000 -- (-545.665) (-543.585) [-542.707] (-545.780) * (-541.852) [-541.700] (-542.899) (-542.667) -- 0:00:57
      109500 -- (-545.109) [-545.688] (-542.364) (-546.131) * (-544.266) (-543.926) (-543.083) [-541.780] -- 0:00:56
      110000 -- (-550.254) (-544.232) (-543.688) [-543.197] * (-545.405) [-543.166] (-542.218) (-543.311) -- 0:00:56

      Average standard deviation of split frequencies: 0.021747

      110500 -- (-544.044) [-545.403] (-544.200) (-541.728) * (-544.683) (-543.129) (-546.521) [-542.225] -- 0:00:56
      111000 -- [-546.848] (-544.998) (-542.543) (-544.704) * [-546.710] (-543.292) (-543.944) (-542.960) -- 0:00:56
      111500 -- (-542.363) (-547.410) (-547.935) [-545.742] * [-543.819] (-542.979) (-544.099) (-546.289) -- 0:00:55
      112000 -- (-544.126) (-544.584) (-542.604) [-545.213] * (-542.804) (-544.018) (-542.746) [-544.166] -- 0:00:55
      112500 -- (-543.881) (-543.373) (-545.184) [-543.935] * (-542.370) [-545.993] (-543.614) (-546.751) -- 0:00:55
      113000 -- (-543.469) (-545.847) (-543.448) [-542.823] * [-544.263] (-542.976) (-546.458) (-543.115) -- 0:00:54
      113500 -- [-543.306] (-544.599) (-542.068) (-542.958) * (-543.523) (-543.453) (-544.112) [-545.425] -- 0:00:54
      114000 -- (-543.288) (-543.554) [-542.473] (-542.432) * [-543.789] (-542.922) (-542.216) (-545.590) -- 0:00:54
      114500 -- [-544.078] (-547.013) (-545.660) (-546.366) * [-543.975] (-544.670) (-546.338) (-542.650) -- 0:00:54
      115000 -- (-546.060) [-543.537] (-543.567) (-543.188) * (-547.379) (-544.187) (-543.924) [-544.606] -- 0:00:53

      Average standard deviation of split frequencies: 0.018897

      115500 -- [-543.489] (-542.371) (-542.156) (-544.457) * [-544.796] (-543.353) (-543.275) (-544.509) -- 0:00:53
      116000 -- (-545.922) (-542.869) (-542.343) [-544.006] * (-543.978) (-542.687) (-542.854) [-543.172] -- 0:00:53
      116500 -- [-544.630] (-545.057) (-542.928) (-544.578) * [-542.889] (-542.148) (-545.278) (-543.467) -- 0:00:53
      117000 -- (-544.604) (-544.108) [-544.194] (-542.980) * (-542.089) (-544.244) [-541.628] (-545.202) -- 0:00:52
      117500 -- (-551.462) (-546.096) (-548.932) [-544.952] * [-543.718] (-545.458) (-542.076) (-545.688) -- 0:00:52
      118000 -- [-542.851] (-545.130) (-545.894) (-545.919) * (-543.896) (-541.930) [-542.217] (-544.058) -- 0:00:52
      118500 -- [-544.674] (-546.703) (-549.122) (-543.708) * (-545.556) [-541.645] (-542.588) (-545.711) -- 0:00:52
      119000 -- (-544.075) [-548.939] (-551.778) (-544.320) * (-544.597) (-541.948) (-546.223) [-553.501] -- 0:00:51
      119500 -- [-542.998] (-548.145) (-549.275) (-544.422) * [-543.234] (-541.545) (-545.435) (-546.115) -- 0:00:51
      120000 -- [-544.919] (-542.906) (-546.015) (-544.981) * [-543.114] (-542.532) (-547.380) (-542.787) -- 0:00:51

      Average standard deviation of split frequencies: 0.020119

      120500 -- (-542.091) [-546.655] (-544.145) (-544.316) * (-545.991) [-544.100] (-545.609) (-542.263) -- 0:00:51
      121000 -- [-543.933] (-545.689) (-543.477) (-542.714) * (-543.354) (-548.170) (-542.825) [-542.637] -- 0:00:50
      121500 -- (-544.919) [-542.778] (-542.947) (-542.708) * (-542.839) (-544.243) (-543.394) [-542.873] -- 0:00:50
      122000 -- [-543.336] (-544.182) (-541.888) (-542.963) * (-543.572) (-546.136) [-544.640] (-543.602) -- 0:00:50
      122500 -- (-544.310) (-547.885) [-545.674] (-547.506) * (-542.962) (-545.259) [-547.906] (-543.041) -- 0:00:50
      123000 -- [-542.259] (-546.038) (-545.431) (-542.790) * [-543.373] (-544.524) (-545.765) (-543.304) -- 0:00:49
      123500 -- (-545.182) (-547.251) (-546.792) [-542.974] * (-545.574) (-542.334) (-546.635) [-543.332] -- 0:00:56
      124000 -- (-544.003) [-544.314] (-541.507) (-544.472) * (-545.458) [-544.406] (-542.783) (-543.272) -- 0:00:56
      124500 -- (-547.486) [-542.298] (-544.550) (-544.998) * (-548.239) [-543.438] (-542.981) (-543.453) -- 0:00:56
      125000 -- (-546.019) (-543.422) (-548.244) [-543.541] * [-542.321] (-543.408) (-542.226) (-544.138) -- 0:00:56

      Average standard deviation of split frequencies: 0.022261

      125500 -- (-544.654) [-543.500] (-544.454) (-543.249) * [-542.382] (-544.994) (-546.614) (-543.603) -- 0:00:55
      126000 -- [-543.883] (-544.441) (-542.672) (-542.799) * (-543.070) (-542.591) [-543.129] (-543.595) -- 0:00:55
      126500 -- (-545.510) (-545.932) (-543.685) [-544.206] * [-542.795] (-542.589) (-542.852) (-542.763) -- 0:00:55
      127000 -- (-542.472) [-542.782] (-544.886) (-542.485) * [-541.991] (-544.305) (-545.576) (-547.292) -- 0:00:54
      127500 -- (-542.105) (-543.050) [-543.970] (-548.758) * [-541.812] (-546.022) (-542.976) (-544.886) -- 0:00:54
      128000 -- (-542.733) [-543.795] (-544.854) (-542.802) * [-542.375] (-543.401) (-542.242) (-546.201) -- 0:00:54
      128500 -- (-546.256) [-542.663] (-544.874) (-543.309) * (-543.431) (-543.511) [-542.317] (-546.728) -- 0:00:54
      129000 -- [-543.821] (-545.018) (-543.732) (-543.099) * [-542.017] (-542.711) (-542.391) (-542.236) -- 0:00:54
      129500 -- (-542.633) (-543.634) (-546.167) [-542.769] * (-541.877) (-544.791) (-542.200) [-545.860] -- 0:00:53
      130000 -- (-545.043) (-545.533) (-547.208) [-542.989] * (-544.842) (-543.805) [-542.529] (-543.286) -- 0:00:53

      Average standard deviation of split frequencies: 0.021466

      130500 -- (-544.199) (-545.785) [-546.039] (-542.526) * (-542.177) [-542.533] (-544.748) (-542.282) -- 0:00:53
      131000 -- (-547.027) (-544.238) (-543.568) [-543.658] * (-543.161) [-542.624] (-543.129) (-544.196) -- 0:00:53
      131500 -- (-545.213) (-546.355) [-542.745] (-547.384) * (-544.424) (-542.068) (-545.093) [-544.094] -- 0:00:52
      132000 -- (-543.710) [-544.994] (-546.561) (-545.022) * (-543.592) (-545.021) [-546.088] (-543.232) -- 0:00:52
      132500 -- (-544.461) (-542.447) (-546.481) [-543.123] * (-543.375) (-542.528) (-546.121) [-544.371] -- 0:00:52
      133000 -- (-547.143) (-545.218) (-550.545) [-543.044] * (-547.468) [-545.036] (-545.273) (-543.475) -- 0:00:52
      133500 -- [-548.628] (-547.194) (-549.950) (-544.624) * (-546.022) (-543.035) (-543.221) [-543.326] -- 0:00:51
      134000 -- (-548.353) (-543.693) (-543.634) [-544.574] * (-542.294) [-545.444] (-543.016) (-542.828) -- 0:00:51
      134500 -- (-542.661) (-543.554) (-543.037) [-543.585] * [-541.839] (-545.982) (-542.414) (-543.583) -- 0:00:51
      135000 -- (-543.275) (-546.417) (-544.942) [-542.400] * (-542.525) (-547.645) [-543.457] (-542.937) -- 0:00:51

      Average standard deviation of split frequencies: 0.022530

      135500 -- (-543.522) [-543.196] (-543.079) (-543.215) * (-541.979) (-543.631) (-545.207) [-542.795] -- 0:00:51
      136000 -- (-543.564) (-541.680) (-547.192) [-544.707] * (-542.207) (-545.022) (-544.899) [-544.824] -- 0:00:50
      136500 -- [-543.479] (-548.031) (-543.244) (-544.692) * (-543.664) [-541.675] (-548.197) (-544.956) -- 0:00:50
      137000 -- (-543.597) [-544.515] (-546.574) (-544.157) * (-544.868) (-545.097) [-543.243] (-546.688) -- 0:00:50
      137500 -- (-546.973) (-547.071) [-545.206] (-542.723) * [-541.939] (-546.138) (-543.403) (-544.439) -- 0:00:50
      138000 -- (-543.303) (-547.032) (-543.817) [-550.686] * (-544.378) (-547.209) [-546.674] (-542.605) -- 0:00:49
      138500 -- (-543.591) (-542.959) (-544.676) [-543.317] * [-545.092] (-549.848) (-545.652) (-545.333) -- 0:00:49
      139000 -- (-543.557) [-541.887] (-541.905) (-546.185) * [-544.260] (-547.582) (-543.140) (-542.236) -- 0:00:49
      139500 -- [-542.191] (-542.578) (-543.177) (-543.460) * [-544.681] (-546.161) (-543.093) (-549.098) -- 0:00:49
      140000 -- [-542.133] (-545.753) (-545.572) (-542.018) * [-545.525] (-543.771) (-544.979) (-543.272) -- 0:00:55

      Average standard deviation of split frequencies: 0.020945

      140500 -- (-541.803) [-544.613] (-543.312) (-547.565) * [-545.203] (-554.167) (-545.160) (-546.988) -- 0:00:55
      141000 -- (-546.951) [-546.911] (-543.553) (-544.001) * [-546.053] (-544.947) (-543.261) (-545.317) -- 0:00:54
      141500 -- (-542.725) (-545.065) (-548.272) [-543.823] * (-542.279) (-546.441) (-542.899) [-543.773] -- 0:00:54
      142000 -- (-547.213) (-548.444) (-546.005) [-544.804] * (-548.557) (-544.627) [-542.833] (-543.595) -- 0:00:54
      142500 -- (-544.816) [-544.278] (-550.135) (-543.949) * (-542.370) [-544.364] (-544.049) (-542.701) -- 0:00:54
      143000 -- [-543.463] (-544.581) (-546.703) (-543.702) * [-542.319] (-542.698) (-544.245) (-545.608) -- 0:00:53
      143500 -- (-542.479) (-542.580) (-546.166) [-545.890] * (-543.110) (-546.555) [-544.245] (-545.951) -- 0:00:53
      144000 -- (-542.044) (-542.995) [-545.084] (-542.247) * (-543.273) (-544.083) (-545.441) [-544.848] -- 0:00:53
      144500 -- (-545.127) (-544.229) [-543.087] (-544.893) * [-542.381] (-543.342) (-546.493) (-545.308) -- 0:00:53
      145000 -- (-544.154) (-543.144) (-543.826) [-543.753] * [-543.839] (-542.391) (-543.346) (-543.715) -- 0:00:53

      Average standard deviation of split frequencies: 0.021281

      145500 -- (-543.599) (-545.661) [-544.805] (-543.055) * (-544.251) [-545.626] (-542.723) (-547.881) -- 0:00:52
      146000 -- (-542.163) [-544.593] (-543.914) (-542.919) * (-545.673) [-544.219] (-543.530) (-545.854) -- 0:00:52
      146500 -- [-544.134] (-545.405) (-549.816) (-545.282) * (-547.573) (-542.281) [-542.386] (-545.997) -- 0:00:52
      147000 -- (-544.844) (-544.554) [-547.887] (-542.658) * (-543.730) [-542.069] (-542.581) (-543.688) -- 0:00:52
      147500 -- [-544.453] (-541.964) (-544.815) (-542.845) * (-543.367) (-541.598) (-547.503) [-542.854] -- 0:00:52
      148000 -- (-546.384) [-544.106] (-543.552) (-543.393) * [-542.098] (-546.247) (-546.675) (-546.912) -- 0:00:51
      148500 -- (-544.775) (-543.958) (-546.290) [-542.955] * (-546.300) (-546.083) [-542.657] (-542.494) -- 0:00:51
      149000 -- (-542.222) (-543.235) [-544.714] (-542.871) * (-545.984) [-545.305] (-544.830) (-543.664) -- 0:00:51
      149500 -- (-543.759) (-547.577) (-543.080) [-543.372] * (-544.509) (-544.310) (-544.731) [-544.865] -- 0:00:51
      150000 -- (-549.610) (-546.132) [-544.619] (-544.635) * (-544.757) (-544.755) (-545.132) [-544.094] -- 0:00:51

      Average standard deviation of split frequencies: 0.021902

      150500 -- [-542.000] (-546.352) (-543.333) (-548.724) * (-543.566) [-545.246] (-543.774) (-547.248) -- 0:00:50
      151000 -- (-542.210) [-544.458] (-542.056) (-545.995) * (-544.946) [-546.388] (-543.687) (-544.248) -- 0:00:50
      151500 -- (-545.265) [-542.223] (-542.389) (-547.348) * [-542.615] (-543.358) (-542.151) (-544.032) -- 0:00:50
      152000 -- (-543.676) [-544.802] (-545.558) (-545.040) * [-543.781] (-543.085) (-542.352) (-542.453) -- 0:00:50
      152500 -- (-543.042) (-543.670) (-544.904) [-542.322] * [-546.494] (-545.467) (-543.063) (-543.501) -- 0:00:50
      153000 -- [-542.504] (-543.969) (-543.138) (-543.703) * (-544.419) (-549.010) [-544.542] (-542.916) -- 0:00:49
      153500 -- (-545.559) (-542.037) (-545.910) [-541.886] * [-544.266] (-544.071) (-543.265) (-544.577) -- 0:00:49
      154000 -- (-545.685) [-542.141] (-545.774) (-550.385) * (-544.938) (-542.227) [-542.254] (-546.822) -- 0:00:49
      154500 -- [-543.430] (-542.873) (-543.437) (-545.736) * (-543.586) [-542.714] (-545.056) (-543.789) -- 0:00:49
      155000 -- [-543.679] (-543.434) (-545.532) (-543.103) * (-544.286) [-542.195] (-548.925) (-542.474) -- 0:00:49

      Average standard deviation of split frequencies: 0.021908

      155500 -- (-548.176) [-542.430] (-544.767) (-545.605) * (-546.327) [-543.238] (-542.714) (-546.463) -- 0:00:48
      156000 -- (-543.321) (-543.149) [-542.879] (-549.169) * (-542.982) (-543.725) [-543.260] (-546.951) -- 0:00:48
      156500 -- (-542.763) (-543.929) (-547.982) [-546.560] * (-543.340) (-543.132) (-542.675) [-543.807] -- 0:00:53
      157000 -- (-544.472) (-542.218) (-545.272) [-544.887] * [-542.917] (-543.477) (-545.149) (-543.149) -- 0:00:53
      157500 -- (-547.812) (-543.162) [-544.166] (-544.969) * (-543.448) (-542.784) [-547.581] (-546.038) -- 0:00:53
      158000 -- (-543.885) (-543.961) (-542.432) [-548.416] * (-543.122) (-542.528) (-542.235) [-544.379] -- 0:00:53
      158500 -- (-543.493) (-543.597) (-544.831) [-545.416] * (-542.670) (-543.767) [-544.174] (-547.141) -- 0:00:53
      159000 -- (-545.220) [-544.833] (-545.077) (-542.299) * (-544.968) (-543.715) [-545.229] (-543.522) -- 0:00:52
      159500 -- (-543.014) [-546.716] (-544.543) (-542.248) * [-544.125] (-543.806) (-545.412) (-542.185) -- 0:00:52
      160000 -- [-542.585] (-547.265) (-548.744) (-544.163) * (-543.786) (-543.633) (-541.646) [-542.276] -- 0:00:52

      Average standard deviation of split frequencies: 0.022855

      160500 -- (-547.479) (-542.653) [-546.624] (-544.563) * (-543.053) [-543.233] (-545.824) (-542.948) -- 0:00:52
      161000 -- [-543.607] (-542.319) (-546.545) (-544.450) * (-543.134) (-542.920) (-542.129) [-541.939] -- 0:00:52
      161500 -- (-541.924) (-545.646) [-544.718] (-542.356) * (-544.577) (-545.265) (-549.986) [-542.263] -- 0:00:51
      162000 -- (-542.352) [-542.707] (-547.180) (-543.799) * (-542.801) [-548.983] (-548.500) (-542.812) -- 0:00:51
      162500 -- (-547.617) (-544.136) (-541.820) [-541.713] * (-542.638) (-545.066) [-544.959] (-544.392) -- 0:00:51
      163000 -- (-553.544) (-543.545) (-545.441) [-543.517] * [-542.501] (-543.714) (-542.527) (-545.088) -- 0:00:51
      163500 -- (-548.794) (-545.009) [-543.036] (-543.925) * [-544.436] (-542.082) (-542.592) (-547.466) -- 0:00:51
      164000 -- (-543.799) [-544.711] (-542.552) (-544.266) * (-545.895) [-542.452] (-542.577) (-545.161) -- 0:00:50
      164500 -- (-543.453) (-543.040) [-543.794] (-545.651) * (-542.726) [-545.043] (-543.481) (-550.646) -- 0:00:50
      165000 -- [-542.773] (-542.625) (-542.792) (-547.726) * (-541.969) (-544.665) [-542.254] (-548.223) -- 0:00:50

      Average standard deviation of split frequencies: 0.018459

      165500 -- (-547.281) (-544.171) [-543.098] (-545.021) * (-542.011) (-543.217) (-548.924) [-544.398] -- 0:00:50
      166000 -- (-541.796) (-543.717) [-544.062] (-542.034) * (-545.061) (-545.182) (-542.066) [-546.226] -- 0:00:50
      166500 -- (-542.461) [-541.801] (-547.743) (-543.074) * (-543.762) [-544.630] (-546.168) (-542.864) -- 0:00:50
      167000 -- (-542.153) (-542.738) (-545.977) [-542.376] * [-543.465] (-546.101) (-543.268) (-544.538) -- 0:00:49
      167500 -- (-544.056) (-543.547) (-544.514) [-542.141] * (-547.605) [-550.784] (-545.474) (-546.361) -- 0:00:49
      168000 -- [-544.982] (-542.791) (-543.404) (-542.516) * [-542.234] (-545.784) (-542.639) (-542.946) -- 0:00:49
      168500 -- [-544.329] (-545.283) (-544.085) (-545.684) * (-542.449) (-546.620) [-543.010] (-541.664) -- 0:00:49
      169000 -- (-544.108) (-544.637) [-541.781] (-543.795) * (-541.642) [-545.454] (-544.587) (-544.480) -- 0:00:49
      169500 -- [-543.027] (-547.224) (-542.904) (-542.614) * (-541.904) (-542.238) [-545.750] (-543.723) -- 0:00:48
      170000 -- (-543.292) (-547.406) [-542.830] (-542.500) * [-542.253] (-542.403) (-546.133) (-544.205) -- 0:00:48

      Average standard deviation of split frequencies: 0.023115

      170500 -- (-547.613) [-544.485] (-544.416) (-542.535) * (-542.496) [-543.958] (-544.227) (-546.798) -- 0:00:48
      171000 -- (-543.757) [-546.950] (-544.710) (-545.089) * [-544.378] (-541.667) (-545.724) (-544.603) -- 0:00:48
      171500 -- (-543.617) [-542.385] (-543.356) (-545.949) * (-546.022) (-544.005) (-543.903) [-543.387] -- 0:00:48
      172000 -- [-543.138] (-542.720) (-543.681) (-546.008) * (-544.886) (-544.157) [-542.462] (-543.186) -- 0:00:48
      172500 -- (-543.209) [-545.361] (-542.006) (-545.470) * (-544.681) (-543.464) (-546.971) [-544.703] -- 0:00:47
      173000 -- (-542.399) [-541.612] (-542.367) (-543.007) * (-543.944) (-545.286) (-547.398) [-543.407] -- 0:00:47
      173500 -- (-543.526) (-544.786) (-545.055) [-543.742] * (-542.446) [-543.461] (-546.268) (-543.767) -- 0:00:52
      174000 -- (-543.733) (-542.584) [-543.019] (-546.309) * [-543.932] (-544.559) (-546.079) (-546.483) -- 0:00:52
      174500 -- (-544.050) (-542.354) [-545.118] (-543.508) * (-542.657) [-542.380] (-542.562) (-544.222) -- 0:00:52
      175000 -- [-545.688] (-542.663) (-542.239) (-542.861) * (-546.243) (-543.356) (-543.052) [-543.050] -- 0:00:51

      Average standard deviation of split frequencies: 0.023542

      175500 -- (-548.233) (-542.421) (-543.898) [-543.761] * [-545.989] (-545.784) (-542.614) (-545.821) -- 0:00:51
      176000 -- [-543.513] (-544.214) (-543.881) (-543.305) * [-543.865] (-542.705) (-543.428) (-550.094) -- 0:00:51
      176500 -- [-546.111] (-543.235) (-542.686) (-544.102) * (-545.620) (-543.226) [-551.021] (-543.777) -- 0:00:51
      177000 -- (-543.011) [-542.125] (-544.234) (-543.978) * (-545.023) (-543.576) [-543.796] (-542.627) -- 0:00:51
      177500 -- (-546.836) (-543.734) (-543.256) [-543.640] * [-544.688] (-550.380) (-546.340) (-545.320) -- 0:00:50
      178000 -- (-542.895) (-548.061) [-542.449] (-542.361) * [-543.322] (-547.253) (-548.110) (-543.679) -- 0:00:50
      178500 -- [-541.939] (-543.491) (-542.114) (-543.062) * (-542.657) (-542.424) [-543.075] (-545.020) -- 0:00:50
      179000 -- [-543.371] (-546.854) (-544.441) (-545.770) * [-544.840] (-547.323) (-545.271) (-542.261) -- 0:00:50
      179500 -- (-546.473) (-546.919) [-542.188] (-544.518) * (-546.150) (-546.207) [-543.901] (-542.475) -- 0:00:50
      180000 -- (-542.224) [-543.583] (-542.693) (-543.320) * (-546.801) (-543.873) [-544.974] (-543.791) -- 0:00:50

      Average standard deviation of split frequencies: 0.023637

      180500 -- [-543.546] (-545.426) (-543.407) (-543.500) * (-546.314) (-543.992) (-544.007) [-543.329] -- 0:00:49
      181000 -- (-542.362) (-544.310) (-547.108) [-542.938] * (-546.029) (-543.596) (-545.908) [-543.966] -- 0:00:49
      181500 -- [-543.347] (-544.952) (-542.641) (-541.987) * [-543.168] (-546.943) (-543.839) (-547.931) -- 0:00:49
      182000 -- (-544.158) (-543.151) (-543.889) [-542.410] * (-546.457) [-543.095] (-545.390) (-544.220) -- 0:00:49
      182500 -- (-543.047) [-544.291] (-543.311) (-545.093) * (-543.546) (-543.648) [-544.750] (-544.131) -- 0:00:49
      183000 -- (-543.413) (-543.099) (-544.282) [-543.205] * (-543.528) [-542.701] (-542.941) (-544.662) -- 0:00:49
      183500 -- (-543.855) [-544.248] (-544.383) (-543.689) * (-543.296) (-546.197) [-542.532] (-547.299) -- 0:00:48
      184000 -- (-544.334) (-545.559) (-544.403) [-544.573] * (-542.850) (-552.503) (-543.059) [-543.008] -- 0:00:48
      184500 -- [-544.529] (-543.133) (-544.421) (-543.440) * (-543.560) (-544.018) (-543.615) [-542.543] -- 0:00:48
      185000 -- (-543.653) (-542.260) [-543.426] (-542.943) * [-545.728] (-546.055) (-546.177) (-544.929) -- 0:00:48

      Average standard deviation of split frequencies: 0.022943

      185500 -- (-545.333) [-544.576] (-549.867) (-541.827) * (-544.864) (-547.356) [-544.852] (-546.963) -- 0:00:48
      186000 -- (-543.332) (-541.804) (-546.113) [-547.374] * [-544.356] (-544.542) (-546.081) (-546.409) -- 0:00:48
      186500 -- (-542.100) (-542.920) (-543.704) [-543.330] * (-545.635) [-542.092] (-543.493) (-550.668) -- 0:00:47
      187000 -- (-545.790) (-544.849) [-542.476] (-544.035) * (-543.001) (-542.214) [-542.231] (-549.202) -- 0:00:47
      187500 -- (-544.524) [-544.831] (-543.042) (-545.350) * (-543.358) (-543.494) (-543.164) [-544.359] -- 0:00:47
      188000 -- (-545.058) [-545.866] (-542.422) (-544.342) * (-543.339) [-542.986] (-542.357) (-544.386) -- 0:00:47
      188500 -- (-546.104) [-543.148] (-543.887) (-543.738) * (-544.583) (-547.546) [-545.513] (-543.443) -- 0:00:47
      189000 -- [-544.352] (-542.863) (-543.466) (-543.096) * (-544.043) (-542.642) (-544.309) [-545.481] -- 0:00:47
      189500 -- (-541.931) [-544.612] (-543.426) (-543.381) * [-542.986] (-544.333) (-543.690) (-544.964) -- 0:00:47
      190000 -- (-542.479) (-543.641) [-543.147] (-545.354) * (-542.442) (-545.007) [-542.770] (-544.720) -- 0:00:46

