--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:55:32 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1572/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -543.22 -545.99
2 -543.20 -546.98
--------------------------------------
TOTAL -543.21 -546.60
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896963 0.087761 0.358108 1.471668 0.863861 1345.51 1363.50 1.000
r(A<->C){all} 0.167083 0.021533 0.000353 0.462665 0.121481 110.92 204.03 1.000
r(A<->G){all} 0.174322 0.021422 0.000052 0.469065 0.137050 190.76 194.14 1.000
r(A<->T){all} 0.162769 0.019544 0.000051 0.453096 0.127326 149.69 218.47 1.001
r(C<->G){all} 0.170991 0.020093 0.000053 0.444861 0.135778 203.54 244.97 1.003
r(C<->T){all} 0.170012 0.022341 0.000021 0.474244 0.125078 168.91 171.48 1.000
r(G<->T){all} 0.154823 0.017442 0.000019 0.415572 0.116871 256.92 300.97 1.000
pi(A){all} 0.224926 0.000429 0.187594 0.267284 0.224310 1245.93 1306.93 1.000
pi(C){all} 0.315179 0.000522 0.271237 0.359032 0.314578 1199.67 1227.87 1.001
pi(G){all} 0.272052 0.000483 0.231833 0.317176 0.271489 1151.53 1228.64 1.000
pi(T){all} 0.187843 0.000384 0.148385 0.224088 0.187255 1081.46 1265.36 1.000
alpha{1,2} 0.431379 0.249288 0.000254 1.430248 0.251010 1122.33 1205.99 1.000
alpha{3} 0.465726 0.254131 0.000103 1.482369 0.284824 1081.51 1184.30 1.000
pinvar{all} 0.995979 0.000022 0.987186 0.999996 0.997451 1258.10 1287.55 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -528.204162
Model 2: PositiveSelection -528.204119
Model 0: one-ratio -528.204119
Model 7: beta -528.204216
Model 8: beta&w>1 -528.204118
Model 0 vs 1 8.600000001024455E-5
Model 2 vs 1 8.600000001024455E-5
Model 8 vs 7 1.9599999995989492E-4
>C1
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C2
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C3
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C4
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C5
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C6
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=132
C1 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C2 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C3 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C4 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C5 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C6 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
**************************************************
C1 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C2 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C3 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C4 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C5 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C6 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
**************************************************
C1 NADPTSARRNTGGRRRAANALPTHSTPAPQST
C2 NADPTSARRNTGGRRRAANALPTHSTPAPQST
C3 NADPTSARRNTGGRRRAANALPTHSTPAPQST
C4 NADPTSARRNTGGRRRAANALPTHSTPAPQST
C5 NADPTSARRNTGGRRRAANALPTHSTPAPQST
C6 NADPTSARRNTGGRRRAANALPTHSTPAPQST
********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3960]--->[3960]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.462 Mb, Max= 30.662 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C2 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C3 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C4 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C5 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
C6 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
**************************************************
C1 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C2 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C3 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C4 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C5 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
C6 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
**************************************************
C1 NADPTSARRNTGGRRRAANALPTHSTPAPQST
C2 NADPTSARRNTGGRRRAANALPTHSTPAPQST
C3 NADPTSARRNTGGRRRAANALPTHSTPAPQST
C4 NADPTSARRNTGGRRRAANALPTHSTPAPQST
C5 NADPTSARRNTGGRRRAANALPTHSTPAPQST
C6 NADPTSARRNTGGRRRAANALPTHSTPAPQST
********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
C2 TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
C3 TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
C4 TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
C5 TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
C6 TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
**************************************************
C1 CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
C2 CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
C3 CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
C4 CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
C5 CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
C6 CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
**************************************************
C1 CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
C2 CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
C3 CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