      Average standard deviation of split frequencies: 0.021991

      190500 -- [-543.099] (-542.534) (-546.285) (-543.606) * (-544.566) [-544.444] (-544.663) (-545.078) -- 0:00:50
      191000 -- [-543.882] (-551.158) (-543.676) (-544.911) * [-544.135] (-545.027) (-544.671) (-543.416) -- 0:00:50
      191500 -- (-544.784) [-546.491] (-546.105) (-542.192) * (-543.030) [-544.152] (-548.135) (-547.881) -- 0:00:50
      192000 -- (-543.630) (-542.162) (-542.725) [-546.337] * (-542.491) [-545.121] (-542.181) (-543.176) -- 0:00:50
      192500 -- [-544.178] (-542.811) (-542.445) (-545.788) * (-543.184) [-541.893] (-542.789) (-546.437) -- 0:00:50
      193000 -- (-543.194) (-543.732) (-544.233) [-543.343] * (-544.379) (-543.179) (-542.830) [-545.370] -- 0:00:50
      193500 -- [-542.744] (-544.088) (-545.418) (-544.361) * (-545.476) (-544.500) [-542.969] (-544.374) -- 0:00:50
      194000 -- (-543.381) (-545.851) [-542.716] (-545.060) * [-543.575] (-544.637) (-544.033) (-545.296) -- 0:00:49
      194500 -- [-544.481] (-542.936) (-542.927) (-543.535) * (-542.843) (-544.589) [-542.408] (-542.341) -- 0:00:49
      195000 -- (-543.097) [-543.926] (-545.017) (-542.488) * (-546.332) [-543.016] (-543.908) (-544.900) -- 0:00:49

      Average standard deviation of split frequencies: 0.022279

      195500 -- (-543.338) [-541.590] (-545.611) (-545.154) * (-543.851) (-543.187) (-543.967) [-543.260] -- 0:00:49
      196000 -- (-543.532) [-543.265] (-548.913) (-542.977) * (-542.216) (-543.104) (-545.324) [-542.712] -- 0:00:49
      196500 -- (-544.346) [-544.409] (-543.280) (-542.483) * (-542.437) (-542.654) [-543.762] (-547.389) -- 0:00:49
      197000 -- (-542.644) [-543.702] (-542.201) (-545.801) * [-544.267] (-547.252) (-543.632) (-546.005) -- 0:00:48
      197500 -- [-541.866] (-542.794) (-543.563) (-543.251) * (-545.421) [-544.805] (-543.902) (-544.987) -- 0:00:48
      198000 -- [-546.109] (-544.437) (-548.985) (-542.919) * (-542.985) (-542.850) [-545.296] (-542.876) -- 0:00:48
      198500 -- [-543.067] (-546.530) (-543.557) (-542.278) * [-544.695] (-543.561) (-545.674) (-541.946) -- 0:00:48
      199000 -- (-544.165) [-546.892] (-545.132) (-545.413) * [-543.267] (-545.102) (-547.259) (-542.463) -- 0:00:48
      199500 -- (-547.693) (-545.181) (-544.107) [-543.318] * [-542.908] (-542.004) (-548.046) (-543.717) -- 0:00:48
      200000 -- (-545.719) [-545.731] (-546.381) (-545.809) * [-542.987] (-542.806) (-543.482) (-542.733) -- 0:00:48

      Average standard deviation of split frequencies: 0.024275

      200500 -- [-542.620] (-542.951) (-541.930) (-542.501) * (-544.431) (-543.629) (-542.579) [-545.621] -- 0:00:47
      201000 -- (-543.517) [-543.931] (-545.981) (-544.153) * (-543.484) (-544.566) (-542.739) [-542.563] -- 0:00:47
      201500 -- [-543.536] (-546.254) (-546.303) (-546.097) * (-545.786) (-542.710) [-544.126] (-543.607) -- 0:00:47
      202000 -- (-543.793) [-549.748] (-547.362) (-542.717) * (-544.592) [-543.612] (-543.456) (-544.803) -- 0:00:47
      202500 -- (-542.973) [-544.457] (-543.192) (-543.685) * (-544.008) (-544.821) (-542.069) [-543.857] -- 0:00:47
      203000 -- (-542.406) (-545.966) (-544.622) [-543.567] * (-546.541) [-544.721] (-542.649) (-552.198) -- 0:00:47
      203500 -- [-542.718] (-543.980) (-543.718) (-543.868) * (-544.515) (-544.088) (-542.885) [-541.746] -- 0:00:46
      204000 -- (-543.816) (-544.522) [-543.861] (-544.299) * (-543.165) (-542.607) (-545.294) [-541.859] -- 0:00:46
      204500 -- (-544.646) (-541.841) [-542.186] (-544.799) * (-543.136) (-548.525) (-544.716) [-542.440] -- 0:00:46
      205000 -- (-545.025) (-541.722) (-543.145) [-544.808] * (-544.254) (-543.412) (-543.218) [-542.539] -- 0:00:46

      Average standard deviation of split frequencies: 0.021282

      205500 -- [-542.785] (-543.834) (-542.826) (-543.102) * [-543.674] (-543.776) (-542.607) (-548.050) -- 0:00:46
      206000 -- (-544.354) (-545.958) [-541.933] (-542.135) * (-546.913) (-541.849) [-545.554] (-545.039) -- 0:00:46
      206500 -- (-543.703) [-542.106] (-542.326) (-543.966) * (-543.636) [-544.570] (-548.600) (-545.205) -- 0:00:46
      207000 -- (-543.171) (-542.381) (-545.248) [-547.549] * (-543.681) (-542.491) (-542.891) [-543.034] -- 0:00:49
      207500 -- (-543.885) (-542.007) [-543.156] (-547.133) * (-543.549) (-544.003) [-544.005] (-542.304) -- 0:00:49
      208000 -- (-543.953) (-544.183) [-545.359] (-543.084) * [-543.377] (-543.187) (-546.539) (-543.291) -- 0:00:49
      208500 -- (-544.490) (-542.422) [-542.601] (-544.542) * (-546.473) (-544.028) [-542.811] (-544.056) -- 0:00:49
      209000 -- (-547.876) (-544.615) [-546.277] (-544.875) * (-544.298) (-543.930) [-544.512] (-543.375) -- 0:00:49
      209500 -- (-544.247) (-542.221) [-544.062] (-545.993) * (-543.313) [-542.143] (-547.206) (-542.025) -- 0:00:49
      210000 -- (-543.007) [-546.962] (-542.443) (-545.424) * [-543.301] (-542.580) (-545.213) (-547.480) -- 0:00:48

      Average standard deviation of split frequencies: 0.021370

      210500 -- (-542.317) [-546.752] (-542.065) (-544.706) * [-544.875] (-541.794) (-544.046) (-548.319) -- 0:00:48
      211000 -- [-542.276] (-545.938) (-545.806) (-543.113) * [-544.069] (-544.060) (-545.153) (-545.479) -- 0:00:48
      211500 -- (-543.338) [-545.025] (-544.359) (-544.413) * (-543.112) (-544.643) [-542.978] (-542.987) -- 0:00:48
      212000 -- (-548.582) (-547.679) [-542.916] (-543.097) * (-544.443) (-542.753) [-543.233] (-542.569) -- 0:00:48
      212500 -- [-543.683] (-549.045) (-544.924) (-545.647) * (-543.099) (-543.428) (-541.819) [-544.714] -- 0:00:48
      213000 -- (-543.389) [-544.227] (-544.973) (-547.562) * (-542.472) (-547.157) (-544.586) [-544.108] -- 0:00:48
      213500 -- (-543.291) (-542.962) [-542.857] (-548.152) * [-542.644] (-544.555) (-547.454) (-542.637) -- 0:00:47
      214000 -- (-544.530) [-543.739] (-545.947) (-542.342) * (-543.738) (-544.392) [-542.772] (-543.596) -- 0:00:47
      214500 -- [-544.253] (-544.225) (-544.049) (-544.017) * (-545.666) [-544.992] (-542.032) (-542.783) -- 0:00:47
      215000 -- (-545.713) [-545.741] (-545.635) (-543.479) * [-544.685] (-544.960) (-542.622) (-549.641) -- 0:00:47

      Average standard deviation of split frequencies: 0.021365

      215500 -- (-546.470) (-543.679) [-543.274] (-544.498) * (-549.180) (-542.913) (-544.253) [-544.558] -- 0:00:47
      216000 -- [-547.943] (-541.726) (-544.569) (-543.935) * (-546.651) [-542.928] (-542.775) (-546.203) -- 0:00:47
      216500 -- (-541.611) (-547.994) (-542.087) [-544.460] * [-545.909] (-548.039) (-542.935) (-542.461) -- 0:00:47
      217000 -- [-541.843] (-545.671) (-542.615) (-543.888) * (-546.162) (-546.582) [-542.288] (-546.017) -- 0:00:46
      217500 -- (-544.686) [-541.870] (-543.154) (-544.798) * (-550.272) (-543.576) [-542.614] (-542.368) -- 0:00:46
      218000 -- (-547.603) [-542.204] (-547.530) (-551.099) * (-549.482) (-542.559) (-547.505) [-544.541] -- 0:00:46
      218500 -- (-544.484) [-544.408] (-543.399) (-545.521) * [-544.526] (-544.481) (-542.670) (-546.302) -- 0:00:46
      219000 -- [-543.692] (-547.435) (-542.540) (-543.912) * (-544.691) (-542.435) [-543.436] (-546.204) -- 0:00:46
      219500 -- (-543.822) (-542.107) [-544.827] (-544.764) * [-542.829] (-544.894) (-542.886) (-544.882) -- 0:00:46
      220000 -- [-545.374] (-542.622) (-544.844) (-543.979) * (-543.218) [-544.974] (-543.573) (-545.417) -- 0:00:46

      Average standard deviation of split frequencies: 0.022150

      220500 -- [-544.925] (-545.609) (-545.963) (-546.097) * [-543.566] (-542.503) (-544.859) (-544.170) -- 0:00:45
      221000 -- (-545.120) [-544.047] (-543.699) (-543.934) * [-546.818] (-543.411) (-548.520) (-543.992) -- 0:00:45
      221500 -- [-548.172] (-543.032) (-545.606) (-543.786) * (-547.745) [-543.752] (-545.287) (-544.883) -- 0:00:45
      222000 -- [-542.783] (-545.161) (-544.650) (-548.919) * (-542.856) [-542.751] (-546.623) (-547.305) -- 0:00:45
      222500 -- (-543.722) [-545.683] (-546.621) (-543.204) * (-542.238) [-545.251] (-545.082) (-543.083) -- 0:00:45
      223000 -- (-542.834) (-542.945) (-545.738) [-544.966] * [-542.150] (-542.800) (-547.058) (-545.202) -- 0:00:45
      223500 -- (-546.516) (-543.527) [-543.024] (-542.015) * (-542.835) (-542.961) [-544.931] (-543.687) -- 0:00:48
      224000 -- (-546.340) [-542.152] (-544.505) (-543.029) * (-545.959) (-550.820) (-543.239) [-543.792] -- 0:00:48
      224500 -- (-549.666) (-541.904) (-543.491) [-544.035] * (-545.275) [-543.418] (-542.785) (-545.537) -- 0:00:48
      225000 -- (-545.008) [-543.113] (-543.887) (-544.729) * [-544.591] (-544.236) (-542.615) (-553.799) -- 0:00:48

      Average standard deviation of split frequencies: 0.021517

      225500 -- (-545.639) (-546.547) [-542.190] (-543.137) * (-541.702) [-545.916] (-542.615) (-543.532) -- 0:00:48
      226000 -- (-543.383) [-544.121] (-544.379) (-546.145) * [-543.042] (-543.936) (-545.064) (-544.080) -- 0:00:47
      226500 -- (-543.987) [-542.375] (-543.577) (-543.446) * (-542.799) (-544.423) [-543.724] (-544.444) -- 0:00:47
      227000 -- [-542.496] (-545.483) (-546.991) (-545.281) * (-543.077) (-543.540) [-542.690] (-544.703) -- 0:00:47
      227500 -- (-544.327) (-545.942) (-548.175) [-543.941] * [-545.054] (-546.023) (-543.130) (-542.782) -- 0:00:47
      228000 -- (-547.007) (-545.392) (-543.701) [-543.774] * (-544.201) [-544.488] (-543.546) (-546.778) -- 0:00:47
      228500 -- (-543.468) (-544.938) (-542.951) [-542.091] * (-543.091) [-545.953] (-542.999) (-544.292) -- 0:00:47
      229000 -- [-543.042] (-542.120) (-542.016) (-542.200) * [-542.602] (-543.017) (-543.100) (-544.451) -- 0:00:47
      229500 -- [-547.547] (-542.932) (-543.132) (-545.460) * (-545.120) (-543.635) (-542.455) [-545.375] -- 0:00:47
      230000 -- (-545.299) (-542.039) (-544.020) [-545.969] * (-547.307) (-546.074) (-542.381) [-556.026] -- 0:00:46

      Average standard deviation of split frequencies: 0.020891

      230500 -- (-544.878) [-542.021] (-546.386) (-547.387) * (-542.053) (-542.670) [-543.134] (-546.226) -- 0:00:46
      231000 -- (-549.153) (-543.524) [-541.588] (-549.147) * (-542.851) (-547.708) [-542.800] (-545.790) -- 0:00:46
      231500 -- (-545.646) [-542.423] (-545.376) (-542.756) * (-545.899) [-545.794] (-544.482) (-543.187) -- 0:00:46
      232000 -- (-542.764) (-542.885) (-544.031) [-543.742] * (-542.378) [-545.339] (-543.881) (-547.053) -- 0:00:46
      232500 -- [-541.907] (-542.832) (-542.699) (-542.436) * (-542.017) [-545.529] (-543.665) (-546.776) -- 0:00:46
      233000 -- (-541.856) [-542.736] (-544.529) (-544.832) * (-542.293) (-543.659) [-544.509] (-542.287) -- 0:00:46
      233500 -- (-542.997) (-543.537) [-547.010] (-543.477) * [-542.623] (-545.389) (-544.906) (-545.000) -- 0:00:45
      234000 -- [-546.630] (-543.895) (-546.865) (-543.186) * (-542.241) [-543.406] (-546.008) (-543.581) -- 0:00:45
      234500 -- (-543.020) [-545.172] (-547.556) (-541.615) * [-544.606] (-543.458) (-545.977) (-541.863) -- 0:00:45
      235000 -- (-544.076) (-543.550) (-545.452) [-542.869] * (-542.892) [-545.411] (-545.970) (-548.215) -- 0:00:45

      Average standard deviation of split frequencies: 0.020974

      235500 -- (-542.696) [-541.741] (-546.080) (-543.241) * [-544.009] (-545.028) (-542.143) (-542.054) -- 0:00:45
      236000 -- (-545.515) (-544.338) [-544.419] (-543.327) * [-542.791] (-543.666) (-542.382) (-542.797) -- 0:00:45
      236500 -- [-544.567] (-547.584) (-542.768) (-543.254) * [-542.194] (-543.997) (-546.127) (-544.759) -- 0:00:45
      237000 -- (-546.043) (-544.284) (-548.303) [-545.082] * (-544.746) (-543.753) [-544.178] (-543.138) -- 0:00:45
      237500 -- (-545.127) (-544.544) [-541.982] (-544.422) * (-544.847) (-550.247) (-541.764) [-543.045] -- 0:00:44
      238000 -- [-542.711] (-542.615) (-541.911) (-543.893) * (-544.846) (-547.025) (-544.604) [-542.250] -- 0:00:44
      238500 -- [-543.865] (-541.863) (-543.627) (-544.821) * (-544.918) [-543.907] (-542.141) (-552.226) -- 0:00:44
      239000 -- (-546.571) (-543.718) [-545.448] (-543.785) * (-541.917) (-545.373) (-542.736) [-548.644] -- 0:00:44
      239500 -- (-546.594) (-544.475) [-545.136] (-543.104) * [-542.858] (-542.831) (-541.943) (-547.682) -- 0:00:44
      240000 -- (-546.857) [-542.954] (-543.835) (-541.893) * (-544.694) [-543.711] (-543.202) (-546.064) -- 0:00:44

      Average standard deviation of split frequencies: 0.019832

      240500 -- (-546.997) [-544.494] (-545.208) (-545.567) * (-542.371) (-544.664) (-544.472) [-543.653] -- 0:00:47
      241000 -- [-543.540] (-545.043) (-547.141) (-546.420) * (-545.707) [-542.931] (-543.534) (-544.537) -- 0:00:47
      241500 -- (-547.547) (-542.715) (-543.449) [-547.595] * (-543.763) (-549.459) (-543.785) [-544.294] -- 0:00:47
      242000 -- (-544.730) [-542.043] (-543.943) (-545.659) * (-547.727) (-547.891) (-544.547) [-543.462] -- 0:00:46
      242500 -- (-544.504) (-544.327) (-545.578) [-546.048] * (-544.219) (-550.101) [-542.737] (-545.661) -- 0:00:46
      243000 -- [-543.189] (-541.967) (-545.393) (-547.027) * [-543.490] (-544.526) (-546.412) (-541.967) -- 0:00:46
      243500 -- (-544.718) (-543.474) [-544.750] (-542.476) * [-543.668] (-545.231) (-544.925) (-544.642) -- 0:00:46
      244000 -- (-543.966) (-548.714) (-542.060) [-543.326] * [-543.707] (-542.436) (-543.132) (-546.738) -- 0:00:46
      244500 -- (-547.644) (-544.921) (-543.696) [-545.813] * (-542.388) (-545.737) (-543.399) [-547.573] -- 0:00:46
      245000 -- (-546.654) (-545.499) (-546.916) [-546.520] * (-543.518) (-542.196) [-544.053] (-545.856) -- 0:00:46

      Average standard deviation of split frequencies: 0.019501

      245500 -- [-546.007] (-545.747) (-549.685) (-542.070) * [-542.287] (-545.684) (-543.337) (-543.912) -- 0:00:46
      246000 -- [-542.830] (-545.809) (-544.512) (-544.292) * [-542.285] (-543.166) (-544.838) (-544.339) -- 0:00:45
      246500 -- (-543.925) (-548.318) [-546.262] (-542.707) * (-543.130) [-546.683] (-545.185) (-544.467) -- 0:00:45
      247000 -- (-545.475) [-544.941] (-542.568) (-543.480) * (-543.755) [-543.824] (-543.996) (-543.915) -- 0:00:45
      247500 -- [-543.940] (-543.386) (-543.559) (-543.852) * [-542.837] (-546.040) (-543.744) (-550.640) -- 0:00:45
      248000 -- [-543.320] (-542.869) (-541.974) (-542.598) * (-545.819) [-543.953] (-544.137) (-543.322) -- 0:00:45
      248500 -- [-545.547] (-542.560) (-542.179) (-546.379) * (-545.573) (-547.038) (-546.650) [-544.392] -- 0:00:45
      249000 -- (-546.580) [-543.455] (-548.256) (-545.112) * (-542.602) (-546.647) [-542.352] (-543.562) -- 0:00:45
      249500 -- [-545.150] (-544.105) (-541.930) (-546.731) * (-542.880) (-545.384) [-546.112] (-544.026) -- 0:00:45
      250000 -- (-543.236) [-547.066] (-541.874) (-543.963) * (-544.821) (-547.070) (-542.468) [-543.592] -- 0:00:45

      Average standard deviation of split frequencies: 0.018806

      250500 -- (-543.413) [-547.765] (-541.724) (-542.502) * (-542.632) (-544.443) (-544.210) [-542.796] -- 0:00:44
      251000 -- (-545.470) (-543.167) (-542.758) [-542.663] * (-541.789) [-542.461] (-542.025) (-542.938) -- 0:00:44
      251500 -- (-544.388) (-542.830) (-543.103) [-542.507] * [-542.173] (-542.579) (-543.561) (-542.756) -- 0:00:44
      252000 -- [-543.421] (-545.343) (-543.202) (-547.016) * (-544.905) (-544.284) [-544.204] (-544.598) -- 0:00:44
      252500 -- (-544.028) (-549.725) (-542.942) [-545.532] * (-542.875) (-546.700) [-543.488] (-544.565) -- 0:00:44
      253000 -- (-546.340) (-545.919) (-544.695) [-543.229] * [-545.046] (-547.087) (-543.203) (-542.723) -- 0:00:44
      253500 -- (-544.241) (-544.173) (-542.723) [-542.476] * (-543.609) (-543.771) [-544.284] (-544.518) -- 0:00:44
      254000 -- (-543.540) (-546.154) (-544.030) [-542.010] * [-544.757] (-544.273) (-543.333) (-544.199) -- 0:00:44
      254500 -- (-542.003) (-549.085) (-546.515) [-543.247] * (-543.919) (-542.697) (-542.833) [-542.400] -- 0:00:43
      255000 -- (-546.468) (-542.004) [-543.614] (-543.728) * (-543.715) (-549.759) (-542.486) [-542.825] -- 0:00:43

      Average standard deviation of split frequencies: 0.019281

      255500 -- (-543.547) (-542.014) [-543.244] (-544.373) * (-544.571) (-549.537) [-544.822] (-543.448) -- 0:00:43
      256000 -- (-545.426) (-544.980) (-544.360) [-544.462] * [-542.667] (-542.133) (-545.956) (-546.316) -- 0:00:43
      256500 -- (-543.973) [-543.902] (-545.797) (-542.382) * [-545.690] (-542.944) (-545.317) (-544.848) -- 0:00:43
      257000 -- (-543.844) [-543.358] (-542.345) (-545.158) * (-546.754) [-542.962] (-546.511) (-547.325) -- 0:00:43
      257500 -- (-542.126) (-543.232) (-541.678) [-544.201] * (-547.020) [-542.484] (-543.413) (-544.388) -- 0:00:46
      258000 -- (-542.855) (-543.010) [-544.016] (-544.064) * (-543.566) (-546.736) (-543.922) [-543.082] -- 0:00:46
      258500 -- (-544.002) (-544.641) (-543.669) [-545.672] * (-546.193) (-544.054) [-542.891] (-545.854) -- 0:00:45
      259000 -- (-547.594) (-545.252) [-544.758] (-543.534) * (-543.784) (-542.633) [-542.316] (-545.272) -- 0:00:45
      259500 -- (-552.283) (-547.703) [-543.693] (-543.353) * (-542.732) (-544.276) (-543.357) [-544.180] -- 0:00:45
      260000 -- [-544.238] (-543.580) (-544.952) (-544.485) * (-545.630) (-543.864) [-542.402] (-543.553) -- 0:00:45

      Average standard deviation of split frequencies: 0.018297

      260500 -- [-542.435] (-542.838) (-543.923) (-541.988) * (-546.762) (-543.816) (-542.770) [-544.944] -- 0:00:45
      261000 -- [-544.246] (-545.097) (-544.485) (-542.133) * (-546.723) [-542.257] (-545.305) (-543.766) -- 0:00:45
      261500 -- (-545.000) (-544.707) (-546.576) [-542.572] * [-546.320] (-542.522) (-545.660) (-544.808) -- 0:00:45
      262000 -- (-548.430) [-542.668] (-546.083) (-542.155) * [-544.978] (-543.380) (-543.502) (-541.889) -- 0:00:45
      262500 -- (-543.172) (-544.371) [-543.113] (-545.615) * (-546.749) [-546.691] (-543.177) (-543.483) -- 0:00:44
      263000 -- (-548.030) (-545.226) [-543.018] (-542.432) * [-542.760] (-546.279) (-544.022) (-543.407) -- 0:00:44
      263500 -- (-546.766) (-543.089) (-545.263) [-545.459] * [-543.539] (-544.342) (-543.134) (-544.386) -- 0:00:44
      264000 -- (-544.196) (-543.167) (-543.957) [-545.636] * (-545.563) [-542.430] (-549.053) (-546.245) -- 0:00:44
      264500 -- (-546.201) (-544.443) (-546.068) [-543.951] * (-543.973) [-542.540] (-545.499) (-544.565) -- 0:00:44
      265000 -- (-544.657) [-542.283] (-543.078) (-546.407) * [-543.165] (-542.074) (-542.245) (-545.081) -- 0:00:44

      Average standard deviation of split frequencies: 0.018035

      265500 -- [-544.242] (-542.397) (-542.568) (-550.384) * (-543.976) (-543.663) (-546.138) [-543.418] -- 0:00:44
      266000 -- (-545.151) (-542.457) [-542.452] (-544.753) * (-544.782) (-543.239) (-546.297) [-543.390] -- 0:00:44
      266500 -- [-542.161] (-544.746) (-544.229) (-546.355) * (-542.385) (-542.003) [-542.994] (-542.885) -- 0:00:44
      267000 -- [-545.217] (-544.356) (-542.535) (-546.238) * (-544.007) (-544.699) (-543.930) [-542.103] -- 0:00:43
      267500 -- (-542.722) (-544.872) (-544.074) [-542.496] * (-543.733) (-545.069) (-544.430) [-545.772] -- 0:00:43
      268000 -- (-543.516) (-544.679) [-542.515] (-543.465) * [-543.492] (-542.762) (-550.580) (-544.550) -- 0:00:43
      268500 -- (-543.063) (-544.148) [-544.121] (-543.069) * [-544.246] (-547.977) (-550.212) (-543.741) -- 0:00:43
      269000 -- (-542.759) (-546.178) [-542.709] (-541.762) * (-545.032) (-545.617) (-544.285) [-547.430] -- 0:00:43
      269500 -- (-543.321) [-543.355] (-543.835) (-543.298) * (-544.707) [-548.562] (-543.656) (-542.998) -- 0:00:43
      270000 -- (-541.931) (-544.744) [-545.995] (-542.360) * (-543.065) (-547.725) (-545.950) [-542.794] -- 0:00:43

      Average standard deviation of split frequencies: 0.017724

      270500 -- (-542.134) [-543.101] (-543.942) (-543.001) * [-543.225] (-543.505) (-547.026) (-544.022) -- 0:00:43
      271000 -- (-547.782) [-543.845] (-548.848) (-542.357) * (-544.138) (-545.475) (-546.686) [-543.431] -- 0:00:43
      271500 -- (-543.613) [-543.424] (-545.444) (-541.777) * (-545.391) (-546.090) (-544.110) [-544.551] -- 0:00:42
      272000 -- [-544.846] (-545.124) (-544.152) (-545.918) * (-543.116) (-543.824) [-542.152] (-544.883) -- 0:00:42
      272500 -- (-548.163) (-542.339) (-543.790) [-542.747] * [-544.524] (-546.098) (-541.638) (-542.448) -- 0:00:42
      273000 -- [-543.099] (-542.310) (-546.830) (-547.863) * (-546.105) [-544.165] (-542.120) (-543.554) -- 0:00:42
      273500 -- (-547.579) (-542.920) (-543.329) [-542.544] * (-542.765) [-546.145] (-541.766) (-546.202) -- 0:00:42
      274000 -- (-545.425) (-543.142) (-545.269) [-544.481] * (-543.172) (-542.367) [-543.346] (-547.755) -- 0:00:45
      274500 -- (-544.908) [-547.002] (-547.715) (-542.986) * (-543.096) [-543.393] (-543.607) (-546.019) -- 0:00:44
      275000 -- (-544.123) [-542.386] (-543.221) (-544.591) * (-545.130) (-545.319) (-542.491) [-543.863] -- 0:00:44