C4 CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
C5 CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
C6 CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
**************************************************
C1 GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
C2 GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
C3 GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
C4 GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
C5 GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
C6 GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
**************************************************
C1 GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
C2 GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
C3 GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
C4 GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
C5 GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
C6 GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
**************************************************
C1 CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
C2 CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
C3 CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
C4 CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
C5 CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
C6 CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
**************************************************
C1 AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
C2 AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
C3 AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
C4 AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
C5 AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
C6 AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
**************************************************
C1 CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
C2 CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
C3 CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
C4 CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
C5 CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
C6 CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
**********************************************
>C1
TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
>C2
TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
>C3
TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
>C4
TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
>C5
TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
>C6
TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC
CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT
CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC
GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT
GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA
CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC
AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC
CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
>C1
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C2
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C3
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C4
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C5
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
>C6
LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NADPTSARRNTGGRRRAANALPTHSTPAPQST
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 396 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856052
Setting output file names to "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 423947795
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5616366484
Seed = 1332197143
Swapseed = 1579856052
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -886.266987 -- -24.965149
Chain 2 -- -886.266987 -- -24.965149
Chain 3 -- -886.266852 -- -24.965149
Chain 4 -- -886.266937 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -886.266852 -- -24.965149
Chain 2 -- -886.266852 -- -24.965149
Chain 3 -- -886.266987 -- -24.965149
Chain 4 -- -886.266987 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-886.267] (-886.267) (-886.267) (-886.267) * [-886.267] (-886.267) (-886.267) (-886.267)
500 -- (-553.728) (-554.794) (-552.137) [-554.952] * (-546.748) [-556.496] (-552.577) (-567.356) -- 0:00:00
1000 -- [-553.268] (-550.247) (-552.539) (-548.958) * (-555.197) [-549.910] (-561.170) (-552.709) -- 0:00:00
1500 -- (-553.315) (-551.177) [-554.125] (-547.921) * (-553.001) (-554.198) [-550.634] (-549.911) -- 0:00:00
2000 -- (-552.000) (-554.071) (-548.896) [-552.181] * (-557.108) (-551.677) (-552.589) [-561.978] -- 0:00:00
2500 -- (-557.230) (-556.576) [-550.150] (-559.803) * (-551.730) [-548.258] (-549.985) (-558.008) -- 0:00:00
3000 -- (-551.866) [-550.033] (-554.207) (-555.975) * [-552.994] (-551.356) (-550.897) (-554.172) -- 0:00:00
3500 -- (-562.978) (-552.230) (-547.169) [-550.222] * (-560.165) [-550.355] (-557.271) (-555.771) -- 0:00:00
4000 -- (-552.774) [-548.135] (-560.164) (-553.227) * (-553.487) (-556.482) (-553.162) [-551.949] -- 0:00:00
4500 -- [-547.860] (-549.450) (-551.051) (-553.532) * (-549.359) (-551.555) (-552.809) [-553.224] -- 0:00:00