      Average standard deviation of split frequencies: 0.016979

      275500 -- (-547.477) (-546.401) (-542.682) [-541.995] * (-544.017) (-543.450) (-550.653) [-544.779] -- 0:00:44
      276000 -- (-547.677) (-545.647) [-541.949] (-542.828) * (-542.050) (-545.366) [-543.719] (-545.449) -- 0:00:44
      276500 -- (-546.406) (-548.171) (-543.759) [-543.428] * (-542.052) (-545.461) (-541.597) [-544.183] -- 0:00:44
      277000 -- [-545.194] (-546.096) (-542.089) (-543.036) * (-542.310) [-542.276] (-542.000) (-544.166) -- 0:00:44
      277500 -- (-542.878) [-543.095] (-542.086) (-542.073) * (-542.109) [-544.863] (-545.926) (-545.366) -- 0:00:44
      278000 -- (-543.277) [-543.164] (-543.008) (-543.328) * (-545.092) (-542.820) (-547.977) [-549.295] -- 0:00:44
      278500 -- (-542.816) (-542.797) (-543.049) [-543.079] * (-543.048) (-543.287) (-548.855) [-545.665] -- 0:00:44
      279000 -- (-542.328) [-542.261] (-546.880) (-544.344) * (-545.700) (-545.677) [-544.527] (-545.404) -- 0:00:43
      279500 -- (-543.217) (-543.604) (-546.594) [-546.144] * (-541.727) (-542.532) [-544.674] (-545.462) -- 0:00:43
      280000 -- (-542.342) (-541.928) (-545.645) [-545.210] * (-544.464) (-542.156) [-544.002] (-543.991) -- 0:00:43

      Average standard deviation of split frequencies: 0.016302

      280500 -- (-542.203) (-543.802) [-543.373] (-543.992) * (-545.124) [-546.293] (-543.397) (-542.223) -- 0:00:43
      281000 -- [-541.816] (-544.875) (-543.352) (-542.629) * [-542.594] (-547.576) (-545.126) (-544.341) -- 0:00:43
      281500 -- (-543.979) (-543.515) [-543.875] (-544.790) * [-542.224] (-542.578) (-543.067) (-543.069) -- 0:00:43
      282000 -- [-543.415] (-542.143) (-542.871) (-547.458) * [-544.386] (-543.757) (-542.367) (-544.466) -- 0:00:43
      282500 -- (-545.068) (-545.009) (-543.511) [-546.330] * [-544.305] (-542.761) (-542.954) (-544.537) -- 0:00:43
      283000 -- (-543.620) (-543.822) [-544.858] (-546.804) * [-543.632] (-547.259) (-547.688) (-548.432) -- 0:00:43
      283500 -- (-542.550) (-544.234) [-545.098] (-545.484) * (-542.744) (-550.117) (-545.068) [-543.537] -- 0:00:42
      284000 -- (-544.789) [-542.070] (-543.286) (-541.667) * (-544.736) (-547.303) [-541.981] (-548.612) -- 0:00:42
      284500 -- (-542.681) [-542.120] (-541.729) (-543.764) * (-548.621) [-542.430] (-542.894) (-545.001) -- 0:00:42
      285000 -- (-545.160) (-543.789) [-542.004] (-541.994) * (-546.676) [-544.482] (-542.450) (-542.904) -- 0:00:42

      Average standard deviation of split frequencies: 0.016483

      285500 -- (-544.056) (-542.563) (-541.841) [-542.443] * (-543.572) (-544.430) [-543.520] (-546.993) -- 0:00:42
      286000 -- (-543.371) (-542.698) (-543.060) [-542.556] * (-544.169) [-543.157] (-543.392) (-546.572) -- 0:00:42
      286500 -- [-545.414] (-547.372) (-545.254) (-542.759) * (-542.372) [-545.193] (-545.190) (-542.808) -- 0:00:42
      287000 -- (-544.545) (-554.274) (-544.867) [-543.692] * (-545.211) (-544.775) (-545.908) [-542.114] -- 0:00:42
      287500 -- (-543.577) (-548.408) [-546.407] (-542.057) * (-544.586) (-545.007) (-542.138) [-542.951] -- 0:00:42
      288000 -- (-543.945) [-542.280] (-544.982) (-542.321) * (-544.333) (-547.657) [-543.517] (-543.199) -- 0:00:42
      288500 -- (-543.407) [-542.537] (-542.973) (-541.969) * [-542.471] (-542.901) (-545.368) (-542.167) -- 0:00:41
      289000 -- [-544.432] (-547.092) (-542.494) (-541.548) * (-544.742) [-543.404] (-543.724) (-542.539) -- 0:00:41
      289500 -- (-546.622) (-547.780) (-543.908) [-541.553] * (-545.672) (-545.343) [-544.227] (-542.096) -- 0:00:41
      290000 -- (-548.172) [-543.435] (-544.244) (-542.752) * (-543.490) (-544.449) (-542.557) [-546.302] -- 0:00:41

      Average standard deviation of split frequencies: 0.015550

      290500 -- (-547.410) (-543.775) [-544.731] (-543.228) * (-545.182) (-545.734) [-543.633] (-545.054) -- 0:00:43
      291000 -- [-545.324] (-544.562) (-544.350) (-548.079) * (-542.200) (-544.319) (-543.254) [-545.159] -- 0:00:43
      291500 -- (-542.175) [-543.819] (-545.072) (-542.933) * (-544.385) (-544.306) [-543.757] (-543.033) -- 0:00:43
      292000 -- (-544.841) [-546.482] (-544.461) (-542.745) * (-546.757) [-544.882] (-542.213) (-543.209) -- 0:00:43
      292500 -- (-550.194) (-545.774) [-543.381] (-543.147) * [-542.011] (-543.340) (-543.010) (-545.173) -- 0:00:43
      293000 -- [-545.990] (-545.777) (-545.678) (-543.226) * (-543.774) [-545.485] (-543.305) (-543.064) -- 0:00:43
      293500 -- [-543.897] (-544.116) (-551.345) (-544.761) * (-543.318) (-545.233) (-543.891) [-542.491] -- 0:00:43
      294000 -- (-544.853) (-542.951) (-544.530) [-544.525] * (-543.241) (-543.145) (-543.597) [-542.049] -- 0:00:43
      294500 -- [-541.906] (-545.442) (-544.228) (-542.542) * (-542.750) (-542.792) [-549.517] (-546.404) -- 0:00:43
      295000 -- (-542.257) [-543.294] (-543.932) (-542.678) * (-545.284) (-542.848) [-543.141] (-542.069) -- 0:00:43

      Average standard deviation of split frequencies: 0.015083

      295500 -- (-544.887) (-545.862) [-542.620] (-544.405) * (-543.689) (-542.067) (-543.120) [-542.660] -- 0:00:42
      296000 -- (-547.295) [-547.665] (-542.969) (-543.766) * (-545.560) [-543.751] (-543.163) (-542.766) -- 0:00:42
      296500 -- (-548.004) (-543.489) [-542.415] (-549.832) * (-543.903) (-549.654) [-542.934] (-543.472) -- 0:00:42
      297000 -- (-545.491) [-544.729] (-546.006) (-546.147) * (-542.253) (-543.169) (-548.696) [-542.725] -- 0:00:42
      297500 -- (-544.056) [-545.392] (-544.183) (-543.002) * [-542.180] (-544.087) (-544.957) (-543.267) -- 0:00:42
      298000 -- (-542.470) [-545.329] (-544.022) (-541.998) * [-543.023] (-542.657) (-544.871) (-543.038) -- 0:00:42
      298500 -- (-544.213) [-544.395] (-546.153) (-545.650) * (-543.209) (-542.457) [-545.043] (-544.270) -- 0:00:42
      299000 -- (-545.647) (-552.529) (-542.924) [-543.127] * (-544.228) [-544.666] (-543.440) (-550.220) -- 0:00:42
      299500 -- (-548.202) (-546.536) (-544.337) [-542.187] * (-542.918) [-545.966] (-544.631) (-542.348) -- 0:00:42
      300000 -- [-545.035] (-545.281) (-545.317) (-544.057) * (-542.512) (-545.127) (-545.927) [-543.537] -- 0:00:42

      Average standard deviation of split frequencies: 0.014756

      300500 -- (-542.526) (-544.611) [-544.071] (-545.215) * [-543.375] (-543.931) (-544.799) (-542.293) -- 0:00:41
      301000 -- (-548.159) (-544.836) [-543.156] (-542.375) * (-542.285) [-542.010] (-543.517) (-545.576) -- 0:00:41
      301500 -- (-544.590) (-544.575) (-545.438) [-546.809] * (-544.428) (-543.953) [-544.753] (-544.198) -- 0:00:41
      302000 -- [-544.493] (-546.114) (-543.221) (-546.747) * [-545.100] (-543.841) (-547.399) (-544.996) -- 0:00:41
      302500 -- [-543.279] (-542.618) (-545.521) (-547.947) * (-547.091) (-544.935) (-544.662) [-544.288] -- 0:00:41
      303000 -- (-543.083) (-545.603) (-542.852) [-544.337] * (-545.586) (-543.955) (-545.869) [-542.986] -- 0:00:41
      303500 -- (-545.592) [-544.775] (-549.561) (-544.138) * (-544.510) (-543.566) (-543.787) [-542.602] -- 0:00:41
      304000 -- (-546.214) [-543.720] (-551.412) (-543.061) * (-545.213) (-545.562) [-542.587] (-542.859) -- 0:00:41
      304500 -- (-542.674) (-544.581) (-551.962) [-544.810] * (-542.245) (-547.515) (-543.145) [-544.748] -- 0:00:41
      305000 -- (-543.511) (-544.185) (-545.287) [-546.309] * (-541.838) [-544.892] (-543.438) (-544.453) -- 0:00:41

      Average standard deviation of split frequencies: 0.013865

      305500 -- (-543.053) (-542.453) [-544.508] (-544.324) * [-542.481] (-545.344) (-541.818) (-545.850) -- 0:00:40
      306000 -- [-542.662] (-545.215) (-543.182) (-545.272) * (-542.414) [-545.265] (-543.753) (-547.645) -- 0:00:40
      306500 -- (-542.643) [-544.243] (-542.225) (-542.480) * [-542.133] (-542.584) (-545.550) (-544.840) -- 0:00:40
      307000 -- (-546.735) (-546.168) [-547.167] (-542.779) * (-544.240) [-542.207] (-544.966) (-548.319) -- 0:00:42
      307500 -- [-547.981] (-543.007) (-543.976) (-542.013) * (-547.388) [-546.684] (-542.355) (-544.647) -- 0:00:42
      308000 -- (-545.893) (-543.225) [-543.203] (-541.927) * (-544.220) (-546.060) (-546.117) [-546.361] -- 0:00:42
      308500 -- (-545.424) [-544.027] (-543.914) (-544.666) * (-546.252) (-542.705) (-546.466) [-542.272] -- 0:00:42
      309000 -- (-542.450) (-544.590) (-545.418) [-544.393] * [-544.905] (-542.894) (-542.926) (-542.206) -- 0:00:42
      309500 -- (-543.277) [-544.900] (-545.914) (-543.228) * (-543.214) (-544.125) (-542.444) [-543.031] -- 0:00:42
      310000 -- (-542.022) (-544.676) (-543.585) [-542.849] * (-543.345) [-542.334] (-544.339) (-548.505) -- 0:00:42

      Average standard deviation of split frequencies: 0.012585

      310500 -- (-545.374) (-543.362) (-543.038) [-544.454] * (-547.085) (-542.237) (-544.568) [-542.087] -- 0:00:42
      311000 -- [-541.981] (-544.786) (-544.031) (-542.375) * [-543.203] (-542.609) (-541.643) (-543.608) -- 0:00:42
      311500 -- [-544.392] (-550.276) (-544.387) (-541.854) * [-543.226] (-542.714) (-549.375) (-542.304) -- 0:00:41
      312000 -- (-551.403) (-543.078) [-544.602] (-543.233) * (-543.517) [-547.321] (-550.144) (-543.274) -- 0:00:41
      312500 -- (-544.006) (-543.844) (-546.508) [-544.033] * [-545.736] (-546.158) (-543.048) (-546.117) -- 0:00:41
      313000 -- (-543.757) (-543.662) (-546.020) [-546.461] * (-543.194) (-546.452) [-543.487] (-542.971) -- 0:00:41
      313500 -- (-543.087) (-544.375) (-549.192) [-542.320] * (-542.651) [-542.242] (-544.085) (-543.602) -- 0:00:41
      314000 -- (-545.082) (-542.246) (-547.910) [-542.236] * (-541.633) (-545.562) [-543.006] (-543.447) -- 0:00:41
      314500 -- (-545.184) (-544.004) [-544.152] (-543.990) * (-542.212) (-542.353) [-542.169] (-544.586) -- 0:00:41
      315000 -- (-548.260) (-543.899) [-545.064] (-543.892) * (-541.557) [-543.694] (-546.217) (-543.787) -- 0:00:41

      Average standard deviation of split frequencies: 0.013426

      315500 -- (-544.874) [-546.779] (-544.243) (-543.401) * [-542.212] (-543.005) (-548.087) (-551.904) -- 0:00:41
      316000 -- (-545.299) [-543.493] (-543.734) (-545.466) * (-546.818) [-543.207] (-546.365) (-546.063) -- 0:00:41
      316500 -- (-544.958) [-543.771] (-543.196) (-542.361) * [-545.753] (-546.180) (-547.319) (-543.794) -- 0:00:41
      317000 -- (-545.018) (-545.508) [-542.026] (-542.560) * (-545.250) [-544.625] (-542.516) (-542.330) -- 0:00:40
      317500 -- (-544.901) (-544.470) [-541.983] (-547.450) * (-543.670) [-542.765] (-542.639) (-544.415) -- 0:00:40
      318000 -- [-542.277] (-544.493) (-542.699) (-546.688) * [-545.205] (-545.334) (-546.292) (-542.946) -- 0:00:40
      318500 -- (-544.853) [-544.254] (-543.783) (-543.652) * (-541.847) [-543.107] (-548.206) (-542.498) -- 0:00:40
      319000 -- (-543.222) [-544.423] (-543.676) (-542.452) * (-544.868) [-544.392] (-554.352) (-546.733) -- 0:00:40
      319500 -- (-544.186) (-544.746) [-544.159] (-544.450) * [-541.515] (-548.165) (-545.278) (-543.973) -- 0:00:40
      320000 -- [-542.612] (-544.775) (-547.066) (-544.044) * (-544.525) (-545.335) (-543.403) [-542.428] -- 0:00:40

      Average standard deviation of split frequencies: 0.011597

      320500 -- (-543.340) [-547.047] (-543.544) (-542.352) * [-545.501] (-542.688) (-543.830) (-543.582) -- 0:00:40
      321000 -- (-544.312) [-544.539] (-543.964) (-542.573) * (-544.541) [-543.567] (-544.869) (-542.715) -- 0:00:40
      321500 -- [-545.620] (-545.819) (-545.171) (-545.379) * (-545.884) [-544.255] (-546.936) (-545.632) -- 0:00:40
      322000 -- [-543.116] (-545.101) (-543.059) (-542.924) * (-543.960) (-544.650) [-542.244] (-541.894) -- 0:00:40
      322500 -- (-544.280) [-543.952] (-543.122) (-542.674) * (-544.564) [-542.529] (-543.507) (-543.306) -- 0:00:39
      323000 -- (-542.364) [-543.161] (-542.378) (-542.871) * (-543.429) (-542.529) (-543.530) [-545.371] -- 0:00:39
      323500 -- [-543.118] (-544.733) (-542.832) (-542.114) * (-542.307) (-549.381) [-546.423] (-549.016) -- 0:00:39
      324000 -- [-544.020] (-545.502) (-542.406) (-542.253) * (-545.089) (-545.892) (-548.223) [-543.656] -- 0:00:41
      324500 -- [-543.265] (-543.325) (-543.990) (-542.320) * [-546.739] (-545.623) (-546.266) (-542.894) -- 0:00:41
      325000 -- (-543.030) [-543.625] (-543.755) (-542.016) * [-542.662] (-543.137) (-544.827) (-542.300) -- 0:00:41

      Average standard deviation of split frequencies: 0.011247

      325500 -- (-547.448) (-546.456) [-543.092] (-545.692) * (-542.182) [-543.192] (-543.983) (-542.918) -- 0:00:41
      326000 -- (-547.406) (-548.025) [-543.584] (-543.976) * (-542.036) (-544.665) [-545.088] (-546.180) -- 0:00:41
      326500 -- (-549.674) (-544.456) [-541.612] (-543.076) * (-542.457) (-542.201) (-546.043) [-550.699] -- 0:00:41
      327000 -- (-549.238) [-546.625] (-542.989) (-542.701) * (-543.226) (-542.870) (-544.134) [-542.141] -- 0:00:41
      327500 -- (-546.569) (-543.799) (-542.627) [-542.687] * [-541.794] (-543.846) (-546.019) (-544.979) -- 0:00:41
      328000 -- [-545.538] (-545.289) (-545.921) (-542.784) * (-542.700) (-543.883) [-544.575] (-544.850) -- 0:00:40
      328500 -- (-545.384) (-545.915) (-547.350) [-543.035] * (-543.296) [-543.348] (-541.907) (-548.434) -- 0:00:40
      329000 -- (-543.609) (-546.298) (-543.890) [-543.762] * (-541.580) (-547.434) (-544.632) [-545.978] -- 0:00:40
      329500 -- (-546.900) [-543.896] (-545.390) (-542.676) * (-543.869) (-544.182) (-547.055) [-543.844] -- 0:00:40
      330000 -- (-546.605) (-543.674) (-543.856) [-544.067] * [-542.878] (-542.878) (-545.610) (-544.636) -- 0:00:40

      Average standard deviation of split frequencies: 0.010986

      330500 -- [-548.085] (-544.144) (-542.371) (-542.542) * (-543.272) (-546.045) [-543.732] (-543.545) -- 0:00:40
      331000 -- (-549.013) (-545.453) (-542.835) [-544.858] * [-541.842] (-544.151) (-542.111) (-542.778) -- 0:00:40
      331500 -- (-543.294) (-544.075) (-545.829) [-544.535] * (-544.386) (-546.198) [-543.755] (-545.374) -- 0:00:40
      332000 -- [-542.840] (-546.965) (-546.082) (-542.935) * (-547.379) [-543.705] (-542.014) (-543.375) -- 0:00:40
      332500 -- [-542.646] (-542.777) (-545.909) (-543.525) * (-544.411) (-545.070) (-544.218) [-543.231] -- 0:00:40
      333000 -- (-547.554) (-542.560) [-543.675] (-543.117) * (-543.992) (-542.717) [-543.865] (-541.956) -- 0:00:40
      333500 -- (-550.891) (-543.277) [-543.122] (-542.596) * (-542.920) (-544.819) [-548.013] (-542.130) -- 0:00:39
      334000 -- (-543.415) (-543.697) [-547.789] (-542.574) * (-542.540) (-543.170) [-543.851] (-541.932) -- 0:00:39
      334500 -- (-547.869) (-548.163) (-547.286) [-546.993] * (-548.777) [-543.334] (-544.476) (-545.560) -- 0:00:39
      335000 -- (-544.926) (-543.466) [-546.264] (-547.126) * [-543.567] (-544.679) (-543.750) (-543.516) -- 0:00:39

      Average standard deviation of split frequencies: 0.010084

      335500 -- (-543.444) (-543.582) [-543.306] (-547.675) * [-543.782] (-543.995) (-549.012) (-548.694) -- 0:00:39
      336000 -- [-542.628] (-543.666) (-543.859) (-544.871) * (-544.536) (-542.184) (-546.440) [-543.559] -- 0:00:39
      336500 -- (-543.388) (-543.678) [-545.371] (-546.806) * (-543.227) [-544.693] (-548.226) (-542.631) -- 0:00:39
      337000 -- [-546.680] (-548.541) (-544.347) (-542.887) * (-547.368) [-543.154] (-543.992) (-543.386) -- 0:00:39
      337500 -- (-546.987) (-549.998) (-543.871) [-543.108] * [-544.542] (-543.702) (-543.267) (-543.117) -- 0:00:39
      338000 -- (-542.567) (-544.917) [-546.202] (-542.414) * [-543.137] (-544.491) (-543.279) (-542.075) -- 0:00:39
      338500 -- (-543.331) (-542.546) [-543.168] (-545.922) * (-546.213) [-544.734] (-554.332) (-542.094) -- 0:00:39
      339000 -- (-543.482) [-543.811] (-544.698) (-544.053) * (-542.328) [-545.637] (-543.386) (-542.835) -- 0:00:38
      339500 -- [-546.141] (-544.562) (-544.567) (-543.266) * (-544.192) [-546.856] (-543.384) (-544.167) -- 0:00:38
      340000 -- [-543.797] (-544.306) (-543.172) (-543.362) * [-543.512] (-542.871) (-543.537) (-542.628) -- 0:00:38

      Average standard deviation of split frequencies: 0.011477

      340500 -- (-542.524) (-542.410) [-543.497] (-542.054) * (-544.201) (-543.688) (-545.117) [-546.078] -- 0:00:38
      341000 -- [-545.435] (-542.111) (-543.525) (-542.021) * (-545.246) [-542.569] (-542.811) (-542.560) -- 0:00:40
      341500 -- (-544.575) (-545.961) [-542.827] (-548.320) * (-554.180) (-545.040) (-545.475) [-542.553] -- 0:00:40
      342000 -- (-546.217) (-547.356) [-543.810] (-544.289) * (-543.260) [-545.896] (-543.497) (-542.216) -- 0:00:40
      342500 -- (-541.961) [-543.072] (-542.659) (-544.617) * [-545.961] (-546.238) (-542.925) (-542.717) -- 0:00:40
      343000 -- (-544.972) [-542.913] (-542.579) (-545.058) * (-542.797) [-543.784] (-543.341) (-548.111) -- 0:00:40
      343500 -- (-541.797) [-542.772] (-544.480) (-543.193) * [-543.075] (-544.472) (-542.997) (-542.075) -- 0:00:40
      344000 -- (-544.804) (-544.768) (-541.973) [-542.372] * [-542.624] (-545.614) (-545.537) (-545.156) -- 0:00:40
      344500 -- (-543.078) (-547.372) (-543.173) [-543.756] * (-544.401) (-542.846) (-541.960) [-545.966] -- 0:00:39
      345000 -- (-542.521) [-543.682] (-549.098) (-549.313) * (-542.920) [-543.314] (-543.629) (-545.923) -- 0:00:39

      Average standard deviation of split frequencies: 0.010900

      345500 -- [-542.461] (-543.904) (-548.279) (-544.771) * (-545.537) (-544.222) (-547.955) [-542.886] -- 0:00:39
      346000 -- (-544.640) [-543.922] (-548.992) (-543.392) * (-543.790) (-542.489) (-546.082) [-542.697] -- 0:00:39
      346500 -- [-543.235] (-543.254) (-542.651) (-543.894) * (-550.879) [-543.254] (-542.956) (-545.683) -- 0:00:39
      347000 -- (-542.726) (-543.094) [-543.813] (-543.001) * (-546.252) (-545.190) [-542.302] (-545.599) -- 0:00:39
      347500 -- [-542.452] (-543.052) (-543.678) (-546.338) * (-544.899) [-546.315] (-542.553) (-549.017) -- 0:00:39
      348000 -- (-542.683) (-543.672) (-546.223) [-545.842] * (-543.727) [-543.110] (-547.165) (-550.335) -- 0:00:39
      348500 -- (-542.735) (-549.201) [-543.421] (-544.346) * (-544.054) [-542.936] (-543.349) (-545.562) -- 0:00:39
      349000 -- [-545.970] (-547.611) (-544.798) (-553.789) * (-544.361) [-544.265] (-543.418) (-544.859) -- 0:00:39
      349500 -- (-547.795) (-545.352) [-546.548] (-542.947) * (-544.162) (-546.257) [-544.018] (-543.227) -- 0:00:39
      350000 -- (-544.822) (-541.943) (-544.366) [-542.499] * (-546.728) [-546.672] (-546.209) (-542.817) -- 0:00:39

      Average standard deviation of split frequencies: 0.011308

      350500 -- (-544.698) [-543.093] (-543.927) (-542.818) * (-547.501) (-544.362) [-546.339] (-543.694) -- 0:00:38
      351000 -- (-542.612) (-543.123) (-543.989) [-542.913] * (-544.528) (-549.755) (-544.950) [-544.259] -- 0:00:38
      351500 -- [-542.126] (-545.186) (-542.163) (-543.425) * (-542.204) (-546.380) (-543.808) [-542.745] -- 0:00:38
      352000 -- (-546.331) (-545.721) [-544.326] (-544.010) * (-546.057) (-542.766) (-543.924) [-544.084] -- 0:00:38
      352500 -- (-548.102) [-547.035] (-545.599) (-546.342) * [-546.020] (-543.504) (-543.516) (-545.126) -- 0:00:38
      353000 -- [-542.483] (-542.677) (-545.320) (-543.235) * (-542.908) (-548.574) (-543.967) [-544.491] -- 0:00:38
      353500 -- (-542.904) (-542.374) [-545.076] (-545.387) * [-542.783] (-547.343) (-544.807) (-547.563) -- 0:00:38
      354000 -- [-543.117] (-547.085) (-548.610) (-543.879) * (-542.726) (-545.470) (-544.740) [-544.262] -- 0:00:38
      354500 -- [-544.123] (-546.215) (-543.245) (-549.461) * [-542.403] (-543.425) (-542.330) (-546.562) -- 0:00:38
      355000 -- (-546.282) [-542.747] (-542.628) (-543.471) * (-544.046) (-541.561) (-543.957) [-544.246] -- 0:00:38