5000 -- (-550.507) (-556.720) (-550.433) [-550.411] * [-551.790] (-549.186) (-551.670) (-553.328) -- 0:00:00
Average standard deviation of split frequencies: 0.081983
5500 -- (-551.296) [-552.327] (-556.155) (-549.773) * (-553.272) [-552.384] (-553.269) (-553.089) -- 0:03:00
6000 -- (-555.867) [-550.860] (-557.690) (-552.738) * (-551.765) (-553.938) (-546.867) [-549.679] -- 0:02:45
6500 -- (-551.885) [-554.079] (-548.057) (-555.323) * [-550.126] (-552.229) (-556.553) (-554.473) -- 0:02:32
7000 -- [-556.418] (-555.768) (-550.823) (-551.105) * (-548.676) (-551.633) [-551.391] (-552.613) -- 0:02:21
7500 -- [-545.537] (-549.255) (-554.654) (-557.876) * (-556.546) (-559.972) [-548.948] (-555.203) -- 0:02:12
8000 -- (-551.377) (-554.326) [-552.133] (-553.192) * (-555.117) (-558.768) [-553.206] (-550.421) -- 0:02:04
8500 -- [-551.868] (-555.193) (-555.645) (-559.023) * (-550.766) (-551.121) [-548.990] (-555.883) -- 0:01:56
9000 -- (-552.381) [-550.417] (-556.960) (-555.541) * (-560.287) [-556.465] (-549.433) (-554.218) -- 0:01:50
9500 -- (-551.955) [-549.747] (-552.233) (-543.367) * [-548.892] (-551.923) (-557.941) (-549.298) -- 0:01:44
10000 -- [-549.361] (-552.109) (-563.072) (-542.958) * [-550.386] (-545.107) (-552.204) (-549.152) -- 0:01:39
Average standard deviation of split frequencies: 0.048403
10500 -- (-549.668) (-559.116) [-553.726] (-545.559) * (-555.286) (-545.251) (-554.736) [-548.198] -- 0:01:34
11000 -- [-548.885] (-557.254) (-551.462) (-542.021) * (-557.830) (-543.026) (-551.184) [-550.390] -- 0:01:29
11500 -- [-553.607] (-552.808) (-558.146) (-543.955) * (-554.263) (-542.340) [-548.278] (-552.490) -- 0:01:25
12000 -- [-548.925] (-561.524) (-558.693) (-545.873) * (-554.227) (-545.150) [-548.834] (-554.303) -- 0:01:22
12500 -- (-552.977) (-549.496) [-558.487] (-542.711) * [-554.691] (-543.765) (-552.056) (-548.414) -- 0:01:19
13000 -- [-547.676] (-554.419) (-556.554) (-550.106) * [-548.370] (-545.653) (-547.906) (-555.863) -- 0:01:15
13500 -- (-559.715) [-549.966] (-558.653) (-551.054) * [-550.154] (-542.578) (-560.483) (-553.155) -- 0:01:13
14000 -- (-551.659) [-551.399] (-555.361) (-545.288) * (-557.887) (-545.991) (-547.764) [-557.894] -- 0:01:10
14500 -- (-553.710) [-551.500] (-553.889) (-548.051) * (-552.540) (-545.386) (-544.144) [-559.464] -- 0:01:07
15000 -- (-549.926) (-555.897) [-556.541] (-544.377) * (-551.325) [-545.789] (-544.919) (-557.030) -- 0:01:05
Average standard deviation of split frequencies: 0.055979
15500 -- (-558.354) (-552.815) (-551.984) [-542.978] * (-554.625) (-542.111) [-544.915] (-557.609) -- 0:01:03
16000 -- (-555.569) [-552.723] (-563.606) (-544.021) * (-548.229) [-544.437] (-544.632) (-549.879) -- 0:01:01
16500 -- (-558.435) (-556.215) [-550.221] (-545.602) * (-552.513) (-544.734) [-544.208] (-552.193) -- 0:00:59
17000 -- (-550.362) [-552.434] (-553.034) (-542.227) * [-551.377] (-543.209) (-546.930) (-558.056) -- 0:00:57
17500 -- (-554.284) (-550.212) [-546.512] (-542.911) * (-555.182) (-543.814) [-543.476] (-547.997) -- 0:00:56
18000 -- (-554.097) (-556.662) [-550.007] (-542.734) * (-560.080) [-544.965] (-543.291) (-558.170) -- 0:00:54
18500 -- [-551.815] (-557.516) (-547.506) (-549.172) * (-553.064) (-542.513) [-543.151] (-554.787) -- 0:00:53
19000 -- [-547.998] (-557.475) (-554.308) (-542.330) * (-553.126) [-543.087] (-544.869) (-555.175) -- 0:00:51
19500 -- (-558.392) (-556.805) (-550.793) [-545.281] * (-554.686) (-542.487) (-545.227) [-554.679] -- 0:00:50
20000 -- (-550.354) [-553.839] (-551.009) (-544.345) * (-552.792) [-542.667] (-543.000) (-546.854) -- 0:00:49
Average standard deviation of split frequencies: 0.058826
20500 -- (-552.015) (-553.284) [-555.599] (-543.741) * (-554.323) [-545.774] (-543.335) (-552.841) -- 0:00:47
21000 -- (-555.897) (-551.042) [-550.182] (-542.591) * (-549.032) [-543.893] (-544.826) (-551.255) -- 0:00:46
21500 -- (-555.289) (-546.394) (-554.916) [-542.082] * (-547.758) (-544.160) [-545.078] (-551.019) -- 0:00:45
22000 -- (-552.078) (-547.679) [-552.878] (-544.549) * (-553.218) (-543.588) (-543.986) [-549.871] -- 0:01:28
22500 -- (-550.972) (-546.574) [-557.996] (-543.768) * (-552.252) (-545.137) (-543.386) [-555.907] -- 0:01:26
23000 -- (-555.243) (-551.240) (-550.671) [-543.146] * [-549.439] (-544.282) (-545.068) (-558.410) -- 0:01:24
23500 -- (-550.564) (-542.106) [-551.436] (-543.304) * (-552.416) (-543.731) [-544.552] (-552.490) -- 0:01:23
24000 -- [-557.160] (-543.757) (-549.097) (-544.388) * (-554.364) [-542.831] (-543.987) (-549.641) -- 0:01:21
24500 -- (-563.314) (-542.280) (-552.495) [-545.635] * (-562.318) (-543.554) (-543.645) [-555.351] -- 0:01:19
25000 -- [-545.647] (-544.202) (-557.369) (-544.366) * (-555.341) (-546.044) [-544.218] (-558.602) -- 0:01:18
Average standard deviation of split frequencies: 0.044503
25500 -- (-542.600) (-547.488) (-552.014) [-544.692] * (-561.171) [-543.326] (-542.092) (-561.975) -- 0:01:16
26000 -- (-542.850) (-555.632) (-550.719) [-544.030] * (-554.724) [-545.368] (-547.455) (-549.287) -- 0:01:14
26500 -- (-545.824) (-553.799) [-553.466] (-543.387) * (-545.012) (-545.942) [-543.254] (-562.709) -- 0:01:13