      Average standard deviation of split frequencies: 0.011216

      355500 -- (-543.620) [-541.891] (-544.000) (-546.158) * (-543.887) [-544.480] (-546.478) (-546.032) -- 0:00:38
      356000 -- (-545.592) (-543.362) [-545.674] (-546.854) * (-547.114) (-544.519) (-544.479) [-544.384] -- 0:00:37
      356500 -- (-542.346) (-544.883) [-542.977] (-545.673) * (-547.494) (-545.287) (-542.341) [-544.064] -- 0:00:37
      357000 -- [-543.511] (-544.965) (-545.680) (-543.684) * [-545.023] (-545.562) (-543.869) (-542.346) -- 0:00:37
      357500 -- (-545.478) (-542.824) [-544.508] (-545.495) * [-544.716] (-545.650) (-546.912) (-542.564) -- 0:00:39
      358000 -- (-544.334) (-546.167) (-544.225) [-545.031] * [-543.405] (-542.315) (-548.489) (-542.989) -- 0:00:39
      358500 -- (-543.742) (-546.998) (-544.464) [-545.315] * (-543.552) [-542.274] (-544.933) (-544.506) -- 0:00:39
      359000 -- (-543.633) (-543.120) (-546.597) [-542.930] * (-543.118) (-542.130) (-543.319) [-543.093] -- 0:00:39
      359500 -- (-542.727) (-543.184) [-545.613] (-541.889) * (-549.720) [-543.849] (-544.459) (-542.455) -- 0:00:39
      360000 -- (-543.242) (-545.153) [-542.287] (-543.216) * (-549.221) [-544.642] (-542.403) (-542.881) -- 0:00:39

      Average standard deviation of split frequencies: 0.010610

      360500 -- [-545.715] (-542.581) (-546.825) (-542.089) * [-548.960] (-544.293) (-544.438) (-544.306) -- 0:00:39
      361000 -- (-544.509) (-545.334) (-544.216) [-542.639] * (-546.378) (-544.448) [-544.252] (-543.779) -- 0:00:38
      361500 -- (-544.168) (-543.111) (-546.159) [-545.998] * (-548.600) (-544.277) (-545.685) [-544.587] -- 0:00:38
      362000 -- (-543.058) (-542.892) [-544.310] (-544.454) * (-546.445) (-542.654) [-543.883] (-543.071) -- 0:00:38
      362500 -- (-543.528) [-542.696] (-546.083) (-545.417) * (-544.764) (-543.774) [-542.631] (-545.365) -- 0:00:38
      363000 -- (-543.442) (-543.298) (-544.116) [-543.579] * (-544.119) (-544.670) [-543.633] (-544.034) -- 0:00:38
      363500 -- (-544.470) [-542.328] (-547.399) (-544.635) * [-542.714] (-548.170) (-545.944) (-547.963) -- 0:00:38
      364000 -- (-542.999) (-543.720) [-544.545] (-544.128) * (-543.055) (-547.839) (-545.152) [-548.045] -- 0:00:38
      364500 -- (-542.453) (-543.382) [-544.680] (-543.516) * (-550.220) (-543.719) [-543.400] (-543.776) -- 0:00:38
      365000 -- (-542.714) [-543.012] (-545.545) (-542.136) * (-543.732) (-545.037) (-544.003) [-542.902] -- 0:00:38

      Average standard deviation of split frequencies: 0.010304

      365500 -- [-543.285] (-542.567) (-544.188) (-542.679) * [-545.948] (-543.919) (-546.185) (-544.472) -- 0:00:38
      366000 -- (-543.295) (-543.281) [-544.841] (-544.579) * (-542.762) [-543.442] (-543.629) (-542.469) -- 0:00:38
      366500 -- (-543.609) [-545.326] (-543.016) (-545.197) * [-544.844] (-544.955) (-542.259) (-544.838) -- 0:00:38
      367000 -- (-542.007) (-543.099) [-542.272] (-542.450) * (-542.348) (-545.282) [-544.004] (-544.027) -- 0:00:37
      367500 -- (-543.954) (-544.043) [-543.273] (-544.227) * (-544.146) (-545.621) [-545.253] (-546.073) -- 0:00:37
      368000 -- [-544.272] (-547.707) (-547.484) (-545.986) * (-547.565) (-545.494) [-542.487] (-544.879) -- 0:00:37
      368500 -- (-543.328) [-542.697] (-549.598) (-542.790) * [-544.644] (-542.929) (-541.912) (-545.408) -- 0:00:37
      369000 -- (-541.891) (-543.391) (-543.549) [-542.146] * (-545.106) [-542.808] (-542.588) (-542.926) -- 0:00:37
      369500 -- [-541.857] (-543.944) (-543.897) (-541.840) * (-543.187) (-543.042) (-542.644) [-544.591] -- 0:00:37
      370000 -- (-545.310) [-544.496] (-544.427) (-545.228) * [-542.014] (-542.030) (-542.335) (-543.186) -- 0:00:37

      Average standard deviation of split frequencies: 0.010773

      370500 -- (-546.815) [-542.691] (-549.244) (-544.155) * (-543.217) [-546.656] (-544.066) (-542.639) -- 0:00:37
      371000 -- (-542.077) (-542.654) (-546.527) [-542.429] * (-545.349) (-543.201) (-547.110) [-543.275] -- 0:00:37
      371500 -- (-542.295) (-542.370) [-544.864] (-541.671) * [-543.401] (-543.152) (-545.860) (-542.919) -- 0:00:37
      372000 -- (-544.644) [-545.726] (-544.199) (-547.474) * (-546.218) (-544.402) (-543.502) [-544.650] -- 0:00:37
      372500 -- (-543.744) (-544.130) [-544.307] (-543.662) * [-544.612] (-542.245) (-542.155) (-543.561) -- 0:00:37
      373000 -- (-547.919) [-545.604] (-543.397) (-544.689) * [-545.277] (-545.087) (-542.474) (-542.590) -- 0:00:36
      373500 -- (-544.372) (-546.134) [-543.690] (-546.420) * (-547.838) (-543.414) (-543.614) [-542.587] -- 0:00:36
      374000 -- (-542.039) (-546.349) (-543.361) [-549.573] * (-545.627) (-541.877) [-545.868] (-542.352) -- 0:00:38
      374500 -- [-543.368] (-543.892) (-544.798) (-542.696) * (-543.690) (-544.861) [-543.461] (-544.391) -- 0:00:38
      375000 -- (-543.547) (-544.776) (-547.778) [-543.829] * (-543.394) (-544.006) [-542.415] (-543.526) -- 0:00:38

      Average standard deviation of split frequencies: 0.010108

      375500 -- [-542.683] (-549.160) (-542.595) (-543.465) * (-551.879) (-546.168) [-544.743] (-548.976) -- 0:00:38
      376000 -- (-547.601) (-547.228) [-542.147] (-544.841) * [-548.129] (-545.103) (-543.677) (-544.296) -- 0:00:38
      376500 -- (-544.005) (-546.015) [-543.563] (-544.994) * (-546.578) [-548.686] (-545.360) (-542.956) -- 0:00:38
      377000 -- [-541.987] (-543.318) (-543.500) (-542.307) * (-547.104) [-544.824] (-542.892) (-543.675) -- 0:00:38
      377500 -- (-543.510) [-543.020] (-542.922) (-543.228) * [-552.174] (-542.212) (-543.639) (-542.132) -- 0:00:37
      378000 -- [-542.481] (-542.407) (-542.120) (-543.963) * [-548.380] (-543.811) (-544.652) (-543.041) -- 0:00:37
      378500 -- (-544.281) [-541.750] (-542.425) (-543.805) * (-550.217) (-548.357) (-544.688) [-542.661] -- 0:00:37
      379000 -- (-546.171) [-543.716] (-542.541) (-543.269) * (-542.595) [-544.843] (-542.593) (-543.948) -- 0:00:37
      379500 -- (-542.344) (-542.433) [-542.683] (-541.645) * (-544.509) (-542.670) [-545.611] (-542.575) -- 0:00:37
      380000 -- (-544.317) (-542.507) (-545.460) [-542.381] * (-542.972) (-542.094) (-548.013) [-543.174] -- 0:00:37

      Average standard deviation of split frequencies: 0.008901

      380500 -- (-544.523) (-544.701) [-544.999] (-545.299) * (-543.951) (-544.892) [-547.584] (-543.629) -- 0:00:37
      381000 -- (-543.782) (-550.834) [-542.425] (-542.795) * (-545.288) (-545.252) (-542.753) [-541.758] -- 0:00:37
      381500 -- (-543.164) [-542.817] (-542.760) (-543.196) * (-546.621) (-546.140) [-542.623] (-542.566) -- 0:00:37
      382000 -- [-542.495] (-543.976) (-541.869) (-543.267) * [-545.249] (-542.841) (-548.972) (-548.487) -- 0:00:37
      382500 -- [-542.954] (-543.252) (-544.196) (-547.929) * (-546.906) [-542.726] (-543.702) (-543.437) -- 0:00:37
      383000 -- (-544.048) (-542.900) [-543.720] (-546.678) * (-546.463) (-544.241) [-544.827] (-542.746) -- 0:00:37
      383500 -- (-544.347) (-542.001) (-548.239) [-543.418] * [-542.902] (-544.032) (-543.090) (-543.205) -- 0:00:36
      384000 -- (-542.706) (-542.586) [-542.539] (-542.798) * (-542.276) (-542.636) [-542.869] (-543.415) -- 0:00:36
      384500 -- [-544.673] (-543.397) (-547.179) (-541.719) * (-542.633) [-543.866] (-545.796) (-542.805) -- 0:00:36
      385000 -- (-544.590) (-544.862) [-543.136] (-541.817) * (-544.956) (-542.591) [-545.446] (-545.483) -- 0:00:36

      Average standard deviation of split frequencies: 0.008320

      385500 -- (-544.922) [-541.684] (-544.715) (-543.088) * (-548.413) (-542.830) [-542.555] (-545.629) -- 0:00:36
      386000 -- [-543.175] (-543.204) (-543.713) (-542.870) * (-547.106) [-542.982] (-543.318) (-545.051) -- 0:00:36
      386500 -- (-544.201) [-542.860] (-542.992) (-544.304) * (-543.140) (-542.159) (-544.361) [-546.154] -- 0:00:36
      387000 -- (-543.920) (-547.105) [-543.481] (-542.392) * (-543.140) (-542.766) (-542.749) [-542.983] -- 0:00:36
      387500 -- (-544.597) (-545.562) [-544.034] (-544.330) * (-543.282) [-543.421] (-544.050) (-543.227) -- 0:00:36
      388000 -- (-542.737) (-542.892) [-542.771] (-542.581) * (-544.816) [-543.846] (-542.759) (-545.301) -- 0:00:36
      388500 -- (-547.999) (-542.009) [-543.358] (-543.243) * (-548.413) (-546.324) (-541.800) [-543.248] -- 0:00:36
      389000 -- (-543.798) [-542.185] (-546.486) (-543.983) * (-546.200) [-544.199] (-544.046) (-545.604) -- 0:00:36
      389500 -- [-542.761] (-543.839) (-554.557) (-544.087) * (-548.618) (-545.756) [-543.217] (-543.794) -- 0:00:36
      390000 -- (-544.022) [-543.069] (-543.203) (-543.011) * (-542.283) (-543.097) (-543.770) [-546.253] -- 0:00:35

      Average standard deviation of split frequencies: 0.008371

      390500 -- (-545.543) (-546.971) (-542.252) [-545.531] * [-542.447] (-544.796) (-545.304) (-545.271) -- 0:00:37
      391000 -- (-545.772) [-546.396] (-543.281) (-543.499) * (-547.278) (-543.368) [-543.881] (-545.709) -- 0:00:37
      391500 -- (-545.381) [-544.651] (-543.603) (-547.356) * (-546.292) [-544.368] (-542.672) (-544.007) -- 0:00:37
      392000 -- (-544.804) [-543.767] (-548.988) (-549.561) * (-544.044) [-541.864] (-550.018) (-546.238) -- 0:00:37
      392500 -- [-543.340] (-543.908) (-542.590) (-543.743) * [-542.806] (-547.463) (-545.786) (-545.003) -- 0:00:37
      393000 -- (-546.192) (-543.920) [-543.031] (-543.960) * (-545.229) [-547.780] (-541.581) (-545.670) -- 0:00:37
      393500 -- (-547.809) (-542.215) [-542.150] (-543.071) * (-545.199) (-543.696) [-543.061] (-544.065) -- 0:00:36
      394000 -- [-543.275] (-544.981) (-544.296) (-545.728) * (-546.410) [-543.572] (-543.620) (-546.108) -- 0:00:36
      394500 -- (-542.999) (-545.435) (-547.179) [-544.956] * [-543.864] (-542.875) (-543.435) (-543.839) -- 0:00:36
      395000 -- (-543.893) (-544.406) (-546.503) [-543.525] * (-544.438) (-542.335) (-543.906) [-543.274] -- 0:00:36

      Average standard deviation of split frequencies: 0.007663

      395500 -- (-543.955) (-545.718) (-543.864) [-544.067] * [-545.338] (-541.912) (-543.906) (-547.263) -- 0:00:36
      396000 -- [-544.481] (-542.730) (-543.745) (-542.385) * [-543.801] (-541.782) (-543.241) (-546.965) -- 0:00:36
      396500 -- (-545.243) [-543.570] (-544.464) (-543.387) * (-545.216) (-542.434) (-543.547) [-542.283] -- 0:00:36
      397000 -- (-545.976) (-542.294) (-546.189) [-541.934] * (-543.758) (-542.649) (-544.009) [-541.711] -- 0:00:36
      397500 -- [-546.421] (-543.065) (-549.220) (-542.040) * (-546.116) (-542.199) [-544.348] (-544.843) -- 0:00:36
      398000 -- (-542.714) (-543.031) [-544.096] (-543.015) * (-545.619) (-542.919) (-546.513) [-542.214] -- 0:00:36
      398500 -- (-541.767) (-543.649) [-543.626] (-542.072) * (-542.491) (-544.753) [-544.577] (-544.274) -- 0:00:36
      399000 -- (-545.121) (-545.211) [-546.000] (-542.860) * (-545.942) (-545.126) [-544.077] (-544.184) -- 0:00:36
      399500 -- (-543.281) (-544.100) (-542.146) [-541.837] * (-543.583) (-545.361) [-543.893] (-546.415) -- 0:00:36
      400000 -- (-542.259) [-544.289] (-544.903) (-543.327) * (-546.194) [-543.412] (-542.772) (-542.904) -- 0:00:36

      Average standard deviation of split frequencies: 0.008530

      400500 -- (-542.161) (-544.393) (-549.518) [-542.443] * (-543.272) [-545.084] (-545.093) (-543.677) -- 0:00:35
      401000 -- [-544.784] (-546.075) (-546.674) (-546.861) * (-543.796) (-542.714) [-542.977] (-547.205) -- 0:00:35
      401500 -- [-545.109] (-543.766) (-545.276) (-544.893) * (-547.350) (-543.358) (-544.858) [-544.040] -- 0:00:35
      402000 -- (-542.255) [-542.724] (-545.856) (-543.446) * [-544.197] (-543.545) (-545.072) (-544.889) -- 0:00:35
      402500 -- (-542.041) (-542.027) (-544.144) [-545.599] * (-543.357) (-544.091) [-542.254] (-545.024) -- 0:00:35
      403000 -- (-543.377) (-543.956) [-542.844] (-551.884) * (-544.759) (-549.396) (-541.909) [-545.380] -- 0:00:35
      403500 -- (-542.554) (-549.556) (-542.691) [-543.969] * (-544.185) (-546.045) [-542.050] (-547.651) -- 0:00:35
      404000 -- (-543.108) (-543.739) (-543.475) [-544.628] * (-543.014) (-542.921) (-542.300) [-545.378] -- 0:00:35
      404500 -- (-542.927) (-546.154) (-544.465) [-542.595] * (-542.675) (-541.869) (-541.828) [-543.250] -- 0:00:35
      405000 -- [-542.905] (-544.407) (-545.777) (-546.024) * (-544.495) (-542.060) (-542.307) [-542.726] -- 0:00:35

      Average standard deviation of split frequencies: 0.007718

      405500 -- (-545.392) (-545.196) (-543.207) [-543.368] * [-543.407] (-544.547) (-543.768) (-543.540) -- 0:00:35
      406000 -- (-545.473) (-546.502) [-543.109] (-542.740) * (-542.987) (-545.981) [-542.191] (-545.333) -- 0:00:35
      406500 -- (-544.736) (-545.239) (-543.091) [-542.255] * [-542.371] (-549.742) (-541.956) (-545.603) -- 0:00:35
      407000 -- (-543.677) [-543.331] (-543.132) (-543.219) * (-542.616) (-545.596) [-542.847] (-544.345) -- 0:00:36
      407500 -- [-542.972] (-543.003) (-544.610) (-542.622) * (-543.443) [-543.338] (-544.194) (-543.749) -- 0:00:36
      408000 -- (-542.637) (-542.574) [-546.558] (-542.797) * (-542.800) (-542.553) (-543.667) [-546.962] -- 0:00:36
      408500 -- (-547.012) [-542.820] (-546.443) (-543.813) * (-544.670) [-547.755] (-544.016) (-546.363) -- 0:00:36
      409000 -- (-543.897) [-543.071] (-546.020) (-545.907) * (-542.133) [-543.488] (-542.417) (-543.568) -- 0:00:36
      409500 -- [-544.596] (-543.412) (-545.397) (-543.499) * (-542.624) (-543.672) [-546.988] (-545.801) -- 0:00:36
      410000 -- (-544.163) (-545.298) [-544.203] (-543.052) * [-543.154] (-547.614) (-545.380) (-543.721) -- 0:00:35

      Average standard deviation of split frequencies: 0.007900

      410500 -- (-544.597) (-545.915) (-543.096) [-542.809] * (-543.503) [-543.891] (-544.957) (-543.608) -- 0:00:35
      411000 -- [-543.064] (-546.864) (-547.646) (-544.409) * (-543.984) [-542.843] (-543.748) (-545.948) -- 0:00:35
      411500 -- [-546.784] (-546.264) (-542.306) (-546.763) * (-547.245) [-542.554] (-544.916) (-543.284) -- 0:00:35
      412000 -- [-543.795] (-545.120) (-545.011) (-542.848) * (-544.700) (-542.059) [-543.338] (-546.367) -- 0:00:35
      412500 -- [-543.977] (-545.122) (-549.857) (-542.738) * (-544.660) (-546.247) (-546.060) [-541.866] -- 0:00:35
      413000 -- (-544.935) (-542.723) (-542.684) [-541.860] * (-546.453) (-544.590) [-545.691] (-544.701) -- 0:00:35
      413500 -- (-544.642) (-542.620) [-542.684] (-546.599) * (-543.438) [-543.155] (-546.471) (-542.685) -- 0:00:35
      414000 -- [-543.364] (-544.248) (-544.609) (-543.572) * (-543.269) (-546.088) [-543.607] (-544.582) -- 0:00:35
      414500 -- [-544.394] (-547.813) (-543.644) (-544.777) * [-546.887] (-542.883) (-544.970) (-542.429) -- 0:00:35
      415000 -- (-546.499) (-546.245) [-545.165] (-545.581) * (-545.535) (-546.308) (-545.077) [-541.830] -- 0:00:35

      Average standard deviation of split frequencies: 0.007295

      415500 -- (-544.494) (-541.861) (-543.990) [-542.407] * [-544.268] (-545.412) (-547.075) (-544.490) -- 0:00:35
      416000 -- (-544.367) [-542.036] (-542.678) (-542.237) * [-544.749] (-545.847) (-545.989) (-542.836) -- 0:00:35
      416500 -- (-550.252) (-543.700) [-542.940] (-542.744) * (-546.813) (-544.493) [-543.827] (-545.074) -- 0:00:35
      417000 -- (-545.475) (-543.275) [-542.145] (-545.798) * [-542.619] (-553.550) (-544.249) (-544.653) -- 0:00:34
      417500 -- (-545.519) (-545.377) (-542.755) [-544.939] * (-545.662) [-546.670] (-545.778) (-543.487) -- 0:00:34
      418000 -- (-542.499) (-547.395) [-543.578] (-543.119) * (-543.311) (-542.449) [-543.759] (-544.571) -- 0:00:34
      418500 -- (-543.403) (-548.810) (-542.074) [-545.715] * (-546.240) (-543.701) (-545.723) [-541.766] -- 0:00:34
      419000 -- (-546.513) (-543.773) [-542.499] (-550.294) * [-544.452] (-543.444) (-544.141) (-543.551) -- 0:00:34
      419500 -- [-544.369] (-542.159) (-542.076) (-546.080) * [-543.506] (-542.781) (-545.065) (-548.289) -- 0:00:34
      420000 -- [-543.952] (-542.572) (-542.546) (-543.190) * (-544.694) (-544.891) [-543.696] (-544.102) -- 0:00:34

      Average standard deviation of split frequencies: 0.007620

      420500 -- (-548.852) (-544.174) [-543.077] (-543.281) * (-544.747) (-543.530) (-544.183) [-545.581] -- 0:00:34
      421000 -- (-547.154) (-546.485) (-544.038) [-543.181] * (-543.161) (-545.539) [-546.356] (-544.096) -- 0:00:34
      421500 -- (-542.930) (-546.007) [-543.889] (-546.350) * (-546.410) (-542.090) [-543.285] (-542.892) -- 0:00:34
      422000 -- (-547.996) (-547.144) (-541.823) [-544.990] * (-543.097) (-546.335) [-545.363] (-544.797) -- 0:00:34
      422500 -- (-546.054) (-545.429) (-543.526) [-544.801] * [-545.502] (-543.287) (-545.701) (-542.709) -- 0:00:34
      423000 -- [-543.444] (-544.444) (-543.568) (-545.225) * (-545.370) (-542.088) (-543.476) [-545.119] -- 0:00:34
      423500 -- (-544.100) (-543.498) [-545.689] (-543.051) * (-542.124) [-545.866] (-546.419) (-544.853) -- 0:00:34
      424000 -- [-543.488] (-542.536) (-542.725) (-543.025) * [-542.883] (-543.222) (-542.222) (-543.794) -- 0:00:35
      424500 -- [-544.240] (-545.703) (-542.647) (-550.787) * [-544.764] (-546.834) (-544.012) (-542.383) -- 0:00:35
      425000 -- (-544.237) (-542.930) [-543.648] (-548.947) * (-545.615) [-543.552] (-545.093) (-545.237) -- 0:00:35

      Average standard deviation of split frequencies: 0.007746

      425500 -- (-543.799) (-543.507) (-542.879) [-543.346] * (-546.848) [-544.008] (-542.316) (-547.084) -- 0:00:35
      426000 -- (-543.264) (-544.395) (-543.138) [-541.983] * (-546.636) [-544.215] (-542.413) (-545.316) -- 0:00:35
      426500 -- (-548.426) (-544.580) (-544.384) [-544.689] * [-544.368] (-544.171) (-546.825) (-545.597) -- 0:00:34
      427000 -- [-542.703] (-542.325) (-542.682) (-544.884) * (-543.229) (-544.102) (-553.207) [-546.830] -- 0:00:34
      427500 -- (-546.019) (-543.948) (-543.717) [-543.705] * [-543.283] (-543.074) (-542.261) (-542.431) -- 0:00:34
      428000 -- (-545.829) [-542.924] (-546.787) (-544.297) * (-542.290) (-543.004) [-543.135] (-542.317) -- 0:00:34
      428500 -- (-542.510) [-542.755] (-545.227) (-544.498) * (-542.083) (-543.149) (-542.790) [-541.882] -- 0:00:34
      429000 -- (-543.071) [-547.886] (-543.908) (-543.025) * [-542.477] (-543.802) (-545.586) (-547.640) -- 0:00:34
      429500 -- [-542.519] (-543.342) (-544.615) (-543.272) * (-546.436) [-542.201] (-545.845) (-546.111) -- 0:00:34
      430000 -- (-541.888) [-541.733] (-546.305) (-549.368) * [-543.437] (-546.336) (-543.408) (-544.994) -- 0:00:34

      Average standard deviation of split frequencies: 0.008757

      430500 -- (-542.462) (-545.928) (-545.190) [-551.464] * (-544.040) (-544.572) [-544.007] (-544.518) -- 0:00:34
      431000 -- (-542.305) (-542.445) (-542.909) [-544.562] * (-544.438) [-545.077] (-544.350) (-547.816) -- 0:00:34
      431500 -- (-545.538) [-543.259] (-543.648) (-542.420) * (-542.021) (-542.725) [-546.692] (-545.988) -- 0:00:34
      432000 -- (-549.205) (-543.072) [-542.544] (-542.584) * [-544.489] (-544.241) (-549.801) (-543.540) -- 0:00:34
      432500 -- [-544.479] (-542.088) (-543.226) (-546.177) * (-548.661) (-547.101) (-546.474) [-545.491] -- 0:00:34
      433000 -- (-543.347) (-543.066) [-544.934] (-544.066) * (-546.366) (-546.383) [-547.514] (-545.950) -- 0:00:34
      433500 -- (-543.970) (-544.956) (-542.408) [-543.931] * [-543.407] (-548.218) (-545.727) (-542.766) -- 0:00:33
      434000 -- [-542.333] (-545.075) (-543.835) (-545.552) * (-543.116) (-543.702) [-542.592] (-543.739) -- 0:00:33
      434500 -- (-543.554) [-542.885] (-544.226) (-545.874) * [-545.887] (-543.811) (-544.182) (-543.050) -- 0:00:33
      435000 -- (-543.714) (-542.423) [-544.625] (-545.503) * (-542.954) (-544.403) (-545.880) [-543.585] -- 0:00:33

      Average standard deviation of split frequencies: 0.008904

      435500 -- [-543.639] (-542.604) (-545.618) (-546.792) * (-542.401) [-542.074] (-543.872) (-542.227) -- 0:00:33
      436000 -- (-545.798) (-542.663) [-542.490] (-546.387) * (-545.538) (-549.160) (-544.789) [-546.229] -- 0:00:33
      436500 -- [-548.735] (-541.897) (-543.290) (-544.706) * (-542.826) (-541.976) (-544.829) [-546.927] -- 0:00:33
      437000 -- (-546.582) (-541.976) [-541.750] (-541.880) * (-546.190) (-542.685) (-544.129) [-544.222] -- 0:00:33
      437500 -- (-544.402) (-543.067) [-542.425] (-544.760) * (-541.882) (-545.428) (-543.266) [-543.210] -- 0:00:33
      438000 -- (-543.467) (-542.526) [-542.851] (-542.527) * (-544.218) (-544.803) [-542.536] (-542.401) -- 0:00:33
      438500 -- (-545.531) (-544.963) (-542.995) [-542.480] * (-541.924) (-544.341) [-543.786] (-543.680) -- 0:00:33
      439000 -- (-543.945) (-544.746) (-543.132) [-543.131] * (-544.757) (-544.286) (-543.246) [-545.168] -- 0:00:33
      439500 -- (-542.471) (-543.575) (-544.951) [-542.667] * (-544.569) (-543.533) (-551.274) [-545.974] -- 0:00:33
      440000 -- (-543.108) (-546.695) (-541.986) [-542.054] * [-543.197] (-544.449) (-545.076) (-542.792) -- 0:00:33