27000 -- (-550.352) (-543.986) (-553.415) [-543.089] * (-544.181) [-546.330] (-547.638) (-561.649) -- 0:01:12
27500 -- [-544.568] (-543.370) (-549.336) (-544.398) * (-542.399) (-547.609) (-545.719) [-557.335] -- 0:01:10
28000 -- (-542.956) (-542.519) [-552.876] (-545.631) * (-542.555) [-544.619] (-545.288) (-550.753) -- 0:01:09
28500 -- (-544.400) [-541.848] (-554.971) (-543.877) * (-542.119) (-542.853) [-546.557] (-554.829) -- 0:01:08
29000 -- (-543.916) (-543.730) [-551.768] (-542.649) * [-544.347] (-543.981) (-546.524) (-559.137) -- 0:01:06
29500 -- (-542.914) [-542.930] (-553.488) (-542.760) * (-543.673) (-544.550) [-546.307] (-560.078) -- 0:01:05
30000 -- (-544.478) [-545.393] (-548.387) (-542.734) * [-542.398] (-543.628) (-542.749) (-559.942) -- 0:01:04
Average standard deviation of split frequencies: 0.030744
30500 -- (-544.611) (-545.504) [-558.019] (-542.498) * (-544.000) (-543.138) [-542.369] (-549.753) -- 0:01:03
31000 -- [-542.670] (-543.542) (-553.951) (-542.367) * [-541.809] (-542.648) (-542.698) (-557.855) -- 0:01:02
31500 -- (-547.814) (-544.243) [-550.533] (-544.698) * (-541.868) [-545.594] (-545.059) (-554.196) -- 0:01:01
32000 -- (-545.639) [-547.046] (-550.643) (-543.205) * (-541.699) (-545.257) [-548.646] (-554.821) -- 0:01:00
32500 -- [-543.803] (-545.433) (-550.411) (-544.819) * (-544.003) (-544.398) [-542.616] (-557.680) -- 0:00:59
33000 -- (-544.267) [-544.801] (-549.223) (-543.637) * (-543.186) (-543.991) [-542.711] (-553.589) -- 0:00:58
33500 -- (-546.412) (-544.894) (-554.386) [-545.113] * [-542.904] (-543.187) (-543.231) (-554.996) -- 0:00:57
34000 -- (-546.577) (-546.833) (-548.665) [-543.518] * (-542.536) (-542.002) (-542.469) [-553.174] -- 0:00:56
34500 -- (-546.664) (-547.323) [-551.887] (-542.730) * [-542.373] (-543.475) (-542.136) (-553.029) -- 0:00:55
35000 -- [-546.843] (-543.735) (-555.901) (-544.603) * (-547.309) (-545.706) (-542.613) [-547.521] -- 0:00:55
Average standard deviation of split frequencies: 0.037216
35500 -- (-542.977) (-542.828) (-552.112) [-542.443] * (-547.817) [-549.372] (-543.215) (-559.148) -- 0:00:54
36000 -- (-543.287) [-543.215] (-560.559) (-545.681) * (-547.172) [-544.553] (-541.991) (-563.065) -- 0:00:53
36500 -- (-546.327) (-542.653) [-553.803] (-542.068) * [-543.689] (-545.028) (-543.822) (-552.260) -- 0:00:52
37000 -- (-543.733) (-542.681) [-554.764] (-547.392) * (-541.916) [-543.827] (-544.663) (-559.930) -- 0:00:52
37500 -- (-541.984) (-545.204) (-559.675) [-544.266] * (-542.742) (-543.016) [-543.227] (-564.010) -- 0:00:51
38000 -- [-544.369] (-543.509) (-563.360) (-544.833) * [-542.103] (-543.036) (-543.515) (-553.229) -- 0:00:50
38500 -- (-545.312) [-541.987] (-566.214) (-545.883) * (-544.298) [-544.156] (-543.686) (-554.391) -- 0:00:49
39000 -- [-544.240] (-543.708) (-551.306) (-548.202) * (-546.638) (-543.296) [-542.568] (-558.833) -- 0:01:13
39500 -- [-544.392] (-543.225) (-548.734) (-546.259) * [-541.827] (-545.552) (-544.632) (-542.216) -- 0:01:12
40000 -- (-543.333) [-542.733] (-549.148) (-544.851) * (-543.443) (-546.444) (-546.816) [-543.143] -- 0:01:12
Average standard deviation of split frequencies: 0.034094
40500 -- (-544.581) (-543.529) [-546.966] (-544.101) * (-545.861) [-546.321] (-546.362) (-544.840) -- 0:01:11
41000 -- (-544.501) [-543.351] (-543.614) (-542.645) * (-544.404) [-542.852] (-544.557) (-542.691) -- 0:01:10
41500 -- (-544.641) (-544.580) (-544.092) [-542.354] * (-545.372) [-543.560] (-543.038) (-544.182) -- 0:01:09
42000 -- (-546.322) (-546.402) [-544.903] (-543.105) * (-546.860) (-543.187) (-542.854) [-542.561] -- 0:01:08
42500 -- (-542.744) (-545.062) (-547.776) [-545.834] * [-543.957] (-544.427) (-543.083) (-543.736) -- 0:01:07
43000 -- (-544.154) (-543.621) (-546.633) [-542.373] * (-542.750) (-544.276) (-542.624) [-545.635] -- 0:01:06
43500 -- (-546.364) (-544.347) (-543.548) [-545.804] * (-542.589) (-545.502) (-542.858) [-543.549] -- 0:01:05
44000 -- (-544.826) [-544.533] (-543.871) (-545.706) * (-543.839) (-546.800) (-542.054) [-542.091] -- 0:01:05
44500 -- [-543.771] (-545.420) (-545.938) (-544.511) * [-543.561] (-542.197) (-541.648) (-543.759) -- 0:01:04
45000 -- (-542.390) (-543.555) (-546.011) [-545.787] * (-542.339) (-544.097) [-543.562] (-542.342) -- 0:01:03
Average standard deviation of split frequencies: 0.031283
45500 -- (-544.569) [-543.444] (-545.335) (-545.680) * [-541.958] (-547.501) (-547.215) (-544.258) -- 0:01:02
46000 -- [-542.699] (-546.858) (-547.160) (-543.475) * (-544.584) (-543.426) [-544.360] (-546.776) -- 0:01:02
46500 -- [-542.995] (-553.138) (-545.242) (-546.760) * [-548.268] (-543.799) (-544.262) (-543.633) -- 0:01:01
47000 -- (-542.917) (-546.953) [-542.452] (-544.221) * (-543.291) (-542.195) (-543.034) [-544.518] -- 0:01:00
47500 -- (-542.295) (-544.338) [-542.896] (-542.077) * (-543.482) (-545.224) [-543.313] (-543.970) -- 0:01:00
48000 -- [-543.378] (-545.239) (-543.026) (-542.663) * (-544.815) (-544.615) (-545.003) [-544.441] -- 0:00:59
48500 -- (-545.212) [-544.056] (-543.115) (-544.642) * (-544.871) (-543.774) (-544.935) [-542.990] -- 0:00:58
49000 -- [-543.030] (-544.558) (-543.186) (-543.219) * (-544.328) [-546.713] (-544.566) (-544.229) -- 0:00:58
49500 -- [-542.471] (-544.470) (-546.236) (-544.919) * (-543.088) (-547.629) (-543.421) [-543.736] -- 0:00:57
50000 -- (-542.656) (-543.475) [-544.691] (-542.174) * (-542.422) (-551.978) [-542.868] (-542.518) -- 0:00:57
Average standard deviation of split frequencies: 0.030497
50500 -- (-547.035) (-544.795) (-544.989) [-542.629] * (-542.591) (-547.349) (-545.106) [-544.368] -- 0:00:56
51000 -- (-542.686) (-543.290) (-545.070) [-544.183] * (-542.509) (-550.134) (-545.731) [-542.037] -- 0:00:55
51500 -- (-544.347) (-543.151) [-544.014] (-544.760) * (-544.232) (-543.423) (-543.408) [-542.953] -- 0:00:55
52000 -- (-548.411) (-542.206) (-547.890) [-544.483] * (-543.136) [-544.321] (-546.120) (-542.835) -- 0:00:54
52500 -- (-544.989) (-544.721) (-543.162) [-545.140] * (-543.177) [-544.002] (-548.161) (-544.530) -- 0:00:54
53000 -- (-545.395) (-542.713) [-545.830] (-546.096) * (-542.195) [-544.034] (-542.893) (-545.092) -- 0:00:53
53500 -- [-541.670] (-543.282) (-545.067) (-542.835) * (-542.391) [-542.259] (-544.698) (-545.427) -- 0:00:53
54000 -- (-542.078) (-544.038) [-544.518] (-547.632) * [-541.769] (-544.759) (-548.502) (-544.885) -- 0:00:52
54500 -- [-543.103] (-542.975) (-543.280) (-543.146) * (-542.628) [-542.747] (-544.550) (-542.654) -- 0:00:52
55000 -- (-542.807) (-545.343) [-541.862] (-544.403) * (-546.157) [-544.526] (-541.582) (-541.917) -- 0:00:51
Average standard deviation of split frequencies: 0.029684
55500 -- (-543.768) (-542.550) [-541.899] (-543.150) * (-544.272) (-545.174) (-543.908) [-543.560] -- 0:00:51
56000 -- (-544.361) [-542.382] (-544.400) (-543.246) * (-542.893) (-545.318) (-544.564) [-542.759] -- 0:01:07
56500 -- (-544.544) [-546.973] (-544.620) (-543.307) * (-547.556) [-544.463] (-543.564) (-544.693) -- 0:01:06
57000 -- [-543.707] (-544.755) (-541.925) (-548.895) * (-550.011) [-545.022] (-542.279) (-543.350) -- 0:01:06
57500 -- (-547.126) [-544.824] (-543.274) (-552.049) * [-545.853] (-545.273) (-543.243) (-544.645) -- 0:01:05
58000 -- [-544.283] (-544.802) (-543.824) (-542.952) * [-544.185] (-544.503) (-545.914) (-542.621) -- 0:01:04
58500 -- [-542.748] (-543.595) (-548.310) (-547.107) * (-543.285) [-542.408] (-548.720) (-545.411) -- 0:01:04
59000 -- (-544.566) (-543.619) [-542.454] (-545.570) * (-543.560) [-542.093] (-541.621) (-548.760) -- 0:01:03
59500 -- [-544.729] (-543.820) (-547.013) (-543.666) * (-542.344) (-541.621) (-544.040) [-545.314] -- 0:01:03
60000 -- [-544.139] (-545.162) (-545.524) (-543.049) * (-542.733) [-544.302] (-544.697) (-544.209) -- 0:01:02
Average standard deviation of split frequencies: 0.025038
60500 -- [-543.145] (-544.043) (-543.382) (-543.277) * (-541.729) [-545.616] (-543.762) (-542.247) -- 0:01:02
61000 -- [-544.400] (-544.045) (-547.774) (-543.552) * (-543.658) (-543.101) (-543.287) [-543.426] -- 0:01:01
61500 -- [-543.424] (-546.850) (-544.972) (-543.873) * (-545.331) [-542.571] (-541.660) (-544.340) -- 0:01:01
62000 -- (-542.645) (-544.652) [-544.260] (-544.204) * (-546.040) (-544.024) [-541.621] (-542.752) -- 0:01:00
62500 -- (-546.992) (-546.176) (-544.202) [-542.872] * (-543.280) [-543.566] (-546.341) (-544.625) -- 0:01:00
63000 -- (-547.015) (-545.915) [-543.116] (-543.706) * [-543.015] (-543.351) (-545.799) (-543.510) -- 0:00:59
63500 -- (-544.823) (-543.707) (-544.645) [-543.035] * (-547.387) [-545.277] (-545.348) (-545.898) -- 0:00:58
64000 -- (-544.000) (-543.435) [-546.354] (-542.569) * (-545.271) (-543.174) [-544.835] (-545.264) -- 0:00:58
64500 -- (-547.976) [-547.715] (-547.805) (-543.419) * [-547.900] (-545.829) (-553.290) (-543.576) -- 0:00:58
65000 -- (-545.614) (-548.669) (-545.750) [-545.356] * (-543.927) (-544.677) [-542.809] (-545.151) -- 0:00:57
Average standard deviation of split frequencies: 0.022179
65500 -- (-545.656) (-549.890) [-543.420] (-544.952) * [-543.320] (-545.331) (-543.399) (-547.045) -- 0:00:57
66000 -- (-548.132) (-544.585) [-543.570] (-548.376) * [-542.976] (-547.610) (-545.843) (-545.429) -- 0:00:56
66500 -- (-546.879) [-542.894] (-546.154) (-546.661) * (-547.196) [-545.876] (-545.381) (-548.005) -- 0:00:56
67000 -- (-549.913) (-542.609) (-542.686) [-545.930] * (-544.433) (-542.729) [-546.810] (-545.835) -- 0:00:55
67500 -- (-543.227) (-541.946) [-542.144] (-542.580) * (-543.318) [-544.195] (-542.580) (-544.223) -- 0:00:55
68000 -- [-542.570] (-545.496) (-542.753) (-545.336) * (-542.999) [-544.375] (-544.047) (-546.482) -- 0:00:54
68500 -- [-544.189] (-542.233) (-543.916) (-546.583) * (-544.630) [-545.297] (-544.267) (-547.091) -- 0:00:54
69000 -- [-545.047] (-543.055) (-544.735) (-547.655) * [-543.405] (-544.409) (-543.652) (-542.846) -- 0:00:53
69500 -- (-545.025) (-542.833) [-545.514] (-543.590) * (-544.452) [-545.515] (-546.805) (-546.065) -- 0:00:53
70000 -- [-545.779] (-542.575) (-547.029) (-543.906) * (-547.940) (-542.723) (-543.508) [-547.131] -- 0:00:53
Average standard deviation of split frequencies: 0.019059
70500 -- (-543.805) (-545.027) [-543.924] (-547.704) * (-546.020) [-544.532] (-545.953) (-547.021) -- 0:00:52