      Average standard deviation of split frequencies: 0.009817

      440500 -- [-543.293] (-544.068) (-543.697) (-543.944) * (-544.966) (-543.291) (-546.294) [-542.371] -- 0:00:34
      441000 -- (-542.372) (-543.471) (-544.859) [-542.698] * (-547.554) (-542.551) [-544.211] (-541.992) -- 0:00:34
      441500 -- [-544.107] (-543.965) (-542.425) (-541.906) * (-546.695) (-544.127) (-544.284) [-542.729] -- 0:00:34
      442000 -- (-544.262) (-542.306) (-542.743) [-542.826] * (-544.109) [-542.908] (-546.112) (-544.353) -- 0:00:34
      442500 -- (-543.831) (-544.357) (-545.831) [-542.548] * [-543.077] (-546.140) (-544.190) (-547.338) -- 0:00:34
      443000 -- (-546.182) [-546.221] (-543.508) (-543.658) * (-545.774) (-542.195) [-542.848] (-546.401) -- 0:00:33
      443500 -- (-541.935) (-543.816) [-542.413] (-546.001) * (-544.535) [-541.856] (-544.870) (-545.191) -- 0:00:33
      444000 -- (-545.047) (-544.597) (-543.009) [-543.522] * [-543.527] (-542.070) (-546.949) (-546.911) -- 0:00:33
      444500 -- (-542.637) (-544.471) [-543.936] (-541.982) * (-542.144) (-545.185) (-548.572) [-544.267] -- 0:00:33
      445000 -- (-541.707) (-542.861) (-547.115) [-543.623] * (-549.475) (-542.449) [-543.834] (-546.393) -- 0:00:33

      Average standard deviation of split frequencies: 0.009824

      445500 -- (-543.021) [-543.489] (-546.482) (-542.613) * (-543.315) (-544.634) [-542.118] (-543.546) -- 0:00:33
      446000 -- (-543.149) (-544.304) [-542.867] (-541.879) * (-542.256) [-542.972] (-542.650) (-543.250) -- 0:00:33
      446500 -- (-543.654) (-545.857) [-542.389] (-542.043) * (-545.371) (-545.081) [-544.543] (-541.705) -- 0:00:33
      447000 -- (-543.567) (-546.977) [-545.429] (-545.134) * (-542.689) (-544.421) (-550.358) [-543.148] -- 0:00:33
      447500 -- [-542.760] (-542.889) (-543.355) (-545.273) * (-543.438) [-543.144] (-544.664) (-548.627) -- 0:00:33
      448000 -- (-543.761) [-544.449] (-543.107) (-545.333) * [-545.467] (-542.671) (-543.971) (-545.689) -- 0:00:33
      448500 -- [-544.338] (-544.582) (-546.502) (-546.783) * (-543.908) (-543.139) (-543.536) [-543.770] -- 0:00:33
      449000 -- (-542.904) [-543.727] (-544.644) (-543.362) * (-542.922) (-545.747) (-546.523) [-543.310] -- 0:00:33
      449500 -- (-543.752) (-543.607) [-544.663] (-542.530) * (-545.438) [-544.129] (-544.619) (-545.399) -- 0:00:33
      450000 -- (-547.433) (-542.194) (-543.402) [-543.884] * (-544.305) [-542.622] (-542.158) (-544.977) -- 0:00:33

      Average standard deviation of split frequencies: 0.010264

      450500 -- (-543.684) (-544.306) (-545.630) [-549.379] * [-542.821] (-545.794) (-544.140) (-546.895) -- 0:00:32
      451000 -- (-541.928) [-542.755] (-543.605) (-543.983) * (-542.976) (-546.189) (-543.087) [-544.338] -- 0:00:32
      451500 -- (-541.899) (-545.909) (-543.772) [-543.439] * (-542.573) [-545.833] (-543.109) (-543.358) -- 0:00:32
      452000 -- (-542.794) [-543.937] (-542.006) (-548.989) * (-544.066) (-544.924) [-545.212] (-544.562) -- 0:00:32
      452500 -- (-542.139) (-542.409) (-544.536) [-548.414] * (-546.780) [-546.722] (-543.082) (-545.582) -- 0:00:32
      453000 -- (-543.966) (-545.184) [-543.645] (-548.290) * (-542.602) (-548.970) (-542.489) [-543.092] -- 0:00:32
      453500 -- (-542.393) (-544.604) [-546.042] (-543.323) * [-543.291] (-543.664) (-542.925) (-542.983) -- 0:00:32
      454000 -- (-543.126) (-545.065) [-548.013] (-545.834) * (-545.066) (-547.078) [-542.201] (-545.287) -- 0:00:32
      454500 -- [-544.487] (-545.665) (-546.322) (-550.456) * (-546.933) (-544.586) [-542.081] (-545.740) -- 0:00:32
      455000 -- [-545.855] (-548.730) (-552.904) (-543.615) * (-544.405) (-547.896) (-543.792) [-545.167] -- 0:00:32

      Average standard deviation of split frequencies: 0.010596

      455500 -- (-547.793) [-542.753] (-543.888) (-545.915) * (-543.851) (-542.730) (-546.124) [-546.383] -- 0:00:32
      456000 -- (-546.837) (-544.186) (-542.735) [-546.144] * (-546.536) [-542.386] (-549.112) (-542.556) -- 0:00:32
      456500 -- [-545.053] (-544.532) (-548.905) (-548.896) * (-543.156) (-543.451) (-543.901) [-543.605] -- 0:00:32
      457000 -- (-542.748) [-542.003] (-543.427) (-544.894) * [-544.561] (-545.654) (-544.215) (-544.725) -- 0:00:32
      457500 -- (-543.125) (-543.957) [-542.712] (-543.191) * (-545.207) (-545.997) [-543.588] (-544.665) -- 0:00:33
      458000 -- (-543.947) (-544.135) [-542.654] (-543.359) * (-543.052) (-543.911) (-542.073) [-542.319] -- 0:00:33
      458500 -- (-543.533) [-541.648] (-544.516) (-544.280) * (-544.480) [-543.080] (-543.261) (-544.224) -- 0:00:33
      459000 -- [-542.454] (-543.911) (-544.909) (-542.897) * (-548.373) (-543.791) [-542.253] (-543.845) -- 0:00:33
      459500 -- (-541.965) [-545.116] (-548.103) (-542.474) * (-548.654) [-545.744] (-544.351) (-542.534) -- 0:00:32
      460000 -- (-543.448) (-545.759) (-543.451) [-542.940] * [-546.199] (-547.156) (-546.194) (-543.466) -- 0:00:32

      Average standard deviation of split frequencies: 0.011192

      460500 -- [-543.431] (-544.354) (-544.147) (-542.991) * (-546.312) [-543.474] (-544.051) (-542.750) -- 0:00:32
      461000 -- [-542.526] (-546.607) (-542.710) (-546.364) * (-543.789) (-546.952) (-543.249) [-544.817] -- 0:00:32
      461500 -- [-544.218] (-546.662) (-548.162) (-542.000) * (-542.416) [-542.292] (-545.462) (-544.700) -- 0:00:32
      462000 -- (-546.191) [-543.737] (-543.272) (-544.688) * (-542.849) (-547.448) [-543.356] (-542.260) -- 0:00:32
      462500 -- [-542.684] (-544.330) (-541.761) (-543.107) * (-544.689) [-546.053] (-543.358) (-544.466) -- 0:00:32
      463000 -- (-544.743) [-544.130] (-542.443) (-542.726) * (-543.200) (-545.876) (-544.781) [-542.984] -- 0:00:32
      463500 -- (-545.929) (-544.205) [-542.960] (-547.103) * (-545.374) (-542.810) (-544.889) [-546.096] -- 0:00:32
      464000 -- (-546.988) (-546.169) (-544.770) [-543.714] * (-545.582) (-546.266) (-547.475) [-543.729] -- 0:00:32
      464500 -- (-543.939) (-544.025) [-543.056] (-543.179) * (-546.504) (-543.162) [-542.893] (-544.549) -- 0:00:32
      465000 -- (-542.430) (-545.799) [-543.894] (-542.226) * [-543.484] (-543.847) (-542.870) (-544.073) -- 0:00:32

      Average standard deviation of split frequencies: 0.011823

      465500 -- (-543.560) [-544.266] (-544.816) (-543.902) * (-546.025) (-543.520) [-545.204] (-542.501) -- 0:00:32
      466000 -- [-543.583] (-541.863) (-543.257) (-548.501) * (-542.520) (-549.104) (-543.178) [-542.946] -- 0:00:32
      466500 -- [-545.965] (-544.029) (-543.480) (-545.421) * [-543.385] (-543.659) (-542.121) (-547.689) -- 0:00:32
      467000 -- (-546.248) [-546.922] (-542.681) (-543.699) * (-545.708) [-544.012] (-542.796) (-544.933) -- 0:00:31
      467500 -- [-543.787] (-548.542) (-544.462) (-544.706) * (-546.376) [-542.913] (-544.566) (-547.295) -- 0:00:31
      468000 -- (-543.185) (-543.030) (-544.987) [-543.011] * (-545.683) [-541.906] (-543.181) (-545.252) -- 0:00:31
      468500 -- (-544.899) (-542.558) [-543.250] (-542.356) * (-542.527) (-543.538) (-542.179) [-543.325] -- 0:00:31
      469000 -- (-545.350) (-546.686) [-542.672] (-542.513) * (-542.016) (-546.445) (-545.517) [-542.314] -- 0:00:31
      469500 -- (-542.309) (-549.285) (-545.113) [-544.170] * [-544.129] (-542.608) (-545.302) (-546.817) -- 0:00:31
      470000 -- [-542.310] (-543.084) (-546.919) (-545.140) * (-544.102) (-542.316) (-546.889) [-543.747] -- 0:00:31

      Average standard deviation of split frequencies: 0.012207

      470500 -- (-543.079) (-544.488) (-552.921) [-542.798] * [-543.678] (-543.787) (-546.693) (-544.585) -- 0:00:31
      471000 -- (-545.924) (-544.235) (-546.463) [-543.255] * (-546.792) (-542.182) [-543.001] (-543.969) -- 0:00:31
      471500 -- [-543.876] (-542.190) (-541.823) (-542.617) * (-543.395) (-547.102) (-542.848) [-543.957] -- 0:00:31
      472000 -- [-542.678] (-547.203) (-542.797) (-543.752) * (-541.880) [-544.342] (-542.679) (-542.848) -- 0:00:31
      472500 -- (-546.403) (-541.779) [-543.348] (-541.960) * (-545.633) (-543.186) [-543.053] (-543.885) -- 0:00:31
      473000 -- (-548.900) [-543.788] (-545.640) (-542.658) * [-543.909] (-544.873) (-544.875) (-545.209) -- 0:00:31
      473500 -- [-546.026] (-542.432) (-542.191) (-542.293) * (-543.408) [-543.750] (-546.619) (-544.939) -- 0:00:31
      474000 -- [-544.890] (-550.315) (-545.254) (-543.181) * [-552.385] (-545.440) (-545.175) (-547.024) -- 0:00:32
      474500 -- (-545.763) (-548.167) (-542.974) [-543.772] * (-547.648) (-544.446) [-542.421] (-542.674) -- 0:00:32
      475000 -- (-542.194) (-545.645) (-542.070) [-542.779] * [-544.212] (-543.919) (-544.477) (-542.902) -- 0:00:32

      Average standard deviation of split frequencies: 0.011760

      475500 -- (-543.885) [-542.873] (-543.271) (-545.436) * (-544.489) (-542.835) [-542.608] (-543.737) -- 0:00:31
      476000 -- (-542.670) (-542.976) (-544.299) [-544.933] * (-543.026) (-544.966) [-543.592] (-545.286) -- 0:00:31
      476500 -- (-544.045) (-542.861) [-545.132] (-544.932) * (-542.409) (-543.549) [-542.774] (-542.547) -- 0:00:31
      477000 -- [-545.350] (-542.232) (-545.090) (-542.473) * [-547.896] (-543.454) (-545.023) (-544.330) -- 0:00:31
      477500 -- (-542.703) (-543.849) (-546.883) [-542.145] * (-542.319) (-542.046) (-549.615) [-544.144] -- 0:00:31
      478000 -- (-543.688) (-544.418) [-542.612] (-545.116) * [-542.633] (-541.826) (-543.096) (-544.392) -- 0:00:31
      478500 -- (-541.761) (-543.513) (-542.780) [-542.649] * (-544.258) (-544.168) [-542.463] (-549.523) -- 0:00:31
      479000 -- [-548.535] (-543.960) (-542.934) (-542.993) * (-543.417) [-543.432] (-542.408) (-545.967) -- 0:00:31
      479500 -- [-547.273] (-543.141) (-542.032) (-545.758) * (-543.962) (-542.505) (-545.401) [-544.001] -- 0:00:31
      480000 -- (-546.685) [-543.518] (-541.701) (-542.694) * [-541.926] (-545.227) (-542.825) (-542.579) -- 0:00:31

      Average standard deviation of split frequencies: 0.012320

      480500 -- (-543.923) (-547.747) (-543.064) [-542.735] * [-542.584] (-546.374) (-544.441) (-543.675) -- 0:00:31
      481000 -- [-542.536] (-546.588) (-543.011) (-544.111) * (-544.323) (-546.089) [-543.886] (-543.828) -- 0:00:31
      481500 -- (-543.325) [-542.387] (-543.096) (-541.674) * (-542.942) (-542.902) (-545.588) [-543.924] -- 0:00:31
      482000 -- (-544.041) [-544.612] (-546.402) (-541.875) * (-544.184) [-542.631] (-546.235) (-546.318) -- 0:00:31
      482500 -- (-542.535) (-546.827) [-549.855] (-545.020) * [-543.161] (-542.183) (-542.081) (-542.834) -- 0:00:31
      483000 -- (-546.107) (-544.253) (-545.075) [-543.765] * [-544.379] (-542.954) (-541.693) (-547.821) -- 0:00:31
      483500 -- (-544.810) (-545.932) (-543.919) [-543.516] * (-542.446) [-542.856] (-544.856) (-543.992) -- 0:00:30
      484000 -- [-548.583] (-541.861) (-544.027) (-543.701) * [-542.728] (-543.737) (-543.238) (-542.499) -- 0:00:30
      484500 -- (-545.078) [-541.881] (-542.507) (-552.132) * (-544.034) (-543.790) [-542.120] (-544.977) -- 0:00:30
      485000 -- (-543.925) (-543.150) (-544.188) [-545.141] * (-548.253) (-546.793) [-542.570] (-547.293) -- 0:00:30

      Average standard deviation of split frequencies: 0.012495

      485500 -- [-544.693] (-547.801) (-543.480) (-549.918) * (-543.926) (-543.159) [-542.497] (-542.388) -- 0:00:30
      486000 -- [-543.790] (-544.033) (-543.476) (-544.288) * [-544.084] (-544.652) (-543.233) (-542.807) -- 0:00:30
      486500 -- (-543.853) [-544.532] (-543.138) (-543.788) * [-545.010] (-549.289) (-544.227) (-542.185) -- 0:00:30
      487000 -- (-546.233) [-542.949] (-543.938) (-546.500) * (-545.223) [-550.024] (-545.797) (-542.267) -- 0:00:30
      487500 -- (-544.495) [-544.940] (-542.975) (-544.698) * [-546.852] (-547.504) (-548.683) (-545.716) -- 0:00:30
      488000 -- (-542.405) (-547.341) [-542.907] (-542.841) * [-546.645] (-546.358) (-544.471) (-543.581) -- 0:00:30
      488500 -- (-543.744) (-544.016) (-545.353) [-544.762] * (-544.525) (-544.412) [-545.973] (-544.134) -- 0:00:30
      489000 -- (-544.991) [-544.680] (-544.280) (-543.047) * (-546.537) (-543.828) [-544.128] (-546.258) -- 0:00:30
      489500 -- (-541.992) (-546.095) (-543.940) [-543.646] * [-545.296] (-543.057) (-548.127) (-543.593) -- 0:00:30
      490000 -- (-544.731) (-543.426) (-542.378) [-544.481] * (-547.946) (-544.161) (-548.113) [-543.563] -- 0:00:30

      Average standard deviation of split frequencies: 0.013330

      490500 -- (-544.623) (-543.292) (-547.829) [-542.730] * [-544.415] (-543.801) (-544.214) (-543.341) -- 0:00:31
      491000 -- (-541.998) (-545.250) [-543.696] (-543.281) * (-545.024) (-543.588) (-543.337) [-544.937] -- 0:00:31
      491500 -- [-542.476] (-543.216) (-542.665) (-542.416) * [-542.792] (-542.234) (-543.706) (-544.112) -- 0:00:31
      492000 -- (-544.158) [-544.067] (-545.407) (-543.292) * (-545.432) (-546.529) (-545.579) [-542.067] -- 0:00:30
      492500 -- [-542.752] (-546.978) (-544.065) (-542.145) * [-542.372] (-543.672) (-545.344) (-543.793) -- 0:00:30
      493000 -- [-542.340] (-547.788) (-545.602) (-543.458) * [-545.020] (-545.679) (-544.596) (-543.201) -- 0:00:30
      493500 -- [-542.678] (-547.906) (-546.705) (-544.430) * [-543.448] (-543.175) (-542.132) (-543.908) -- 0:00:30
      494000 -- (-541.857) [-542.805] (-545.068) (-546.281) * (-546.450) (-545.635) [-544.234] (-543.761) -- 0:00:30
      494500 -- (-541.826) [-546.090] (-554.634) (-543.563) * (-555.123) (-546.283) [-543.051] (-545.649) -- 0:00:30
      495000 -- [-544.757] (-544.679) (-545.561) (-545.555) * (-546.089) (-543.958) (-544.063) [-543.703] -- 0:00:30

      Average standard deviation of split frequencies: 0.012076

      495500 -- (-544.023) (-549.286) (-545.370) [-549.059] * (-544.827) [-542.529] (-544.103) (-546.366) -- 0:00:30
      496000 -- (-547.166) [-542.588] (-545.635) (-546.365) * (-542.761) (-543.681) (-544.822) [-545.272] -- 0:00:30
      496500 -- [-544.661] (-543.584) (-544.701) (-547.017) * (-543.363) (-543.432) [-543.207] (-543.501) -- 0:00:30
      497000 -- (-544.456) (-542.990) (-542.704) [-545.448] * [-545.436] (-544.611) (-543.478) (-545.440) -- 0:00:30
      497500 -- (-542.960) (-542.521) [-542.439] (-543.226) * (-548.191) (-545.056) [-542.923] (-542.002) -- 0:00:30
      498000 -- [-544.083] (-543.566) (-544.252) (-543.393) * [-545.688] (-545.957) (-544.188) (-543.170) -- 0:00:30
      498500 -- (-543.554) [-541.929] (-544.887) (-543.673) * (-543.099) (-546.515) [-545.740] (-542.952) -- 0:00:30
      499000 -- (-546.739) (-544.250) (-545.578) [-547.738] * (-542.222) (-545.681) (-547.321) [-544.611] -- 0:00:30
      499500 -- [-545.564] (-546.577) (-544.789) (-546.818) * [-543.140] (-544.234) (-544.569) (-543.076) -- 0:00:30
      500000 -- (-544.098) (-544.614) [-544.739] (-543.537) * (-542.587) [-543.085] (-545.920) (-543.579) -- 0:00:30

      Average standard deviation of split frequencies: 0.012351

      500500 -- (-544.396) (-544.924) [-542.252] (-549.749) * [-542.039] (-545.304) (-546.463) (-546.227) -- 0:00:29
      501000 -- (-545.428) (-542.788) [-543.509] (-542.481) * (-542.194) (-545.249) [-544.863] (-545.693) -- 0:00:29
      501500 -- (-543.562) (-542.597) (-548.634) [-548.440] * (-543.080) [-546.024] (-546.192) (-543.371) -- 0:00:29
      502000 -- (-541.954) (-542.932) (-542.998) [-546.104] * (-544.314) (-541.873) [-544.988] (-546.857) -- 0:00:29
      502500 -- (-546.326) (-545.665) [-544.674] (-545.746) * (-543.071) (-544.488) (-542.858) [-543.371] -- 0:00:29
      503000 -- (-546.484) (-545.035) (-542.964) [-542.954] * (-544.124) [-545.198] (-542.899) (-544.335) -- 0:00:29
      503500 -- (-543.791) [-543.429] (-543.195) (-543.957) * [-548.192] (-543.239) (-542.551) (-543.707) -- 0:00:29
      504000 -- (-544.239) (-542.482) [-544.170] (-544.279) * (-550.011) (-546.380) [-542.818] (-542.673) -- 0:00:29
      504500 -- (-543.173) (-545.695) [-546.100] (-547.613) * (-544.068) (-544.188) [-543.529] (-541.825) -- 0:00:29
      505000 -- [-543.390] (-544.298) (-544.577) (-543.651) * (-541.870) [-546.498] (-544.146) (-543.133) -- 0:00:29

      Average standard deviation of split frequencies: 0.012495

      505500 -- (-549.694) [-542.826] (-545.101) (-543.320) * (-541.870) (-545.937) [-545.054] (-543.617) -- 0:00:29
      506000 -- [-543.056] (-542.169) (-543.131) (-542.015) * (-543.200) (-546.553) [-545.977] (-542.295) -- 0:00:29
      506500 -- (-542.113) [-544.091] (-546.136) (-542.648) * (-545.545) [-543.511] (-543.873) (-541.994) -- 0:00:29
      507000 -- (-543.314) (-546.544) [-543.979] (-546.828) * (-544.737) (-546.748) (-544.411) [-541.906] -- 0:00:30
      507500 -- [-542.848] (-542.118) (-542.826) (-546.044) * (-543.290) (-545.162) [-546.288] (-546.334) -- 0:00:30
      508000 -- [-543.543] (-544.216) (-542.758) (-545.809) * (-543.719) [-543.395] (-543.961) (-546.760) -- 0:00:30
      508500 -- (-542.152) (-550.871) [-544.071] (-545.183) * (-543.112) [-544.538] (-541.796) (-547.025) -- 0:00:29
      509000 -- (-542.107) (-546.412) [-542.436] (-547.297) * (-544.947) [-544.894] (-545.311) (-543.224) -- 0:00:29
      509500 -- (-545.335) [-548.312] (-550.923) (-542.829) * (-544.504) (-544.372) [-544.322] (-546.077) -- 0:00:29
      510000 -- (-545.234) (-544.686) (-542.764) [-542.492] * (-542.338) [-543.348] (-543.590) (-544.478) -- 0:00:29

      Average standard deviation of split frequencies: 0.012218

      510500 -- (-542.232) (-541.838) [-542.679] (-543.674) * (-543.627) (-542.425) [-544.548] (-543.848) -- 0:00:29
      511000 -- (-548.710) (-543.874) (-542.181) [-546.372] * [-543.339] (-542.249) (-543.490) (-542.952) -- 0:00:29
      511500 -- [-543.003] (-544.138) (-544.179) (-544.399) * (-545.441) (-543.401) (-543.555) [-542.592] -- 0:00:29
      512000 -- (-545.552) (-542.332) [-542.203] (-545.327) * (-541.764) [-541.853] (-546.633) (-542.849) -- 0:00:29
      512500 -- (-547.622) (-543.200) [-543.293] (-542.980) * [-542.606] (-545.680) (-542.764) (-543.976) -- 0:00:29
      513000 -- [-542.874] (-543.082) (-547.012) (-543.856) * (-544.276) (-543.542) (-546.177) [-544.548] -- 0:00:29
      513500 -- (-542.313) (-545.238) [-545.281] (-542.758) * (-545.146) (-543.379) (-546.166) [-541.685] -- 0:00:29
      514000 -- (-546.273) (-541.947) (-542.752) [-543.535] * (-544.834) (-549.114) [-549.554] (-545.523) -- 0:00:29
      514500 -- [-542.746] (-542.393) (-543.524) (-542.274) * (-544.478) (-542.970) (-544.532) [-547.443] -- 0:00:29
      515000 -- [-542.183] (-542.234) (-543.332) (-546.437) * [-544.066] (-552.353) (-543.591) (-543.537) -- 0:00:29

      Average standard deviation of split frequencies: 0.012629

      515500 -- [-544.281] (-547.789) (-543.667) (-544.682) * (-548.590) (-543.371) [-542.955] (-545.636) -- 0:00:29
      516000 -- [-542.492] (-543.983) (-543.584) (-546.532) * (-548.374) (-545.368) (-543.557) [-543.275] -- 0:00:29
      516500 -- [-542.531] (-544.591) (-545.856) (-543.236) * (-544.987) [-542.099] (-545.755) (-541.898) -- 0:00:29
      517000 -- (-543.592) [-545.075] (-545.583) (-543.141) * (-543.833) (-544.700) [-543.408] (-543.053) -- 0:00:28
      517500 -- (-543.854) [-544.421] (-543.004) (-544.776) * (-544.116) (-550.113) [-543.368] (-544.380) -- 0:00:28
      518000 -- (-546.194) (-542.999) (-547.753) [-544.972] * (-544.593) (-543.668) [-542.200] (-546.004) -- 0:00:28
      518500 -- [-547.419] (-542.952) (-543.256) (-543.419) * (-544.553) (-543.310) (-543.554) [-543.344] -- 0:00:28
      519000 -- (-541.892) [-545.139] (-544.265) (-546.411) * (-542.611) [-542.109] (-544.691) (-542.451) -- 0:00:28
      519500 -- (-546.455) (-545.331) [-545.993] (-545.192) * (-549.109) (-543.417) (-546.247) [-543.395] -- 0:00:28
      520000 -- [-544.486] (-542.891) (-543.125) (-544.152) * (-543.235) (-542.479) [-543.014] (-542.484) -- 0:00:28

      Average standard deviation of split frequencies: 0.012462

      520500 -- (-548.475) (-545.193) (-543.514) [-544.577] * (-542.412) (-543.025) [-542.983] (-543.495) -- 0:00:28
      521000 -- (-544.422) (-545.460) [-543.143] (-543.138) * (-544.606) (-545.313) (-542.843) [-544.101] -- 0:00:28
      521500 -- (-545.829) (-547.868) (-544.923) [-543.235] * (-544.112) (-543.431) (-543.635) [-546.693] -- 0:00:28
      522000 -- [-545.250] (-542.406) (-546.138) (-543.140) * (-546.052) [-543.259] (-546.693) (-548.927) -- 0:00:28
      522500 -- (-543.239) [-542.315] (-543.238) (-543.084) * (-544.775) (-546.035) (-543.604) [-542.296] -- 0:00:28
      523000 -- (-546.677) (-547.059) [-543.206] (-544.071) * (-545.218) (-546.315) (-543.089) [-542.949] -- 0:00:28
      523500 -- [-543.789] (-544.638) (-544.995) (-544.373) * [-545.202] (-542.790) (-546.805) (-544.296) -- 0:00:28
      524000 -- (-542.833) (-550.377) (-546.127) [-545.626] * [-544.017] (-543.282) (-543.823) (-543.116) -- 0:00:29
      524500 -- (-542.669) (-544.310) [-545.935] (-548.442) * (-544.595) (-542.445) (-546.502) [-542.898] -- 0:00:29
      525000 -- (-543.999) [-544.131] (-542.415) (-541.706) * [-544.525] (-543.577) (-543.638) (-545.991) -- 0:00:28

      Average standard deviation of split frequencies: 0.012231

      525500 -- (-543.570) [-543.805] (-545.480) (-541.690) * (-543.930) [-544.259] (-544.348) (-543.233) -- 0:00:28
      526000 -- (-545.842) [-543.018] (-542.150) (-541.509) * (-542.900) (-543.809) [-545.075] (-543.196) -- 0:00:28
      526500 -- (-544.779) (-543.211) (-542.456) [-543.144] * [-542.087] (-543.905) (-543.528) (-544.610) -- 0:00:28
      527000 -- (-550.863) (-543.287) [-543.372] (-543.402) * (-543.770) (-543.189) (-551.628) [-545.290] -- 0:00:28
      527500 -- (-545.138) [-542.794] (-549.750) (-542.468) * (-543.977) [-544.454] (-544.743) (-546.482) -- 0:00:28
      528000 -- (-543.586) (-542.374) [-545.078] (-543.027) * [-542.158] (-544.241) (-545.482) (-544.106) -- 0:00:28
      528500 -- (-543.039) (-542.466) [-544.425] (-544.259) * (-542.518) (-544.410) (-543.761) [-542.562] -- 0:00:28
      529000 -- (-550.776) [-542.831] (-544.684) (-542.670) * (-543.975) (-543.372) [-546.584] (-542.874) -- 0:00:28
      529500 -- (-543.851) (-545.004) (-544.051) [-543.341] * (-544.156) (-543.172) [-543.669] (-546.301) -- 0:00:28
      530000 -- (-543.404) (-547.996) [-542.383] (-542.792) * (-544.646) (-543.179) [-543.991] (-542.128) -- 0:00:28

      Average standard deviation of split frequencies: 0.010608

      530500 -- (-543.735) (-544.828) (-544.029) [-543.099] * [-543.748] (-542.801) (-542.506) (-542.399) -- 0:00:28
      531000 -- [-544.971] (-543.713) (-543.767) (-543.013) * [-543.006] (-545.061) (-541.710) (-542.660) -- 0:00:28
      531500 -- (-546.130) [-542.373] (-545.995) (-545.135) * (-543.060) (-548.518) [-542.598] (-543.469) -- 0:00:28
      532000 -- [-543.824] (-542.310) (-543.756) (-546.825) * [-543.741] (-550.415) (-543.582) (-542.111) -- 0:00:28
      532500 -- (-543.854) (-543.030) [-544.857] (-545.225) * (-543.175) (-543.303) (-544.139) [-542.028] -- 0:00:28
      533000 -- [-544.393] (-547.826) (-544.807) (-542.847) * (-544.337) (-545.056) (-543.351) [-542.799] -- 0:00:28
      533500 -- (-542.458) [-547.938] (-543.565) (-543.803) * (-545.162) [-543.244] (-542.689) (-541.646) -- 0:00:27
      534000 -- (-541.991) (-544.144) (-543.328) [-542.894] * (-542.757) [-542.910] (-543.613) (-545.068) -- 0:00:27
      534500 -- [-542.018] (-547.246) (-545.062) (-542.184) * (-545.039) [-551.634] (-543.842) (-545.659) -- 0:00:27
      535000 -- (-545.213) [-544.446] (-543.422) (-544.922) * (-544.332) (-545.636) (-542.823) [-542.606] -- 0:00:27

      Average standard deviation of split frequencies: 0.010968

      535500 -- (-542.248) (-544.549) (-544.012) [-543.938] * (-541.936) (-542.740) (-542.948) [-543.721] -- 0:00:27
      536000 -- [-542.617] (-545.662) (-543.833) (-545.210) * (-545.800) (-547.139) (-542.472) [-544.802] -- 0:00:27
      536500 -- [-547.166] (-546.950) (-543.840) (-543.366) * (-545.059) (-543.535) [-548.570] (-544.274) -- 0:00:27
      537000 -- (-544.498) [-542.442] (-543.797) (-543.067) * (-549.846) [-543.717] (-543.328) (-542.135) -- 0:00:27
      537500 -- (-544.282) (-546.050) [-545.317] (-542.926) * [-546.844] (-543.509) (-543.063) (-546.387) -- 0:00:27
      538000 -- (-546.642) (-544.952) (-544.492) [-543.103] * [-544.090] (-543.391) (-544.001) (-546.263) -- 0:00:27
      538500 -- (-544.861) (-542.793) [-545.310] (-543.429) * (-543.322) [-542.857] (-543.994) (-542.338) -- 0:00:27
      539000 -- (-543.692) [-543.775] (-542.946) (-543.413) * (-543.678) (-542.133) (-544.662) [-543.968] -- 0:00:27
      539500 -- (-542.805) [-544.358] (-544.248) (-544.339) * (-545.034) (-543.222) [-543.768] (-543.954) -- 0:00:27
      540000 -- (-542.306) (-543.721) (-542.864) [-541.807] * (-544.776) [-542.364] (-547.476) (-542.838) -- 0:00:27

      Average standard deviation of split frequencies: 0.011129

      540500 -- (-542.898) (-542.847) [-542.959] (-544.720) * (-543.857) (-542.338) [-547.012] (-545.573) -- 0:00:28
      541000 -- (-543.721) [-543.605] (-544.133) (-542.059) * [-541.957] (-543.728) (-550.801) (-543.259) -- 0:00:27
      541500 -- [-544.261] (-545.246) (-543.538) (-543.939) * [-543.496] (-543.413) (-543.894) (-545.601) -- 0:00:27
      542000 -- (-544.035) (-542.860) [-544.726] (-545.790) * (-546.251) (-550.175) (-543.525) [-543.709] -- 0:00:27
      542500 -- (-544.556) (-542.514) [-546.443] (-544.759) * (-545.319) [-545.251] (-543.449) (-546.221) -- 0:00:27
      543000 -- [-544.713] (-547.839) (-544.016) (-544.636) * [-543.948] (-544.168) (-542.672) (-544.809) -- 0:00:27
      543500 -- (-543.644) [-543.384] (-543.998) (-544.059) * [-541.664] (-546.975) (-541.694) (-543.774) -- 0:00:27
      544000 -- [-544.905] (-543.795) (-546.771) (-541.901) * [-542.739] (-545.226) (-546.715) (-543.402) -- 0:00:27
      544500 -- (-543.787) (-545.461) [-542.774] (-543.244) * (-543.739) [-544.702] (-543.077) (-547.039) -- 0:00:27
      545000 -- (-543.801) (-543.476) [-541.741] (-543.221) * (-541.774) [-545.792] (-543.258) (-544.950) -- 0:00:27

      Average standard deviation of split frequencies: 0.010716

      545500 -- (-543.197) [-542.591] (-543.180) (-543.133) * [-544.256] (-542.380) (-546.838) (-543.228) -- 0:00:27
      546000 -- (-544.520) (-545.246) [-542.104] (-543.369) * (-543.618) [-547.108] (-544.964) (-544.027) -- 0:00:27
      546500 -- (-544.143) [-543.749] (-545.078) (-545.559) * [-543.569] (-543.037) (-544.251) (-545.807) -- 0:00:27
      547000 -- (-546.613) (-542.844) [-543.787] (-548.794) * (-543.548) [-544.580] (-543.249) (-546.665) -- 0:00:27
      547500 -- (-543.639) (-543.549) (-544.070) [-542.081] * (-546.764) [-542.440] (-550.356) (-547.192) -- 0:00:27
      548000 -- [-542.879] (-548.559) (-546.588) (-543.792) * (-545.184) [-543.749] (-546.086) (-543.005) -- 0:00:27
      548500 -- (-542.725) (-545.232) (-542.582) [-544.262] * (-546.584) (-547.021) (-545.909) [-545.382] -- 0:00:27
      549000 -- (-544.103) (-543.142) (-544.816) [-545.743] * (-547.715) (-547.425) [-544.157] (-541.966) -- 0:00:27
      549500 -- [-544.346] (-543.876) (-544.202) (-545.274) * (-542.463) (-543.395) [-544.701] (-543.922) -- 0:00:27
      550000 -- (-543.034) (-542.485) [-547.021] (-545.748) * (-542.107) (-542.920) [-544.379] (-543.249) -- 0:00:27

      Average standard deviation of split frequencies: 0.010225

      550500 -- (-542.206) (-545.558) [-546.730] (-545.664) * (-547.427) (-543.107) [-542.157] (-545.499) -- 0:00:26
      551000 -- (-542.412) [-543.401] (-547.196) (-548.951) * (-544.510) (-542.594) [-542.002] (-543.991) -- 0:00:26
      551500 -- (-542.248) (-546.336) [-545.187] (-542.897) * (-543.373) (-542.528) (-544.109) [-543.630] -- 0:00:26
      552000 -- (-548.564) (-544.498) [-544.825] (-543.303) * [-542.168] (-542.697) (-543.358) (-543.600) -- 0:00:26
      552500 -- (-545.416) [-542.889] (-542.539) (-542.774) * (-544.478) [-546.018] (-543.219) (-546.207) -- 0:00:26
      553000 -- (-544.121) (-543.544) (-542.909) [-546.459] * (-549.353) (-542.162) [-543.712] (-546.243) -- 0:00:26
      553500 -- [-545.400] (-543.289) (-545.217) (-545.294) * [-543.375] (-544.128) (-544.047) (-546.530) -- 0:00:26
      554000 -- (-542.833) [-541.841] (-545.576) (-542.684) * (-542.292) (-544.531) [-541.984] (-542.221) -- 0:00:26
      554500 -- (-550.925) [-543.073] (-544.677) (-546.600) * (-543.277) (-544.697) (-542.013) [-542.579] -- 0:00:26
      555000 -- (-548.003) (-542.534) (-543.060) [-543.113] * (-542.361) (-547.522) (-546.479) [-542.309] -- 0:00:26

      Average standard deviation of split frequencies: 0.010823

      555500 -- (-545.829) (-543.132) [-541.953] (-547.444) * (-544.667) (-541.856) [-546.111] (-542.288) -- 0:00:26
      556000 -- [-544.136] (-543.815) (-542.629) (-545.335) * (-552.762) [-545.137] (-548.044) (-543.744) -- 0:00:26
      556500 -- (-543.033) (-544.907) (-543.109) [-544.124] * (-545.120) [-545.814] (-544.122) (-544.722) -- 0:00:26
      557000 -- [-542.872] (-545.801) (-545.121) (-543.776) * [-544.207] (-542.836) (-541.784) (-544.548) -- 0:00:26
      557500 -- (-542.836) (-545.260) [-541.924] (-544.951) * (-545.258) (-543.513) (-542.827) [-542.410] -- 0:00:26
      558000 -- (-545.432) (-542.027) (-548.805) [-545.189] * (-543.842) (-544.396) (-549.790) [-541.549] -- 0:00:26
      558500 -- (-548.936) (-544.380) (-551.281) [-544.705] * (-543.772) [-545.014] (-542.536) (-542.881) -- 0:00:26
      559000 -- (-544.468) (-543.470) (-545.042) [-542.816] * (-543.355) (-541.847) [-544.191] (-542.649) -- 0:00:26
      559500 -- (-544.475) (-543.431) (-547.800) [-542.959] * (-543.844) (-544.506) [-542.072] (-543.292) -- 0:00:26
      560000 -- [-542.610] (-545.165) (-547.674) (-543.321) * [-542.934] (-543.483) (-543.864) (-542.756) -- 0:00:26

      Average standard deviation of split frequencies: 0.011029

      560500 -- (-545.373) (-543.241) (-545.333) [-544.789] * [-543.434] (-542.394) (-545.431) (-544.535) -- 0:00:26
      561000 -- (-547.287) [-542.731] (-542.976) (-543.555) * (-546.387) (-545.271) [-542.370] (-547.346) -- 0:00:26
      561500 -- (-542.960) (-543.212) (-544.379) [-542.763] * (-543.148) (-543.900) [-542.477] (-544.324) -- 0:00:26
      562000 -- (-545.927) (-543.254) (-544.216) [-543.811] * (-547.963) [-542.913] (-544.562) (-546.267) -- 0:00:26
      562500 -- [-546.717] (-545.033) (-543.492) (-543.863) * (-544.435) (-543.278) [-543.809] (-544.103) -- 0:00:26
      563000 -- (-545.498) (-543.640) [-542.769] (-544.207) * [-542.264] (-545.109) (-546.940) (-542.424) -- 0:00:26
      563500 -- (-542.655) (-544.621) (-545.281) [-544.038] * (-543.005) (-542.237) (-545.098) [-546.452] -- 0:00:26
      564000 -- (-545.226) (-544.771) [-544.467] (-545.499) * [-543.267] (-546.321) (-543.900) (-550.931) -- 0:00:26
      564500 -- (-544.147) [-544.191] (-543.631) (-542.508) * (-542.610) [-544.494] (-544.419) (-543.533) -- 0:00:26
      565000 -- (-542.190) (-541.925) (-552.454) [-541.629] * (-545.683) [-544.623] (-545.622) (-546.535) -- 0:00:26

      Average standard deviation of split frequencies: 0.011660

      565500 -- (-543.699) [-544.490] (-541.938) (-544.041) * [-543.656] (-545.552) (-543.189) (-545.562) -- 0:00:26
      566000 -- (-544.258) [-542.780] (-543.164) (-543.420) * [-542.794] (-545.549) (-542.142) (-545.707) -- 0:00:26
      566500 -- (-543.191) (-543.432) [-545.079] (-542.700) * [-544.844] (-545.450) (-542.887) (-542.941) -- 0:00:26
      567000 -- (-542.532) [-543.385] (-543.243) (-542.281) * (-544.670) [-542.047] (-542.060) (-544.245) -- 0:00:25
      567500 -- (-542.851) (-544.941) [-544.420] (-545.513) * (-545.635) (-547.399) [-545.570] (-545.222) -- 0:00:25
      568000 -- (-542.467) [-542.699] (-542.200) (-543.237) * (-544.776) [-545.519] (-544.733) (-543.358) -- 0:00:25
      568500 -- (-542.271) (-544.168) (-542.249) [-542.478] * (-542.664) [-544.139] (-542.667) (-542.460) -- 0:00:25
      569000 -- (-543.226) [-545.567] (-544.090) (-546.171) * [-543.259] (-544.759) (-542.130) (-542.939) -- 0:00:25
      569500 -- (-542.902) (-542.872) [-543.525] (-542.931) * (-543.523) (-544.303) (-543.292) [-546.544] -- 0:00:25
      570000 -- (-542.281) [-543.773] (-543.406) (-542.459) * (-542.891) (-544.575) (-543.524) [-546.106] -- 0:00:25

      Average standard deviation of split frequencies: 0.011613

      570500 -- (-542.464) [-542.631] (-542.978) (-545.176) * (-546.150) (-548.515) (-543.645) [-545.024] -- 0:00:25
      571000 -- [-544.244] (-544.863) (-544.656) (-543.994) * [-543.516] (-545.541) (-542.702) (-547.072) -- 0:00:25
      571500 -- (-542.445) [-545.681] (-542.181) (-545.447) * (-543.198) (-542.863) [-544.497] (-542.964) -- 0:00:25
      572000 -- (-543.680) (-546.987) [-542.653] (-550.422) * (-547.759) [-542.631] (-541.735) (-544.472) -- 0:00:25
      572500 -- (-547.785) (-545.767) [-543.675] (-543.007) * (-545.793) [-542.008] (-545.306) (-543.567) -- 0:00:25
      573000 -- (-547.773) (-549.507) [-546.037] (-543.431) * (-542.358) (-545.150) [-544.164] (-542.365) -- 0:00:25
      573500 -- (-545.588) [-544.215] (-546.572) (-542.358) * (-546.701) (-543.421) (-545.158) [-542.624] -- 0:00:25
      574000 -- (-542.478) (-546.752) [-547.277] (-544.762) * (-543.647) [-544.019] (-543.563) (-545.066) -- 0:00:25
      574500 -- (-543.114) (-546.192) [-544.810] (-545.845) * (-544.041) (-543.541) (-543.777) [-545.213] -- 0:00:25
      575000 -- (-544.709) (-543.595) [-543.838] (-544.693) * (-544.758) [-542.314] (-543.986) (-543.120) -- 0:00:25

      Average standard deviation of split frequencies: 0.011891

      575500 -- (-544.446) (-549.713) (-545.943) [-543.162] * [-547.823] (-543.439) (-546.059) (-543.464) -- 0:00:25
      576000 -- (-545.884) [-542.054] (-547.412) (-542.708) * [-543.640] (-542.000) (-542.622) (-543.550) -- 0:00:25
      576500 -- [-543.369] (-542.893) (-547.232) (-547.205) * [-542.884] (-542.206) (-546.828) (-543.169) -- 0:00:25
      577000 -- (-542.829) [-545.130] (-545.989) (-543.645) * (-544.414) (-543.144) [-543.036] (-546.782) -- 0:00:25
      577500 -- [-543.341] (-547.903) (-543.190) (-543.352) * (-544.737) [-542.710] (-547.499) (-542.227) -- 0:00:25
      578000 -- (-543.228) (-547.734) [-545.787] (-545.564) * [-547.165] (-544.060) (-550.029) (-544.626) -- 0:00:25
      578500 -- [-542.211] (-546.228) (-542.177) (-543.977) * (-543.645) (-545.772) (-543.179) [-544.161] -- 0:00:25
      579000 -- (-541.965) (-543.848) (-544.397) [-543.562] * (-544.854) (-543.693) [-542.955] (-542.757) -- 0:00:25
      579500 -- (-542.484) (-542.727) (-544.799) [-542.553] * (-542.957) [-543.926] (-542.817) (-543.389) -- 0:00:25
      580000 -- [-541.919] (-542.368) (-541.734) (-543.826) * (-544.555) (-547.712) [-543.793] (-543.410) -- 0:00:25

      Average standard deviation of split frequencies: 0.012786

      580500 -- (-546.722) (-545.673) [-544.200] (-546.694) * (-543.997) [-546.383] (-543.565) (-548.180) -- 0:00:25
      581000 -- (-544.176) (-542.671) (-545.082) [-543.460] * (-545.767) (-546.065) (-545.209) [-542.764] -- 0:00:25
      581500 -- (-543.553) (-545.925) [-543.862] (-545.751) * (-543.651) (-545.743) [-546.649] (-542.876) -- 0:00:25
      582000 -- (-541.815) [-545.679] (-546.733) (-543.561) * (-550.363) [-543.242] (-544.801) (-544.181) -- 0:00:25
      582500 -- (-542.631) [-542.527] (-545.827) (-545.339) * (-545.074) (-546.223) [-544.050] (-543.763) -- 0:00:25
      583000 -- (-542.349) (-542.623) (-544.595) [-545.539] * (-543.768) (-541.920) [-542.305] (-547.518) -- 0:00:25
      583500 -- (-544.205) (-543.316) (-546.448) [-543.472] * [-542.296] (-543.047) (-544.035) (-545.294) -- 0:00:24
      584000 -- [-542.993] (-545.663) (-543.789) (-543.560) * (-546.162) (-544.600) (-544.188) [-544.594] -- 0:00:24
      584500 -- (-543.370) (-544.427) (-544.568) [-542.368] * (-543.506) [-546.341] (-543.502) (-543.884) -- 0:00:24
      585000 -- (-542.891) [-543.930] (-543.906) (-542.074) * [-546.675] (-550.688) (-544.255) (-544.356) -- 0:00:24

      Average standard deviation of split frequencies: 0.012972

      585500 -- (-544.718) [-544.279] (-544.785) (-546.373) * (-543.848) (-546.228) (-542.150) [-542.401] -- 0:00:24
      586000 -- (-543.868) [-542.813] (-546.692) (-542.283) * (-543.034) (-542.618) [-542.598] (-542.996) -- 0:00:24
      586500 -- (-544.316) (-543.224) (-541.993) [-542.505] * (-545.956) [-543.457] (-546.521) (-546.941) -- 0:00:24
      587000 -- [-543.544] (-542.026) (-542.116) (-545.505) * (-542.885) [-543.430] (-544.312) (-547.760) -- 0:00:24
      587500 -- (-542.558) (-542.587) [-544.876] (-550.531) * (-544.157) (-548.448) (-547.368) [-542.332] -- 0:00:24
      588000 -- (-545.571) (-543.068) (-543.876) [-546.198] * (-544.741) (-544.101) (-543.788) [-543.429] -- 0:00:24
      588500 -- (-544.507) (-543.654) (-542.115) [-543.776] * (-547.123) [-543.973] (-543.199) (-543.962) -- 0:00:24
      589000 -- (-545.145) (-542.427) (-543.671) [-544.301] * (-548.685) (-544.997) (-542.328) [-543.507] -- 0:00:24
      589500 -- [-543.407] (-544.388) (-547.477) (-542.602) * [-542.065] (-544.611) (-543.394) (-545.419) -- 0:00:24
      590000 -- [-542.738] (-548.008) (-546.119) (-541.829) * [-544.789] (-544.064) (-543.823) (-550.477) -- 0:00:24

      Average standard deviation of split frequencies: 0.012420

      590500 -- (-545.986) [-543.936] (-542.381) (-542.975) * (-542.317) (-545.827) [-544.583] (-544.041) -- 0:00:24
      591000 -- (-546.017) (-544.682) (-543.501) [-542.928] * [-543.291] (-544.507) (-544.638) (-545.688) -- 0:00:24
      591500 -- (-544.529) [-544.494] (-544.855) (-548.169) * (-544.965) [-544.464] (-545.605) (-544.000) -- 0:00:24
      592000 -- [-544.675] (-542.519) (-545.514) (-543.375) * (-545.634) (-544.755) (-543.846) [-544.279] -- 0:00:24
      592500 -- (-546.514) [-544.474] (-541.924) (-543.923) * [-543.345] (-544.750) (-544.550) (-545.864) -- 0:00:24
      593000 -- (-546.701) (-542.652) (-548.308) [-543.046] * (-544.074) [-545.175] (-547.670) (-543.068) -- 0:00:24
      593500 -- (-544.114) (-543.005) [-544.841] (-546.653) * (-547.641) (-546.618) (-544.085) [-542.477] -- 0:00:24
      594000 -- (-541.719) (-546.546) [-545.009] (-545.665) * (-543.686) (-543.705) (-544.067) [-544.743] -- 0:00:24
      594500 -- (-544.021) (-548.504) (-543.285) [-544.583] * (-542.238) (-544.398) [-546.146] (-544.865) -- 0:00:24
      595000 -- (-543.595) (-547.434) (-542.813) [-545.217] * (-543.234) [-543.510] (-543.757) (-543.948) -- 0:00:24

      Average standard deviation of split frequencies: 0.012013

      595500 -- (-543.796) (-548.368) [-542.775] (-548.156) * (-543.432) [-542.472] (-546.511) (-542.335) -- 0:00:24
      596000 -- (-545.662) (-543.809) [-541.972] (-543.910) * (-545.155) [-542.435] (-546.778) (-545.180) -- 0:00:24
      596500 -- (-547.793) (-544.704) (-546.669) [-543.649] * (-545.626) (-544.329) [-542.700] (-544.503) -- 0:00:24
      597000 -- (-544.403) (-546.909) [-546.641] (-543.999) * (-544.238) (-549.141) [-545.228] (-542.915) -- 0:00:24
      597500 -- [-542.474] (-542.092) (-543.845) (-547.005) * (-545.278) (-544.941) [-543.307] (-543.665) -- 0:00:24
      598000 -- [-541.839] (-546.026) (-541.646) (-542.606) * (-546.013) (-547.158) (-544.456) [-542.331] -- 0:00:24
      598500 -- [-544.746] (-549.150) (-545.287) (-544.231) * (-546.078) (-544.908) (-542.673) [-544.098] -- 0:00:24
      599000 -- (-545.894) (-548.025) [-543.301] (-545.374) * (-544.226) (-544.891) (-543.606) [-542.841] -- 0:00:24
      599500 -- (-547.132) (-545.197) [-542.421] (-542.430) * [-544.161] (-544.095) (-545.607) (-545.058) -- 0:00:24
      600000 -- (-545.753) [-541.846] (-543.811) (-546.508) * (-544.019) (-545.461) (-542.596) [-541.789] -- 0:00:24

      Average standard deviation of split frequencies: 0.011674

      600500 -- [-542.660] (-542.390) (-546.885) (-546.832) * (-545.548) (-544.686) [-544.491] (-543.314) -- 0:00:23
      601000 -- (-545.147) (-549.130) [-542.474] (-549.032) * [-545.901] (-546.173) (-544.785) (-542.384) -- 0:00:23
      601500 -- (-542.575) (-542.328) (-541.710) [-543.933] * (-545.187) (-545.401) (-543.940) [-542.239] -- 0:00:23
      602000 -- (-544.936) (-541.738) (-544.840) [-545.352] * (-546.507) (-544.030) [-543.668] (-546.314) -- 0:00:23
      602500 -- [-542.640] (-547.695) (-542.929) (-544.134) * (-544.399) (-544.679) [-542.930] (-546.777) -- 0:00:23
      603000 -- (-544.107) (-545.524) (-548.081) [-542.700] * (-547.788) [-544.518] (-543.554) (-545.542) -- 0:00:23
      603500 -- (-544.780) (-543.736) (-547.376) [-543.884] * (-542.500) (-542.197) [-544.801] (-543.435) -- 0:00:23
      604000 -- (-543.708) [-543.255] (-543.273) (-544.178) * (-543.111) [-542.953] (-541.830) (-543.621) -- 0:00:23
      604500 -- (-543.629) [-542.118] (-544.457) (-545.609) * (-543.714) (-544.427) (-542.705) [-544.140] -- 0:00:23
      605000 -- (-542.562) (-544.483) (-544.280) [-548.897] * (-549.147) [-545.582] (-543.383) (-542.228) -- 0:00:23