71000 -- (-543.648) (-543.119) (-543.934) [-543.490] * (-547.977) (-545.625) (-547.429) [-544.379] -- 0:00:52
71500 -- (-543.165) (-542.491) [-543.721] (-545.457) * (-543.207) (-544.087) (-545.790) [-545.928] -- 0:00:51
72000 -- (-543.779) (-543.575) [-544.459] (-544.101) * (-541.854) (-547.157) [-543.598] (-543.099) -- 0:00:51
72500 -- (-544.607) (-546.168) [-542.194] (-544.499) * [-545.359] (-543.298) (-543.972) (-546.161) -- 0:00:51
73000 -- (-544.995) (-544.350) (-542.870) [-544.655] * (-541.952) (-543.592) [-542.882] (-545.547) -- 0:01:03
73500 -- [-542.316] (-545.544) (-544.630) (-545.504) * (-542.130) [-543.464] (-545.981) (-545.942) -- 0:01:03
74000 -- (-541.888) (-543.622) [-543.063] (-546.655) * (-544.233) (-542.860) [-544.413] (-544.299) -- 0:01:02
74500 -- (-544.324) [-541.843] (-544.554) (-543.394) * (-548.879) (-547.308) (-543.075) [-544.563] -- 0:01:02
75000 -- (-542.504) (-542.004) (-542.934) [-542.652] * (-542.489) (-545.726) [-543.505] (-543.104) -- 0:01:01
Average standard deviation of split frequencies: 0.023505
75500 -- (-541.656) (-542.457) (-542.664) [-543.231] * (-546.629) [-545.905] (-546.544) (-547.035) -- 0:01:01
76000 -- (-548.255) (-544.731) (-543.484) [-545.381] * (-542.800) (-544.091) [-543.210] (-543.263) -- 0:01:00
76500 -- (-543.554) (-541.833) [-542.892] (-544.790) * (-543.037) [-545.947] (-546.027) (-543.543) -- 0:01:00
77000 -- (-541.616) (-542.731) (-543.068) [-542.801] * (-541.723) (-545.901) (-545.761) [-544.704] -- 0:00:59
77500 -- [-542.082] (-544.254) (-545.347) (-544.250) * [-545.097] (-545.593) (-547.137) (-543.783) -- 0:00:59
78000 -- (-545.447) (-543.723) [-542.128] (-547.817) * (-543.781) (-546.219) (-544.104) [-543.512] -- 0:00:59
78500 -- (-546.355) (-546.675) (-546.321) [-544.363] * (-542.376) [-542.294] (-548.130) (-542.946) -- 0:00:58
79000 -- (-544.633) [-545.312] (-547.976) (-545.464) * (-543.821) [-544.993] (-544.822) (-542.168) -- 0:00:58
79500 -- (-545.564) (-545.837) (-547.064) [-543.988] * (-545.504) (-542.926) (-544.387) [-543.502] -- 0:00:57
80000 -- (-543.832) (-542.787) [-544.308] (-543.937) * (-545.905) [-549.961] (-543.801) (-544.844) -- 0:00:57
Average standard deviation of split frequencies: 0.025973
80500 -- (-543.397) (-542.912) [-544.747] (-542.562) * (-544.707) (-541.867) (-543.301) [-543.150] -- 0:00:57
81000 -- (-546.141) (-546.960) (-545.490) [-543.110] * (-544.820) (-543.176) [-542.488] (-542.480) -- 0:00:56
81500 -- [-550.876] (-545.942) (-543.556) (-542.049) * (-544.916) (-543.087) (-542.480) [-542.344] -- 0:00:56
82000 -- (-554.889) (-544.779) (-543.189) [-545.366] * (-545.341) [-545.347] (-545.484) (-542.967) -- 0:00:55
82500 -- (-546.457) (-546.207) (-543.670) [-542.387] * [-544.552] (-546.649) (-544.843) (-542.745) -- 0:00:55
83000 -- (-547.774) [-542.288] (-542.968) (-542.443) * (-544.388) (-545.938) (-544.456) [-545.585] -- 0:00:55
83500 -- [-543.018] (-542.267) (-544.423) (-548.834) * (-543.973) (-544.818) (-543.665) [-543.983] -- 0:00:54
84000 -- (-544.803) (-544.106) [-542.234] (-549.021) * [-543.554] (-548.748) (-542.912) (-543.127) -- 0:00:54
84500 -- (-547.013) (-545.099) [-542.537] (-545.378) * (-543.717) (-545.338) (-544.847) [-543.983] -- 0:00:54
85000 -- [-545.317] (-543.198) (-544.010) (-544.842) * (-543.966) (-543.529) [-542.286] (-547.497) -- 0:00:53
Average standard deviation of split frequencies: 0.021926
85500 -- (-546.296) [-544.651] (-543.962) (-543.585) * (-543.882) (-545.462) [-543.459] (-544.905) -- 0:00:53
86000 -- (-543.546) (-545.299) [-543.954] (-545.250) * (-542.767) [-543.184] (-546.169) (-545.551) -- 0:00:53
86500 -- (-546.670) [-543.752] (-548.355) (-544.413) * (-543.621) (-544.636) (-544.861) [-545.165] -- 0:00:52
87000 -- (-544.312) (-545.615) (-543.246) [-544.157] * (-544.070) (-543.508) [-542.182] (-543.172) -- 0:00:52
87500 -- (-543.265) (-544.207) [-543.074] (-542.840) * (-542.727) (-545.159) [-542.253] (-548.020) -- 0:00:52
88000 -- [-544.894] (-543.738) (-544.873) (-547.114) * (-543.995) (-543.844) [-542.258] (-544.915) -- 0:00:51
88500 -- (-544.199) (-542.307) [-542.210] (-544.372) * (-542.249) (-543.077) (-543.030) [-543.487] -- 0:00:51
89000 -- (-544.224) (-542.153) [-544.841] (-543.290) * (-543.471) (-543.576) (-545.768) [-544.063] -- 0:00:51
89500 -- (-542.230) (-543.704) (-545.835) [-544.136] * (-542.018) (-543.978) [-548.392] (-544.553) -- 0:00:50
90000 -- (-543.782) (-543.274) (-544.193) [-542.749] * (-543.895) [-542.440] (-545.241) (-543.184) -- 0:01:00
Average standard deviation of split frequencies: 0.023917
90500 -- [-543.731] (-543.327) (-542.616) (-543.529) * [-546.265] (-546.319) (-543.121) (-543.643) -- 0:01:00
91000 -- [-543.023] (-541.707) (-543.507) (-542.731) * (-547.048) (-542.653) [-542.704] (-542.105) -- 0:00:59
91500 -- [-543.124] (-543.614) (-545.277) (-542.241) * (-543.046) [-544.425] (-543.285) (-545.430) -- 0:00:59
92000 -- (-543.290) (-546.810) (-545.401) [-544.235] * (-542.529) (-546.310) (-541.978) [-545.188] -- 0:00:59
92500 -- [-543.807] (-543.038) (-544.252) (-545.724) * (-544.222) [-542.397] (-542.289) (-547.149) -- 0:00:58