      Average standard deviation of split frequencies: 0.010988

      605500 -- (-546.483) (-545.649) [-543.484] (-544.677) * (-542.687) (-543.184) (-544.970) [-542.402] -- 0:00:23
      606000 -- (-543.069) (-544.333) (-543.738) [-543.021] * (-543.859) (-543.587) [-544.075] (-544.692) -- 0:00:23
      606500 -- (-542.254) (-547.073) [-543.893] (-542.696) * [-542.976] (-543.811) (-542.917) (-543.169) -- 0:00:23
      607000 -- (-544.989) (-547.295) [-543.458] (-544.172) * (-543.563) (-543.028) [-542.139] (-543.847) -- 0:00:23
      607500 -- (-546.291) [-546.817] (-544.771) (-544.911) * (-546.973) [-543.040] (-543.218) (-544.811) -- 0:00:23
      608000 -- (-544.020) (-543.350) (-543.554) [-542.487] * (-543.005) (-542.834) [-542.573] (-544.163) -- 0:00:23
      608500 -- [-545.431] (-542.696) (-544.280) (-542.590) * (-549.873) [-543.309] (-547.597) (-544.609) -- 0:00:23
      609000 -- [-541.719] (-544.733) (-543.591) (-542.036) * [-550.801] (-547.836) (-543.529) (-544.706) -- 0:00:23
      609500 -- (-542.130) (-544.454) [-543.173] (-542.393) * (-547.394) (-542.581) [-542.666] (-545.186) -- 0:00:23
      610000 -- (-548.191) [-544.378] (-542.161) (-542.838) * (-551.604) [-542.386] (-545.244) (-544.651) -- 0:00:23

      Average standard deviation of split frequencies: 0.010566

      610500 -- (-546.552) (-543.250) (-546.291) [-545.488] * (-542.464) (-544.726) [-550.236] (-543.734) -- 0:00:23
      611000 -- (-543.598) (-546.087) (-543.965) [-542.482] * (-543.410) (-548.300) (-542.872) [-544.070] -- 0:00:23
      611500 -- (-541.649) [-544.197] (-543.527) (-543.631) * (-542.092) (-545.952) [-543.055] (-543.119) -- 0:00:23
      612000 -- (-542.610) (-545.430) (-549.215) [-545.446] * (-543.587) [-544.520] (-545.356) (-542.259) -- 0:00:23
      612500 -- [-541.686] (-545.245) (-547.187) (-543.540) * (-542.519) (-544.261) (-546.023) [-541.966] -- 0:00:23
      613000 -- [-543.120] (-543.556) (-544.810) (-542.147) * (-545.781) [-543.491] (-542.143) (-542.528) -- 0:00:23
      613500 -- (-545.125) (-545.479) [-543.411] (-542.669) * (-543.307) (-545.472) [-543.874] (-544.496) -- 0:00:23
      614000 -- (-548.082) (-546.189) [-542.518] (-545.364) * (-544.841) [-545.779] (-550.673) (-545.264) -- 0:00:23
      614500 -- (-543.536) (-544.002) (-545.059) [-543.174] * (-545.585) (-543.243) (-546.432) [-542.058] -- 0:00:23
      615000 -- [-543.376] (-545.123) (-543.238) (-546.541) * (-546.681) (-541.994) [-544.178] (-541.971) -- 0:00:23

      Average standard deviation of split frequencies: 0.010666

      615500 -- (-541.820) [-545.616] (-544.404) (-543.335) * (-544.579) (-542.344) (-547.097) [-542.349] -- 0:00:23
      616000 -- [-542.900] (-543.780) (-542.670) (-547.660) * [-543.709] (-546.776) (-544.814) (-545.140) -- 0:00:23
      616500 -- (-543.683) (-545.890) (-542.582) [-543.140] * (-546.426) (-543.990) (-542.325) [-542.798] -- 0:00:23
      617000 -- (-542.778) (-543.783) (-542.509) [-544.972] * [-542.202] (-545.577) (-546.313) (-544.560) -- 0:00:22
      617500 -- [-547.360] (-544.011) (-544.639) (-545.617) * [-543.180] (-542.540) (-546.172) (-543.759) -- 0:00:22
      618000 -- (-543.162) (-542.826) [-544.111] (-543.413) * [-543.955] (-543.001) (-544.180) (-543.333) -- 0:00:22
      618500 -- [-545.988] (-545.532) (-545.778) (-543.404) * [-542.175] (-543.565) (-542.847) (-543.207) -- 0:00:22
      619000 -- (-543.359) (-542.630) (-545.048) [-542.461] * (-542.398) (-542.113) (-543.525) [-544.186] -- 0:00:22
      619500 -- (-545.603) (-543.146) [-543.316] (-543.953) * (-542.179) (-548.506) (-545.994) [-543.557] -- 0:00:22
      620000 -- (-544.363) (-543.831) [-543.430] (-545.607) * (-542.314) (-543.554) (-546.629) [-545.145] -- 0:00:22

      Average standard deviation of split frequencies: 0.010158

      620500 -- [-541.785] (-541.845) (-543.976) (-542.911) * [-548.281] (-542.712) (-543.888) (-543.418) -- 0:00:22
      621000 -- (-543.215) [-543.479] (-543.283) (-550.308) * (-543.416) (-542.408) [-544.183] (-546.952) -- 0:00:22
      621500 -- (-542.482) (-543.341) (-542.989) [-543.628] * (-545.365) [-544.339] (-544.280) (-543.817) -- 0:00:22
      622000 -- (-544.598) (-547.540) (-542.839) [-543.554] * [-545.933] (-550.802) (-545.007) (-544.289) -- 0:00:22
      622500 -- (-547.655) (-543.101) [-545.195] (-543.305) * (-546.275) (-543.883) [-542.377] (-544.200) -- 0:00:22
      623000 -- (-545.973) (-546.315) [-549.653] (-546.272) * (-544.130) (-548.019) (-542.395) [-544.554] -- 0:00:22
      623500 -- [-544.047] (-545.250) (-543.610) (-548.422) * (-542.667) [-544.447] (-545.386) (-543.310) -- 0:00:22
      624000 -- (-545.492) (-544.058) (-543.690) [-545.759] * (-544.065) [-544.256] (-542.970) (-542.301) -- 0:00:22
      624500 -- [-550.197] (-546.004) (-546.758) (-542.906) * [-544.223] (-545.696) (-545.191) (-542.144) -- 0:00:22
      625000 -- (-543.807) (-543.019) [-546.425] (-542.659) * [-544.251] (-544.761) (-548.397) (-548.849) -- 0:00:22

      Average standard deviation of split frequencies: 0.010543

      625500 -- (-551.894) (-549.067) [-543.114] (-542.400) * (-544.042) [-542.198] (-543.540) (-544.710) -- 0:00:22
      626000 -- (-543.024) (-544.379) (-543.614) [-544.538] * (-542.642) (-542.163) (-545.042) [-543.713] -- 0:00:22
      626500 -- [-542.832] (-545.846) (-546.403) (-546.305) * (-545.808) (-544.717) (-546.061) [-543.232] -- 0:00:22
      627000 -- (-542.701) [-543.235] (-542.217) (-544.139) * (-543.452) (-544.910) [-545.358] (-543.702) -- 0:00:22
      627500 -- [-542.768] (-543.213) (-544.173) (-542.777) * (-545.337) [-543.654] (-542.605) (-543.590) -- 0:00:22
      628000 -- (-544.358) (-543.598) [-546.645] (-542.024) * (-542.092) [-545.892] (-545.412) (-543.940) -- 0:00:22
      628500 -- (-544.142) [-544.576] (-547.941) (-543.514) * [-543.673] (-544.516) (-543.385) (-545.243) -- 0:00:22
      629000 -- (-544.327) (-547.465) [-550.298] (-542.471) * (-544.375) (-542.348) [-545.687] (-546.289) -- 0:00:22
      629500 -- [-542.393] (-545.387) (-549.226) (-542.511) * (-545.633) (-543.950) [-544.311] (-545.790) -- 0:00:22
      630000 -- (-543.603) (-542.170) [-544.352] (-547.126) * (-545.921) (-543.700) (-543.713) [-547.453] -- 0:00:22

      Average standard deviation of split frequencies: 0.010465

      630500 -- [-545.003] (-542.155) (-544.983) (-548.231) * (-543.660) (-546.686) [-543.248] (-542.524) -- 0:00:22
      631000 -- (-545.885) (-545.121) (-542.277) [-544.143] * (-543.157) (-543.594) (-541.925) [-543.441] -- 0:00:22
      631500 -- (-547.102) [-542.755] (-543.161) (-549.511) * (-544.142) (-544.567) (-542.208) [-544.861] -- 0:00:22
      632000 -- (-545.006) (-545.922) [-544.523] (-543.912) * (-548.689) [-544.260] (-542.804) (-543.783) -- 0:00:22
      632500 -- (-542.538) (-545.543) [-546.268] (-544.584) * (-544.394) (-542.541) [-542.746] (-544.804) -- 0:00:22
      633000 -- [-542.564] (-544.847) (-546.727) (-543.156) * (-544.111) (-541.897) [-542.697] (-543.841) -- 0:00:22
      633500 -- (-541.866) (-543.610) [-543.448] (-542.330) * (-547.013) [-543.810] (-544.297) (-548.026) -- 0:00:21
      634000 -- (-544.438) [-543.724] (-550.172) (-542.349) * [-543.262] (-542.297) (-543.715) (-542.492) -- 0:00:21
      634500 -- [-543.734] (-543.925) (-546.183) (-544.191) * [-543.401] (-543.392) (-542.742) (-543.769) -- 0:00:21
      635000 -- (-544.560) (-543.662) [-542.130] (-544.091) * (-544.225) (-542.918) [-543.101] (-542.893) -- 0:00:21

      Average standard deviation of split frequencies: 0.010469

      635500 -- [-542.389] (-546.922) (-542.224) (-544.671) * [-547.236] (-546.815) (-542.893) (-543.085) -- 0:00:21
      636000 -- (-541.786) (-542.379) [-541.663] (-543.592) * (-548.440) (-545.372) [-541.829] (-549.045) -- 0:00:21
      636500 -- [-543.627] (-545.528) (-545.117) (-544.254) * (-543.348) (-547.227) [-542.909] (-547.874) -- 0:00:21
      637000 -- (-545.802) (-542.530) (-544.176) [-542.815] * (-546.283) (-547.893) (-541.850) [-542.781] -- 0:00:21
      637500 -- (-545.079) (-543.981) [-548.139] (-543.219) * (-542.136) [-542.128] (-542.644) (-542.844) -- 0:00:21
      638000 -- [-543.429] (-543.926) (-550.867) (-544.520) * (-545.308) (-549.561) [-542.097] (-542.384) -- 0:00:21
      638500 -- (-544.547) (-542.174) (-548.508) [-545.637] * [-546.190] (-543.128) (-542.532) (-543.369) -- 0:00:21
      639000 -- (-542.964) (-544.054) (-545.195) [-543.661] * (-544.616) [-544.913] (-543.927) (-543.903) -- 0:00:21
      639500 -- (-541.845) [-541.800] (-543.523) (-544.259) * (-543.386) (-543.417) (-544.325) [-543.657] -- 0:00:21
      640000 -- [-543.755] (-542.945) (-547.204) (-548.229) * (-543.444) (-549.613) [-544.369] (-543.667) -- 0:00:21

      Average standard deviation of split frequencies: 0.010301

      640500 -- (-545.180) (-542.822) [-545.875] (-548.094) * (-543.713) (-550.429) [-542.469] (-544.330) -- 0:00:21
      641000 -- (-542.803) [-542.264] (-545.270) (-544.918) * (-547.403) (-543.674) [-544.117] (-543.856) -- 0:00:21
      641500 -- [-541.835] (-544.373) (-544.538) (-543.047) * (-546.053) (-545.999) [-543.628] (-543.571) -- 0:00:21
      642000 -- (-544.512) (-547.017) [-546.128] (-543.665) * (-542.868) (-545.154) (-544.727) [-545.712] -- 0:00:21
      642500 -- (-543.940) (-542.790) [-543.410] (-542.916) * (-547.509) [-543.633] (-544.251) (-544.995) -- 0:00:21
      643000 -- (-543.942) (-547.379) [-542.368] (-547.758) * (-543.735) (-543.370) [-544.458] (-542.705) -- 0:00:21
      643500 -- (-542.626) [-543.448] (-545.421) (-546.476) * [-542.136] (-545.931) (-542.790) (-543.216) -- 0:00:21
      644000 -- [-545.198] (-544.362) (-548.724) (-548.280) * [-542.847] (-544.784) (-542.251) (-542.150) -- 0:00:21
      644500 -- (-545.215) (-544.706) (-544.437) [-543.769] * (-545.388) (-543.714) (-543.065) [-542.597] -- 0:00:21
      645000 -- (-543.485) [-546.528] (-543.403) (-542.414) * (-542.194) (-547.424) (-544.426) [-542.363] -- 0:00:21

      Average standard deviation of split frequencies: 0.010490

      645500 -- (-545.740) (-547.528) (-541.713) [-545.310] * [-542.662] (-543.453) (-543.430) (-543.116) -- 0:00:21
      646000 -- (-547.970) (-542.553) (-542.437) [-541.881] * (-542.662) (-547.680) (-543.878) [-547.094] -- 0:00:21
      646500 -- (-546.269) [-543.981] (-543.983) (-543.101) * [-542.594] (-543.471) (-542.458) (-549.659) -- 0:00:21
      647000 -- (-547.785) (-543.151) [-545.020] (-546.029) * (-542.562) (-548.927) (-543.277) [-542.625] -- 0:00:21
      647500 -- (-544.854) (-546.279) (-543.098) [-543.438] * (-544.472) (-545.867) [-550.666] (-550.810) -- 0:00:21
      648000 -- (-544.890) (-542.761) [-546.871] (-542.128) * (-545.318) (-542.389) [-544.179] (-544.753) -- 0:00:21
      648500 -- (-544.054) (-543.384) (-545.074) [-542.370] * [-545.774] (-546.393) (-542.392) (-543.475) -- 0:00:21
      649000 -- (-545.337) (-544.828) [-542.312] (-544.259) * [-542.251] (-543.856) (-549.077) (-543.834) -- 0:00:21
      649500 -- (-547.461) [-542.631] (-544.057) (-542.386) * (-544.715) [-543.470] (-541.938) (-548.459) -- 0:00:21
      650000 -- (-544.650) (-546.099) (-543.197) [-543.493] * [-543.628] (-548.750) (-542.113) (-542.919) -- 0:00:21

      Average standard deviation of split frequencies: 0.010143

      650500 -- [-543.003] (-543.453) (-545.952) (-542.198) * (-545.021) (-547.990) (-543.328) [-543.010] -- 0:00:20
      651000 -- (-550.095) (-544.371) [-548.649] (-543.851) * [-542.216] (-544.863) (-544.281) (-546.058) -- 0:00:20
      651500 -- (-542.907) [-542.946] (-546.692) (-543.201) * (-547.135) [-543.813] (-546.116) (-542.854) -- 0:00:20
      652000 -- (-544.810) [-545.394] (-542.877) (-545.387) * (-544.801) (-542.769) (-544.540) [-542.908] -- 0:00:20
      652500 -- (-544.331) (-542.040) [-547.582] (-543.694) * (-546.265) (-542.681) (-543.528) [-542.702] -- 0:00:20
      653000 -- [-546.051] (-544.023) (-545.240) (-548.826) * (-542.995) [-542.556] (-542.184) (-542.243) -- 0:00:20
      653500 -- (-543.659) (-545.671) [-544.434] (-548.805) * [-543.210] (-544.115) (-542.561) (-545.305) -- 0:00:20
      654000 -- (-544.199) (-544.173) [-545.558] (-541.823) * [-544.603] (-545.643) (-546.144) (-543.940) -- 0:00:20
      654500 -- (-542.621) [-543.858] (-543.599) (-542.736) * [-543.327] (-544.623) (-544.171) (-543.246) -- 0:00:20
      655000 -- (-544.147) (-542.599) (-543.768) [-543.551] * (-542.175) [-545.295] (-542.294) (-544.218) -- 0:00:20

      Average standard deviation of split frequencies: 0.009477

      655500 -- (-543.274) (-544.504) [-544.108] (-545.364) * (-542.590) (-546.893) [-542.726] (-545.326) -- 0:00:20
      656000 -- (-543.832) [-544.439] (-543.006) (-544.582) * (-544.469) (-542.888) [-542.656] (-544.722) -- 0:00:20
      656500 -- [-544.962] (-545.673) (-542.058) (-542.466) * (-544.773) (-542.710) [-542.615] (-542.083) -- 0:00:20
      657000 -- (-542.582) (-542.647) (-545.269) [-544.700] * (-544.213) (-542.934) (-542.547) [-542.072] -- 0:00:20
      657500 -- (-541.856) [-542.123] (-544.611) (-545.743) * [-546.987] (-543.112) (-542.541) (-542.320) -- 0:00:20
      658000 -- (-542.772) (-543.671) [-543.492] (-547.001) * [-545.203] (-544.268) (-543.144) (-544.649) -- 0:00:20
      658500 -- [-541.716] (-546.403) (-545.493) (-547.406) * (-544.967) [-544.018] (-541.693) (-541.669) -- 0:00:20
      659000 -- (-545.785) (-545.120) [-542.109] (-544.041) * (-544.649) (-541.697) (-543.300) [-543.515] -- 0:00:20
      659500 -- (-544.998) [-545.955] (-543.876) (-544.678) * (-543.086) (-549.011) (-544.946) [-545.150] -- 0:00:20
      660000 -- (-548.384) (-545.460) (-545.370) [-544.289] * (-544.361) (-545.256) [-545.059] (-544.754) -- 0:00:20

      Average standard deviation of split frequencies: 0.009499

      660500 -- (-548.424) [-541.542] (-543.806) (-543.212) * [-544.479] (-544.078) (-548.283) (-544.218) -- 0:00:20
      661000 -- (-544.660) [-541.876] (-543.003) (-547.306) * [-545.912] (-543.235) (-542.169) (-542.477) -- 0:00:20
      661500 -- (-546.604) (-543.119) (-544.390) [-546.404] * [-541.990] (-544.660) (-542.145) (-543.295) -- 0:00:20
      662000 -- [-542.455] (-543.236) (-545.502) (-543.600) * (-543.078) (-542.810) (-546.581) [-543.525] -- 0:00:20
      662500 -- (-546.335) (-542.610) [-546.167] (-543.329) * (-542.919) [-544.293] (-548.725) (-543.510) -- 0:00:20
      663000 -- (-544.212) (-543.730) [-544.939] (-543.866) * [-541.930] (-544.583) (-544.783) (-543.283) -- 0:00:20
      663500 -- [-542.515] (-543.112) (-543.018) (-543.163) * (-543.032) (-542.732) (-544.784) [-543.245] -- 0:00:20
      664000 -- (-543.059) [-541.960] (-545.002) (-546.441) * (-544.175) (-551.231) [-545.893] (-543.931) -- 0:00:20
      664500 -- (-542.711) [-542.242] (-543.012) (-544.482) * [-543.512] (-544.189) (-543.186) (-548.110) -- 0:00:20
      665000 -- (-542.719) (-542.248) [-542.794] (-543.126) * (-545.844) (-543.341) (-545.313) [-550.660] -- 0:00:20

      Average standard deviation of split frequencies: 0.008980

      665500 -- (-542.113) (-549.920) [-542.869] (-543.502) * [-542.238] (-543.339) (-542.291) (-546.155) -- 0:00:20
      666000 -- (-542.088) (-545.411) (-546.824) [-542.028] * (-544.698) (-543.029) [-542.043] (-543.394) -- 0:00:20
      666500 -- (-543.710) (-545.497) [-543.581] (-541.714) * [-544.759] (-543.911) (-542.683) (-545.822) -- 0:00:20
      667000 -- (-545.351) [-542.653] (-544.284) (-543.481) * (-546.528) (-542.558) (-545.691) [-543.450] -- 0:00:19
      667500 -- (-544.976) (-542.978) [-542.809] (-544.023) * (-542.484) [-542.376] (-544.770) (-543.193) -- 0:00:19
      668000 -- (-543.671) (-544.935) [-543.918] (-542.724) * [-542.788] (-543.877) (-543.438) (-545.249) -- 0:00:19
      668500 -- (-544.351) (-542.629) (-543.163) [-543.968] * [-544.310] (-542.992) (-543.958) (-545.098) -- 0:00:19
      669000 -- (-544.989) [-543.934] (-543.577) (-543.303) * [-544.940] (-543.416) (-543.320) (-546.838) -- 0:00:19
      669500 -- (-542.599) (-543.471) (-546.513) [-545.430] * (-543.276) (-543.513) [-543.793] (-545.720) -- 0:00:19
      670000 -- [-545.555] (-543.367) (-544.125) (-542.038) * (-543.010) [-541.772] (-545.250) (-543.809) -- 0:00:19

      Average standard deviation of split frequencies: 0.009621

      670500 -- (-542.795) [-544.012] (-545.036) (-541.920) * (-545.586) (-543.523) [-543.543] (-545.316) -- 0:00:19
      671000 -- [-543.626] (-543.550) (-548.033) (-544.863) * (-542.317) (-543.274) (-545.372) [-544.236] -- 0:00:19
      671500 -- (-545.376) (-543.337) [-542.414] (-544.673) * [-543.559] (-544.161) (-543.225) (-543.563) -- 0:00:19
      672000 -- (-542.939) (-543.223) [-543.046] (-546.291) * (-544.062) (-544.099) (-546.920) [-543.349] -- 0:00:19
      672500 -- (-543.738) (-542.664) [-543.308] (-546.016) * (-544.034) (-543.482) [-543.427] (-544.180) -- 0:00:19
      673000 -- [-543.181] (-546.565) (-543.546) (-545.606) * (-543.304) [-543.897] (-542.668) (-544.256) -- 0:00:19
      673500 -- [-543.299] (-545.187) (-544.512) (-544.958) * (-545.891) (-544.055) [-543.808] (-544.109) -- 0:00:19
      674000 -- (-543.767) (-543.570) [-543.529] (-543.254) * (-544.462) (-544.691) [-543.201] (-543.861) -- 0:00:19
      674500 -- (-543.062) (-544.504) (-542.478) [-543.150] * [-544.697] (-543.242) (-541.981) (-544.776) -- 0:00:19
      675000 -- (-543.546) [-542.204] (-543.101) (-542.801) * (-543.742) (-547.702) (-550.416) [-546.321] -- 0:00:19

      Average standard deviation of split frequencies: 0.009414

      675500 -- [-543.538] (-546.871) (-544.084) (-544.004) * (-543.953) (-543.908) (-547.760) [-541.958] -- 0:00:19
      676000 -- (-544.199) (-544.713) (-541.864) [-543.757] * (-544.938) (-543.193) (-544.939) [-542.210] -- 0:00:19
      676500 -- (-544.105) [-543.836] (-544.147) (-543.584) * (-545.665) [-542.987] (-543.653) (-542.410) -- 0:00:19
      677000 -- [-543.354] (-546.355) (-547.601) (-544.767) * [-544.797] (-544.023) (-544.948) (-543.957) -- 0:00:19
      677500 -- (-544.248) [-543.353] (-547.880) (-544.266) * (-545.020) [-544.663] (-544.082) (-547.473) -- 0:00:19
      678000 -- (-545.069) (-543.218) [-544.305] (-544.266) * (-542.207) (-543.384) [-547.685] (-545.444) -- 0:00:19
      678500 -- (-543.369) (-542.281) (-546.151) [-542.240] * [-542.850] (-543.656) (-546.544) (-545.316) -- 0:00:19
      679000 -- [-543.602] (-543.292) (-542.670) (-541.548) * (-545.069) (-542.223) [-543.609] (-546.975) -- 0:00:19
      679500 -- (-547.370) (-543.094) [-544.546] (-541.947) * (-545.996) (-541.788) [-542.311] (-545.810) -- 0:00:19
      680000 -- (-543.918) (-544.996) [-543.979] (-542.181) * (-544.613) (-545.252) [-543.223] (-544.277) -- 0:00:19

      Average standard deviation of split frequencies: 0.009350

      680500 -- (-545.234) (-544.008) [-542.800] (-544.109) * [-546.652] (-545.830) (-542.647) (-547.018) -- 0:00:19
      681000 -- (-545.830) (-544.256) [-544.251] (-547.125) * (-547.224) (-543.463) (-542.919) [-548.831] -- 0:00:19
      681500 -- (-542.574) [-543.254] (-548.807) (-544.574) * (-543.925) (-544.173) (-543.845) [-543.915] -- 0:00:19
      682000 -- (-547.098) (-544.285) (-543.175) [-544.771] * (-543.939) (-547.092) (-542.965) [-544.012] -- 0:00:19
      682500 -- (-542.902) (-544.866) [-544.444] (-544.194) * (-544.880) (-542.526) [-543.661] (-544.561) -- 0:00:19
      683000 -- [-543.495] (-544.278) (-545.203) (-544.712) * [-543.946] (-542.293) (-542.706) (-544.778) -- 0:00:19
      683500 -- (-543.651) (-548.314) [-544.129] (-543.276) * (-543.322) (-543.217) [-545.455] (-543.584) -- 0:00:18
      684000 -- (-545.476) (-542.258) (-543.972) [-543.431] * (-542.004) (-543.944) (-550.277) [-542.626] -- 0:00:18
      684500 -- [-544.782] (-543.674) (-543.763) (-545.602) * (-542.957) [-542.343] (-543.393) (-542.645) -- 0:00:18
      685000 -- [-543.009] (-543.358) (-543.146) (-544.171) * (-543.835) (-549.200) [-543.739] (-542.956) -- 0:00:18