93000 -- (-543.996) (-543.351) (-542.585) [-545.292] * (-542.198) [-543.182] (-542.384) (-543.920) -- 0:00:58
93500 -- (-542.393) (-543.444) (-543.732) [-542.164] * (-542.568) [-545.350] (-542.110) (-546.546) -- 0:00:58
94000 -- (-544.625) [-546.949] (-545.378) (-543.961) * (-541.877) (-543.943) [-544.617] (-543.309) -- 0:00:57
94500 -- [-542.056] (-547.372) (-542.547) (-542.891) * (-543.243) (-544.915) (-542.575) [-545.856] -- 0:00:57
95000 -- [-541.654] (-543.937) (-542.769) (-545.800) * (-542.617) (-547.589) [-543.811] (-542.279) -- 0:00:57
Average standard deviation of split frequencies: 0.024294
95500 -- (-548.390) (-542.872) [-542.721] (-546.790) * (-544.467) (-547.182) [-543.249] (-548.012) -- 0:00:56
96000 -- (-544.406) [-543.556] (-545.702) (-547.707) * (-544.170) (-546.838) [-543.759] (-544.392) -- 0:00:56
96500 -- [-543.789] (-544.427) (-544.702) (-543.813) * (-543.509) (-544.718) [-543.048] (-542.082) -- 0:00:56
97000 -- [-543.438] (-541.824) (-547.956) (-543.895) * (-543.786) (-543.624) (-545.505) [-543.569] -- 0:00:55
97500 -- (-543.682) (-546.230) (-548.235) [-544.323] * (-543.989) (-542.667) (-551.259) [-547.278] -- 0:00:55
98000 -- (-545.579) (-545.355) [-544.728] (-542.395) * [-543.396] (-542.141) (-546.747) (-549.262) -- 0:00:55
98500 -- (-545.837) (-542.300) (-543.017) [-541.493] * (-544.185) [-544.929] (-545.797) (-542.980) -- 0:00:54
99000 -- (-549.646) (-542.555) [-546.744] (-544.448) * [-541.877] (-544.177) (-544.739) (-542.630) -- 0:00:54
99500 -- (-545.837) [-543.163] (-544.541) (-543.072) * (-542.418) (-544.122) [-544.887] (-543.968) -- 0:00:54
100000 -- (-547.364) [-543.202] (-544.718) (-541.808) * (-544.865) (-542.616) [-543.039] (-542.946) -- 0:00:54
Average standard deviation of split frequencies: 0.026372
100500 -- (-546.428) (-543.350) (-546.132) [-543.438] * (-545.175) (-542.916) (-541.784) [-543.925] -- 0:00:53
101000 -- (-545.404) (-545.616) [-544.552] (-541.597) * (-545.807) (-542.552) [-544.031] (-544.406) -- 0:00:53
101500 -- (-543.753) (-544.601) [-542.222] (-541.770) * (-545.190) [-542.639] (-546.252) (-544.823) -- 0:00:53
102000 -- (-545.719) (-542.335) (-541.885) [-542.698] * [-543.113] (-541.977) (-542.198) (-542.703) -- 0:00:52
102500 -- (-542.841) (-544.274) [-542.271] (-545.232) * (-546.660) [-541.943] (-543.417) (-543.643) -- 0:00:52
103000 -- [-544.225] (-542.601) (-542.018) (-541.792) * [-543.450] (-544.381) (-545.756) (-543.502) -- 0:00:52
103500 -- [-542.462] (-545.447) (-542.591) (-542.000) * (-545.235) [-542.003] (-544.422) (-543.673) -- 0:00:51
104000 -- (-542.987) [-544.063] (-542.755) (-542.766) * (-546.955) (-542.978) (-542.853) [-544.102] -- 0:00:51
104500 -- (-543.582) (-547.516) (-545.472) [-542.036] * [-546.611] (-545.127) (-542.100) (-542.463) -- 0:00:51
105000 -- (-543.920) [-542.485] (-543.580) (-542.327) * (-549.443) (-544.685) (-543.053) [-542.412] -- 0:00:51
Average standard deviation of split frequencies: 0.024237
105500 -- [-542.411] (-543.239) (-545.445) (-543.565) * (-550.288) [-545.137] (-545.037) (-542.902) -- 0:00:50
106000 -- (-543.223) (-543.196) (-544.513) [-541.882] * (-546.033) (-543.215) (-545.349) [-542.418] -- 0:00:50
106500 -- [-542.704] (-544.749) (-542.356) (-543.633) * [-542.075] (-542.173) (-543.660) (-544.795) -- 0:00:58
107000 -- (-544.193) (-543.883) [-542.525] (-543.174) * (-542.337) (-542.323) [-542.158] (-542.951) -- 0:00:58
107500 -- (-545.469) (-544.347) (-542.013) [-545.816] * [-542.258] (-545.802) (-547.021) (-549.031) -- 0:00:58
108000 -- [-544.712] (-542.917) (-542.676) (-545.681) * (-542.529) [-548.473] (-542.017) (-548.436) -- 0:00:57
108500 -- (-542.511) [-543.073] (-543.181) (-544.764) * (-545.222) [-543.046] (-543.231) (-546.128) -- 0:00:57
109000 -- (-545.665) (-543.585) [-542.707] (-545.780) * (-541.852) [-541.700] (-542.899) (-542.667) -- 0:00:57
109500 -- (-545.109) [-545.688] (-542.364) (-546.131) * (-544.266) (-543.926) (-543.083) [-541.780] -- 0:00:56
110000 -- (-550.254) (-544.232) (-543.688) [-543.197] * (-545.405) [-543.166] (-542.218) (-543.311) -- 0:00:56
Average standard deviation of split frequencies: 0.021747
110500 -- (-544.044) [-545.403] (-544.200) (-541.728) * (-544.683) (-543.129) (-546.521) [-542.225] -- 0:00:56
111000 -- [-546.848] (-544.998) (-542.543) (-544.704) * [-546.710] (-543.292) (-543.944) (-542.960) -- 0:00:56
111500 -- (-542.363) (-547.410) (-547.935) [-545.742] * [-543.819] (-542.979) (-544.099) (-546.289) -- 0:00:55
112000 -- (-544.126) (-544.584) (-542.604) [-545.213] * (-542.804) (-544.018) (-542.746) [-544.166] -- 0:00:55
112500 -- (-543.881) (-543.373) (-545.184) [-543.935] * (-542.370) [-545.993] (-543.614) (-546.751) -- 0:00:55
113000 -- (-543.469) (-545.847) (-543.448) [-542.823] * [-544.263] (-542.976) (-546.458) (-543.115) -- 0:00:54
113500 -- [-543.306] (-544.599) (-542.068) (-542.958) * (-543.523) (-543.453) (-544.112) [-545.425] -- 0:00:54
114000 -- (-543.288) (-543.554) [-542.473] (-542.432) * [-543.789] (-542.922) (-542.216) (-545.590) -- 0:00:54
114500 -- [-544.078] (-547.013) (-545.660) (-546.366) * [-543.975] (-544.670) (-546.338) (-542.650) -- 0:00:54
115000 -- (-546.060) [-543.537] (-543.567) (-543.188) * (-547.379) (-544.187) (-543.924) [-544.606] -- 0:00:53