      Average standard deviation of split frequencies: 0.008847

      685500 -- [-544.298] (-542.085) (-544.274) (-546.787) * [-543.444] (-542.675) (-542.843) (-545.140) -- 0:00:18
      686000 -- (-541.823) [-542.232] (-547.155) (-550.246) * (-542.871) (-543.598) (-544.754) [-542.936] -- 0:00:18
      686500 -- (-543.323) (-546.203) [-545.921] (-548.638) * (-543.760) (-542.196) (-542.396) [-545.139] -- 0:00:18
      687000 -- (-543.414) [-543.371] (-542.789) (-548.946) * (-542.822) [-543.481] (-543.260) (-543.178) -- 0:00:18
      687500 -- [-545.977] (-546.362) (-543.011) (-542.799) * [-543.166] (-543.446) (-548.374) (-543.169) -- 0:00:18
      688000 -- (-542.425) (-549.788) (-545.496) [-542.653] * (-545.027) (-546.656) (-542.451) [-543.389] -- 0:00:18
      688500 -- (-544.436) [-544.296] (-543.390) (-541.963) * (-545.431) [-544.927] (-543.403) (-544.336) -- 0:00:18
      689000 -- (-543.816) (-544.698) [-544.863] (-542.967) * [-542.766] (-545.306) (-543.789) (-546.447) -- 0:00:18
      689500 -- (-543.626) (-545.959) [-543.394] (-542.719) * (-542.545) [-542.830] (-543.597) (-543.907) -- 0:00:18
      690000 -- (-543.065) [-548.017] (-546.295) (-546.376) * [-542.482] (-541.853) (-542.415) (-544.966) -- 0:00:18

      Average standard deviation of split frequencies: 0.009683

      690500 -- (-545.010) [-544.936] (-543.131) (-547.262) * (-542.246) [-541.800] (-543.280) (-545.330) -- 0:00:18
      691000 -- (-547.317) (-550.940) (-542.424) [-544.820] * (-542.486) [-544.627] (-543.203) (-545.225) -- 0:00:18
      691500 -- [-543.978] (-546.787) (-542.557) (-544.878) * (-543.765) (-545.544) [-542.252] (-543.168) -- 0:00:18
      692000 -- (-544.330) [-543.497] (-543.319) (-543.954) * (-545.266) [-542.745] (-543.355) (-541.942) -- 0:00:18
      692500 -- (-542.874) [-545.491] (-542.034) (-543.526) * [-543.319] (-544.652) (-542.316) (-547.806) -- 0:00:18
      693000 -- (-542.221) (-544.880) [-542.602] (-542.812) * (-545.202) [-544.118] (-542.387) (-543.428) -- 0:00:18
      693500 -- (-543.475) (-545.632) (-543.209) [-544.945] * [-547.367] (-542.729) (-542.407) (-548.015) -- 0:00:18
      694000 -- (-544.480) [-542.421] (-550.777) (-544.004) * (-545.225) [-542.059] (-543.737) (-545.368) -- 0:00:18
      694500 -- (-544.411) (-544.035) [-545.136] (-546.190) * [-544.889] (-541.689) (-544.997) (-543.540) -- 0:00:18
      695000 -- (-543.939) (-543.944) [-542.239] (-542.846) * (-542.995) (-541.851) [-542.448] (-543.812) -- 0:00:18

      Average standard deviation of split frequencies: 0.009482

      695500 -- (-543.591) (-544.548) (-543.538) [-544.631] * (-543.083) [-543.995] (-545.512) (-545.561) -- 0:00:18
      696000 -- [-543.555] (-544.804) (-542.043) (-544.493) * (-543.952) [-544.952] (-543.407) (-541.937) -- 0:00:18
      696500 -- (-543.654) [-544.165] (-545.403) (-553.590) * (-541.850) (-553.741) (-544.262) [-543.833] -- 0:00:18
      697000 -- (-544.056) (-542.791) [-543.402] (-547.106) * (-545.307) (-542.799) [-544.888] (-543.762) -- 0:00:18
      697500 -- [-545.208] (-545.621) (-542.244) (-544.312) * (-543.597) [-542.762] (-545.757) (-543.871) -- 0:00:18
      698000 -- [-544.011] (-543.827) (-544.703) (-543.554) * (-542.116) (-545.360) (-544.156) [-542.438] -- 0:00:18
      698500 -- [-542.595] (-542.573) (-545.459) (-544.825) * [-542.542] (-544.704) (-543.662) (-542.625) -- 0:00:18
      699000 -- [-542.341] (-542.409) (-544.271) (-544.376) * [-545.720] (-543.164) (-543.086) (-544.077) -- 0:00:18
      699500 -- (-543.391) (-547.903) [-543.163] (-541.789) * [-545.645] (-546.502) (-541.658) (-546.642) -- 0:00:18
      700000 -- (-543.846) (-543.167) (-542.691) [-542.141] * (-543.208) [-544.829] (-542.326) (-547.609) -- 0:00:18

      Average standard deviation of split frequencies: 0.009503

      700500 -- (-544.611) (-546.608) [-543.904] (-545.127) * (-542.717) (-542.999) [-544.305] (-541.735) -- 0:00:17
      701000 -- (-545.804) (-542.887) [-542.320] (-544.908) * (-545.023) (-543.282) [-542.423] (-544.389) -- 0:00:17
      701500 -- (-543.558) (-542.712) (-541.680) [-545.514] * (-548.675) (-542.682) (-544.155) [-543.672] -- 0:00:17
      702000 -- (-549.451) (-543.037) (-543.325) [-543.835] * (-548.563) (-545.063) [-545.054] (-543.009) -- 0:00:17
      702500 -- (-545.422) (-543.814) (-544.958) [-545.152] * (-544.398) (-543.706) (-542.239) [-542.920] -- 0:00:17
      703000 -- (-545.174) (-544.172) (-544.812) [-545.653] * (-542.277) [-542.768] (-542.608) (-543.243) -- 0:00:17
      703500 -- (-543.477) (-543.483) (-546.172) [-543.433] * (-542.189) (-543.315) (-544.285) [-543.502] -- 0:00:17
      704000 -- (-543.463) (-544.488) (-543.298) [-544.778] * [-543.827] (-541.640) (-544.415) (-542.942) -- 0:00:17
      704500 -- (-544.446) (-542.326) [-542.917] (-546.557) * (-547.803) (-543.265) [-542.355] (-543.434) -- 0:00:17
      705000 -- (-543.125) [-542.609] (-545.059) (-542.248) * [-542.726] (-544.635) (-542.649) (-542.858) -- 0:00:17

      Average standard deviation of split frequencies: 0.009473

      705500 -- (-545.179) [-543.944] (-544.057) (-545.855) * (-545.300) (-543.182) [-542.741] (-545.209) -- 0:00:17
      706000 -- [-544.198] (-542.471) (-545.291) (-545.754) * [-542.894] (-543.565) (-545.209) (-543.756) -- 0:00:17
      706500 -- (-544.503) (-541.928) (-543.422) [-543.955] * (-547.433) [-542.450] (-546.174) (-543.681) -- 0:00:17
      707000 -- (-543.801) (-543.361) (-543.747) [-545.930] * (-543.801) (-542.827) (-544.674) [-541.844] -- 0:00:17
      707500 -- [-543.780] (-546.243) (-546.774) (-542.596) * (-545.000) (-545.094) [-545.548] (-541.899) -- 0:00:17
      708000 -- (-542.751) (-543.819) [-548.109] (-548.644) * (-546.128) (-545.219) (-542.085) [-545.367] -- 0:00:17
      708500 -- (-545.015) (-542.491) [-544.164] (-546.099) * (-543.669) (-542.613) [-542.595] (-543.782) -- 0:00:17
      709000 -- (-549.402) (-548.777) [-547.187] (-544.162) * [-544.464] (-542.127) (-544.174) (-544.756) -- 0:00:17
      709500 -- (-546.792) (-548.201) (-545.591) [-543.714] * (-545.704) [-542.794] (-545.013) (-545.013) -- 0:00:17
      710000 -- (-542.777) (-554.647) [-548.160] (-541.876) * (-544.519) (-543.792) [-544.836] (-542.022) -- 0:00:17

      Average standard deviation of split frequencies: 0.009743

      710500 -- (-545.778) [-542.443] (-548.570) (-545.188) * (-542.809) (-545.928) [-544.539] (-544.068) -- 0:00:17
      711000 -- [-542.007] (-548.193) (-544.217) (-546.336) * (-544.622) [-545.376] (-542.353) (-544.657) -- 0:00:17
      711500 -- (-541.986) [-544.224] (-545.435) (-542.558) * (-547.952) (-542.781) [-543.187] (-547.803) -- 0:00:17
      712000 -- [-545.063] (-544.301) (-545.533) (-542.738) * [-546.261] (-544.804) (-547.244) (-546.812) -- 0:00:17
      712500 -- (-543.843) [-546.885] (-546.175) (-545.993) * (-543.354) (-543.454) [-542.284] (-545.945) -- 0:00:17
      713000 -- [-546.476] (-546.155) (-543.435) (-544.995) * (-551.614) (-547.746) [-542.920] (-543.864) -- 0:00:17
      713500 -- (-546.318) (-544.975) (-542.186) [-545.170] * [-542.470] (-544.932) (-543.838) (-544.043) -- 0:00:17
      714000 -- (-544.238) (-543.701) (-542.715) [-542.677] * [-544.234] (-543.313) (-545.197) (-544.306) -- 0:00:17
      714500 -- (-543.599) [-547.084] (-542.320) (-541.825) * (-543.196) [-545.742] (-544.528) (-544.766) -- 0:00:17
      715000 -- (-543.646) [-543.661] (-542.524) (-543.791) * (-542.361) (-543.348) (-542.760) [-543.661] -- 0:00:17

      Average standard deviation of split frequencies: 0.009505

      715500 -- (-542.948) [-542.679] (-542.932) (-544.326) * [-544.239] (-542.946) (-542.720) (-543.406) -- 0:00:17
      716000 -- (-542.636) (-544.286) (-542.238) [-544.127] * [-542.863] (-542.177) (-542.735) (-543.212) -- 0:00:17
      716500 -- [-542.862] (-547.007) (-544.283) (-541.938) * (-543.505) (-543.265) (-543.635) [-542.890] -- 0:00:17
      717000 -- [-546.526] (-544.513) (-546.798) (-546.302) * (-546.141) (-546.672) (-544.200) [-543.233] -- 0:00:16
      717500 -- (-544.124) (-543.296) (-546.644) [-544.993] * (-548.475) (-545.316) (-545.365) [-542.772] -- 0:00:16
      718000 -- [-548.264] (-542.421) (-550.850) (-548.237) * (-546.956) (-541.845) [-545.798] (-544.348) -- 0:00:16
      718500 -- (-542.274) [-542.434] (-547.754) (-544.939) * (-547.552) [-543.066] (-543.499) (-548.439) -- 0:00:16
      719000 -- (-543.825) [-543.059] (-543.830) (-542.425) * [-546.833] (-541.881) (-544.049) (-543.341) -- 0:00:16
      719500 -- [-543.849] (-542.653) (-544.444) (-544.412) * (-543.469) [-543.569] (-543.183) (-542.772) -- 0:00:16
      720000 -- (-543.327) [-542.677] (-542.763) (-542.078) * (-545.375) (-543.759) [-544.192] (-543.693) -- 0:00:16

      Average standard deviation of split frequencies: 0.008994

      720500 -- (-544.820) (-547.478) (-544.750) [-543.116] * (-546.274) (-541.702) (-542.059) [-542.867] -- 0:00:16
      721000 -- (-544.434) (-547.348) (-546.703) [-546.391] * (-544.774) [-544.153] (-542.416) (-545.322) -- 0:00:16
      721500 -- (-543.898) (-546.170) [-543.316] (-543.053) * (-544.308) (-542.479) (-542.116) [-545.270] -- 0:00:16
      722000 -- [-543.305] (-543.682) (-548.082) (-546.275) * (-547.537) [-545.724] (-545.012) (-547.710) -- 0:00:16
      722500 -- (-542.912) (-543.014) (-543.365) [-543.251] * [-543.764] (-545.700) (-544.971) (-546.012) -- 0:00:16
      723000 -- (-546.186) (-543.185) [-542.186] (-544.318) * [-542.920] (-544.472) (-543.752) (-545.921) -- 0:00:16
      723500 -- (-546.336) (-543.815) (-542.506) [-543.554] * (-542.492) (-543.981) [-553.074] (-546.831) -- 0:00:16
      724000 -- (-547.219) [-544.206] (-546.767) (-541.830) * (-545.980) [-543.131] (-551.266) (-543.995) -- 0:00:16
      724500 -- (-542.758) (-544.116) [-543.074] (-542.585) * (-544.300) [-542.778] (-543.978) (-543.178) -- 0:00:16
      725000 -- (-546.031) (-542.141) [-546.378] (-543.896) * (-544.368) (-544.948) (-547.786) [-542.972] -- 0:00:16

      Average standard deviation of split frequencies: 0.009415

      725500 -- (-544.093) [-542.057] (-546.598) (-545.280) * [-543.392] (-542.246) (-544.097) (-543.259) -- 0:00:16
      726000 -- (-544.898) (-548.096) [-545.310] (-543.824) * (-542.346) (-544.444) [-546.269] (-542.190) -- 0:00:16
      726500 -- (-542.928) (-543.638) [-543.902] (-543.759) * (-546.996) (-549.551) (-548.143) [-543.223] -- 0:00:16
      727000 -- (-543.405) (-546.088) (-547.574) [-543.728] * (-543.240) (-544.984) [-545.300] (-544.038) -- 0:00:16
      727500 -- (-542.102) (-545.025) (-543.912) [-543.537] * (-544.327) (-541.767) (-541.805) [-545.801] -- 0:00:16
      728000 -- (-543.052) [-546.969] (-544.985) (-550.551) * (-544.070) [-548.885] (-544.367) (-544.027) -- 0:00:16
      728500 -- (-546.689) [-546.156] (-543.518) (-553.837) * (-543.856) [-548.385] (-542.606) (-543.112) -- 0:00:16
      729000 -- (-544.668) (-545.684) (-544.994) [-542.358] * (-542.790) (-543.530) [-542.608] (-545.443) -- 0:00:16
      729500 -- (-542.304) [-543.247] (-543.153) (-542.987) * [-542.837] (-543.633) (-542.718) (-542.989) -- 0:00:16
      730000 -- [-542.390] (-546.196) (-545.035) (-545.143) * (-546.104) (-546.211) (-543.323) [-545.372] -- 0:00:16

      Average standard deviation of split frequencies: 0.009436

      730500 -- (-543.145) (-545.352) [-542.185] (-545.227) * [-542.916] (-544.329) (-544.419) (-549.958) -- 0:00:16
      731000 -- [-545.262] (-546.671) (-542.615) (-546.406) * (-543.710) (-543.350) [-542.620] (-543.468) -- 0:00:16
      731500 -- (-544.806) (-545.033) (-545.311) [-546.536] * [-541.981] (-544.027) (-542.328) (-545.112) -- 0:00:16
      732000 -- [-543.124] (-545.635) (-544.601) (-542.115) * (-541.810) (-545.583) [-542.914] (-544.006) -- 0:00:16
      732500 -- (-546.502) [-543.972] (-546.106) (-542.980) * (-545.359) (-552.176) (-542.897) [-542.759] -- 0:00:16
      733000 -- (-544.173) (-545.285) (-547.537) [-542.508] * [-545.679] (-542.922) (-543.267) (-542.069) -- 0:00:16
      733500 -- [-543.268] (-546.663) (-548.519) (-546.711) * (-546.845) (-542.955) (-549.167) [-544.831] -- 0:00:15
      734000 -- [-544.134] (-547.717) (-543.483) (-544.336) * (-546.474) (-542.962) [-541.583] (-543.641) -- 0:00:15
      734500 -- [-543.222] (-541.840) (-543.957) (-542.833) * (-543.803) [-547.005] (-541.858) (-543.505) -- 0:00:15
      735000 -- (-543.636) (-542.359) [-542.894] (-543.235) * (-543.947) [-546.623] (-543.585) (-542.077) -- 0:00:15

      Average standard deviation of split frequencies: 0.009687

      735500 -- (-544.543) (-544.323) (-543.535) [-543.982] * (-544.695) (-542.454) [-545.455] (-542.396) -- 0:00:15
      736000 -- (-544.482) [-545.548] (-543.281) (-544.038) * (-543.708) (-545.010) [-543.474] (-541.678) -- 0:00:15
      736500 -- (-543.776) [-547.134] (-542.346) (-546.242) * (-543.162) (-550.029) [-542.667] (-548.184) -- 0:00:15
      737000 -- (-544.646) (-544.603) [-542.931] (-544.574) * (-545.108) (-547.580) (-542.030) [-543.233] -- 0:00:15
      737500 -- (-544.697) (-542.968) [-542.468] (-543.966) * (-543.447) [-543.867] (-544.565) (-542.693) -- 0:00:15
      738000 -- (-547.175) (-541.952) [-543.613] (-543.147) * (-543.310) (-546.733) (-545.511) [-543.068] -- 0:00:15
      738500 -- [-545.373] (-542.226) (-545.377) (-544.033) * (-542.930) [-542.489] (-543.398) (-546.919) -- 0:00:15
      739000 -- [-544.979] (-544.478) (-542.287) (-542.258) * (-543.088) (-550.557) [-543.536] (-546.437) -- 0:00:15
      739500 -- [-543.551] (-544.202) (-543.067) (-545.143) * (-547.621) (-545.908) [-546.988] (-543.608) -- 0:00:15
      740000 -- (-544.851) (-542.719) [-544.562] (-553.016) * (-547.898) (-545.347) [-547.144] (-543.943) -- 0:00:15

      Average standard deviation of split frequencies: 0.009746

      740500 -- (-545.737) [-541.554] (-541.934) (-547.946) * (-546.768) [-544.045] (-547.063) (-543.334) -- 0:00:15
      741000 -- (-542.541) (-541.801) (-541.862) [-544.035] * (-542.233) (-545.090) [-547.782] (-548.182) -- 0:00:15
      741500 -- (-544.716) [-542.760] (-542.692) (-542.106) * (-544.650) (-545.323) (-542.205) [-543.306] -- 0:00:15
      742000 -- (-547.820) (-542.314) [-546.918] (-544.522) * (-545.370) (-543.255) (-542.201) [-548.056] -- 0:00:15
      742500 -- [-542.770] (-544.493) (-543.290) (-542.320) * (-545.925) (-544.509) [-545.478] (-543.029) -- 0:00:15
      743000 -- (-546.581) [-545.044] (-541.925) (-544.131) * (-543.289) (-544.719) (-545.801) [-543.932] -- 0:00:15
      743500 -- [-544.310] (-548.128) (-542.144) (-543.433) * (-544.518) (-543.655) (-547.307) [-542.890] -- 0:00:15
      744000 -- (-543.763) [-544.136] (-548.320) (-544.874) * [-543.113] (-548.968) (-545.144) (-543.859) -- 0:00:15
      744500 -- [-542.728] (-542.355) (-545.904) (-542.591) * (-542.792) (-548.501) (-542.567) [-541.890] -- 0:00:15
      745000 -- (-547.150) [-542.247] (-544.731) (-543.740) * (-542.853) [-543.564] (-547.136) (-543.979) -- 0:00:15

      Average standard deviation of split frequencies: 0.009676

      745500 -- [-543.817] (-548.797) (-544.553) (-544.181) * [-542.915] (-550.512) (-547.399) (-544.427) -- 0:00:15
      746000 -- (-545.555) (-545.277) [-542.799] (-544.154) * (-544.626) (-550.348) (-551.618) [-545.932] -- 0:00:15
      746500 -- (-541.940) (-544.198) (-543.956) [-545.534] * (-545.264) (-545.920) (-542.384) [-546.895] -- 0:00:15
      747000 -- (-544.414) (-542.673) (-542.676) [-543.006] * [-544.249] (-544.264) (-546.912) (-542.801) -- 0:00:15
      747500 -- (-542.181) [-544.742] (-543.684) (-543.667) * (-546.517) (-546.091) (-545.809) [-548.858] -- 0:00:15
      748000 -- [-544.724] (-545.711) (-547.384) (-541.874) * [-542.414] (-544.290) (-548.151) (-543.265) -- 0:00:15
      748500 -- (-542.975) (-542.854) [-547.701] (-542.986) * (-543.152) [-545.046] (-543.956) (-543.613) -- 0:00:15
      749000 -- (-543.543) [-545.748] (-542.603) (-544.933) * [-546.479] (-545.070) (-548.337) (-543.808) -- 0:00:15
      749500 -- (-545.343) (-542.828) (-542.258) [-543.633] * (-542.641) [-544.217] (-545.626) (-543.956) -- 0:00:15
      750000 -- (-546.147) (-543.583) [-542.715] (-546.454) * (-542.545) (-546.319) [-546.081] (-543.357) -- 0:00:15

      Average standard deviation of split frequencies: 0.008988

      750500 -- (-542.721) [-542.635] (-544.132) (-550.789) * (-546.356) (-546.169) [-543.534] (-542.586) -- 0:00:14
      751000 -- (-544.896) (-543.312) [-544.060] (-545.639) * (-543.687) (-549.064) [-542.823] (-546.557) -- 0:00:14
      751500 -- (-547.285) (-542.953) (-545.537) [-542.861] * [-544.854] (-546.703) (-542.326) (-545.336) -- 0:00:14
      752000 -- (-544.396) (-543.372) (-545.855) [-544.758] * (-544.224) (-546.110) [-545.262] (-542.803) -- 0:00:14
      752500 -- (-543.942) [-543.391] (-544.397) (-545.121) * (-543.873) (-548.287) (-542.849) [-546.038] -- 0:00:14
      753000 -- (-542.237) (-542.542) [-544.722] (-543.687) * (-544.399) (-545.301) [-543.767] (-541.783) -- 0:00:14
      753500 -- (-541.576) (-544.585) [-542.717] (-544.153) * [-544.309] (-544.313) (-544.221) (-542.374) -- 0:00:14
      754000 -- (-542.736) [-545.434] (-553.606) (-542.875) * [-546.702] (-542.936) (-550.253) (-542.640) -- 0:00:14
      754500 -- [-542.567] (-543.742) (-545.720) (-544.870) * (-542.825) (-546.092) (-548.989) [-544.634] -- 0:00:14
      755000 -- (-546.986) (-549.306) [-545.022] (-544.107) * (-542.035) (-543.949) [-543.527] (-542.875) -- 0:00:14

      Average standard deviation of split frequencies: 0.008613

      755500 -- [-543.286] (-549.068) (-544.378) (-543.243) * (-541.872) (-543.008) (-543.992) [-543.035] -- 0:00:14
      756000 -- [-542.948] (-543.545) (-545.266) (-544.955) * (-545.139) (-542.699) [-543.262] (-543.053) -- 0:00:14
      756500 -- (-544.398) (-543.248) (-543.718) [-543.763] * (-543.027) (-543.078) [-544.537] (-543.807) -- 0:00:14
      757000 -- (-547.179) [-542.711] (-545.259) (-542.208) * [-542.762] (-543.136) (-547.778) (-546.528) -- 0:00:14
      757500 -- (-543.441) (-543.658) [-543.952] (-546.042) * (-542.917) (-543.313) (-546.631) [-544.055] -- 0:00:14
      758000 -- (-546.930) [-543.996] (-542.872) (-544.117) * [-542.345] (-546.309) (-545.867) (-544.250) -- 0:00:14
      758500 -- [-544.991] (-545.315) (-542.488) (-548.549) * (-543.455) (-544.991) [-541.815] (-544.064) -- 0:00:14
      759000 -- (-542.593) (-543.451) [-543.978] (-545.118) * [-545.122] (-542.649) (-543.211) (-541.948) -- 0:00:14
      759500 -- (-543.951) [-543.201] (-544.807) (-542.206) * (-543.865) [-542.486] (-545.112) (-543.448) -- 0:00:14
      760000 -- (-544.450) (-544.193) (-543.633) [-542.048] * (-545.934) [-542.503] (-544.386) (-545.599) -- 0:00:14

      Average standard deviation of split frequencies: 0.008831

      760500 -- (-542.232) [-543.670] (-548.670) (-546.549) * (-544.600) (-544.820) [-542.536] (-547.278) -- 0:00:14
      761000 -- (-541.932) (-547.077) (-545.133) [-542.764] * (-549.019) (-542.938) [-544.245] (-543.775) -- 0:00:14
      761500 -- [-544.756] (-544.222) (-547.395) (-543.185) * (-547.127) (-544.853) (-542.843) [-541.777] -- 0:00:14
      762000 -- (-545.872) (-543.893) (-547.348) [-543.933] * (-543.829) (-545.132) (-541.537) [-543.286] -- 0:00:14
      762500 -- [-547.784] (-543.346) (-544.783) (-542.423) * (-543.122) [-544.406] (-542.718) (-543.550) -- 0:00:14
      763000 -- (-544.446) (-542.799) [-543.903] (-542.758) * (-543.715) (-543.839) [-548.444] (-541.970) -- 0:00:14
      763500 -- (-542.750) (-544.201) [-544.813] (-542.222) * (-548.419) (-545.950) (-542.016) [-543.925] -- 0:00:14
      764000 -- [-543.068] (-545.660) (-542.577) (-544.152) * [-544.490] (-544.753) (-546.229) (-549.114) -- 0:00:14
      764500 -- [-544.011] (-545.500) (-544.921) (-546.364) * (-544.040) (-550.718) (-545.983) [-543.845] -- 0:00:14
      765000 -- (-546.732) (-544.894) (-542.459) [-549.362] * (-545.965) [-544.651] (-544.055) (-544.352) -- 0:00:14

      Average standard deviation of split frequencies: 0.008808

      765500 -- [-543.345] (-543.115) (-547.514) (-542.614) * [-544.989] (-544.514) (-543.758) (-544.529) -- 0:00:14
      766000 -- (-543.440) (-546.550) (-545.323) [-544.535] * [-543.024] (-545.197) (-550.613) (-545.475) -- 0:00:14
      766500 -- (-543.632) [-547.558] (-543.904) (-544.476) * [-541.983] (-544.588) (-546.501) (-545.050) -- 0:00:14
      767000 -- (-543.410) (-542.528) [-543.399] (-543.873) * (-542.768) [-542.789] (-545.044) (-542.625) -- 0:00:13
      767500 -- (-542.863) (-544.606) (-545.800) [-542.046] * (-542.387) (-541.611) [-544.592] (-545.363) -- 0:00:13
      768000 -- (-543