Average standard deviation of split frequencies: 0.018897
115500 -- [-543.489] (-542.371) (-542.156) (-544.457) * [-544.796] (-543.353) (-543.275) (-544.509) -- 0:00:53
116000 -- (-545.922) (-542.869) (-542.343) [-544.006] * (-543.978) (-542.687) (-542.854) [-543.172] -- 0:00:53
116500 -- [-544.630] (-545.057) (-542.928) (-544.578) * [-542.889] (-542.148) (-545.278) (-543.467) -- 0:00:53
117000 -- (-544.604) (-544.108) [-544.194] (-542.980) * (-542.089) (-544.244) [-541.628] (-545.202) -- 0:00:52
117500 -- (-551.462) (-546.096) (-548.932) [-544.952] * [-543.718] (-545.458) (-542.076) (-545.688) -- 0:00:52
118000 -- [-542.851] (-545.130) (-545.894) (-545.919) * (-543.896) (-541.930) [-542.217] (-544.058) -- 0:00:52
118500 -- [-544.674] (-546.703) (-549.122) (-543.708) * (-545.556) [-541.645] (-542.588) (-545.711) -- 0:00:52
119000 -- (-544.075) [-548.939] (-551.778) (-544.320) * (-544.597) (-541.948) (-546.223) [-553.501] -- 0:00:51
119500 -- [-542.998] (-548.145) (-549.275) (-544.422) * [-543.234] (-541.545) (-545.435) (-546.115) -- 0:00:51
120000 -- [-544.919] (-542.906) (-546.015) (-544.981) * [-543.114] (-542.532) (-547.380) (-542.787) -- 0:00:51
Average standard deviation of split frequencies: 0.020119
120500 -- (-542.091) [-546.655] (-544.145) (-544.316) * (-545.991) [-544.100] (-545.609) (-542.263) -- 0:00:51
121000 -- [-543.933] (-545.689) (-543.477) (-542.714) * (-543.354) (-548.170) (-542.825) [-542.637] -- 0:00:50
121500 -- (-544.919) [-542.778] (-542.947) (-542.708) * (-542.839) (-544.243) (-543.394) [-542.873] -- 0:00:50
122000 -- [-543.336] (-544.182) (-541.888) (-542.963) * (-543.572) (-546.136) [-544.640] (-543.602) -- 0:00:50
122500 -- (-544.310) (-547.885) [-545.674] (-547.506) * (-542.962) (-545.259) [-547.906] (-543.041) -- 0:00:50
123000 -- [-542.259] (-546.038) (-545.431) (-542.790) * [-543.373] (-544.524) (-545.765) (-543.304) -- 0:00:49
123500 -- (-545.182) (-547.251) (-546.792) [-542.974] * (-545.574) (-542.334) (-546.635) [-543.332] -- 0:00:56
124000 -- (-544.003) [-544.314] (-541.507) (-544.472) * (-545.458) [-544.406] (-542.783) (-543.272) -- 0:00:56
124500 -- (-547.486) [-542.298] (-544.550) (-544.998) * (-548.239) [-543.438] (-542.981) (-543.453) -- 0:00:56
125000 -- (-546.019) (-543.422) (-548.244) [-543.541] * [-542.321] (-543.408) (-542.226) (-544.138) -- 0:00:56
Average standard deviation of split frequencies: 0.022261
125500 -- (-544.654) [-543.500] (-544.454) (-543.249) * [-542.382] (-544.994) (-546.614) (-543.603) -- 0:00:55
126000 -- [-543.883] (-544.441) (-542.672) (-542.799) * (-543.070) (-542.591) [-543.129] (-543.595) -- 0:00:55
126500 -- (-545.510) (-545.932) (-543.685) [-544.206] * [-542.795] (-542.589) (-542.852) (-542.763) -- 0:00:55
127000 -- (-542.472) [-542.782] (-544.886) (-542.485) * [-541.991] (-544.305) (-545.576) (-547.292) -- 0:00:54
127500 -- (-542.105) (-543.050) [-543.970] (-548.758) * [-541.812] (-546.022) (-542.976) (-544.886) -- 0:00:54
128000 -- (-542.733) [-543.795] (-544.854) (-542.802) * [-542.375] (-543.401) (-542.242) (-546.201) -- 0:00:54
128500 -- (-546.256) [-542.663] (-544.874) (-543.309) * (-543.431) (-543.511) [-542.317] (-546.728) -- 0:00:54
129000 -- [-543.821] (-545.018) (-543.732) (-543.099) * [-542.017] (-542.711) (-542.391) (-542.236) -- 0:00:54
129500 -- (-542.633) (-543.634) (-546.167) [-542.769] * (-541.877) (-544.791) (-542.200) [-545.860] -- 0:00:53
130000 -- (-545.043) (-545.533) (-547.208) [-542.989] * (-544.842) (-543.805) [-542.529] (-543.286) -- 0:00:53
Average standard deviation of split frequencies: 0.021466
130500 -- (-544.199) (-545.785) [-546.039] (-542.526) * (-542.177) [-542.533] (-544.748) (-542.282) -- 0:00:53
131000 -- (-547.027) (-544.238) (-543.568) [-543.658] * (-543.161) [-542.624] (-543.129) (-544.196) -- 0:00:53
131500 -- (-545.213) (-546.355) [-542.745] (-547.384) * (-544.424) (-542.068) (-545.093) [-544.094] -- 0:00:52
132000 -- (-543.710) [-544.994] (-546.561) (-545.022) * (-543.592) (-545.021) [-546.088] (-543.232) -- 0:00:52
132500 -- (-544.461) (-542.447) (-546.481) [-543.123] * (-543.375) (-542.528) (-546.121) [-544.371] -- 0:00:52
133000 -- (-547.143) (-545.218) (-550.545) [-543.044] * (-547.468) [-545.036] (-545.273) (-543.475) -- 0:00:52
133500 -- [-548.628] (-547.194) (-549.950) (-544.624) * (-546.022) (-543.035) (-543.221) [-543.326] -- 0:00:51
134000 -- (-548.353) (-543.693) (-543.634) [-544.574] * (-542.294) [-545.444] (-543.016) (-542.828) -- 0:00:51
134500 -- (-542.661) (-543.554) (-543.037) [-543.585] * [-541.839] (-545.982) (-542.414) (-543.583) -- 0:00:51
135000 -- (-543.275) (-546.417) (-544.942) [-542.400] * (-542.525) (-547.645) [-543.457] (-542.937) -- 0:00:51
Average standard deviation of split frequencies: 0.022530
135500 -- (-543.522) [-543.196] (-543.079) (-543.215) * (-541.979) (-543.631) (-545.207) [-542.795] -- 0:00:51
136000 -- (-543.564) (-541.680) (-547.192) [-544.707] * (-542.207) (-545.022) (-544.899) [-544.824] -- 0:00:50
136500 -- [-543.479] (-548.031) (-543.244) (-544.692) * (-543.664) [-541.675] (-548.197) (-544.956) -- 0:00:50
137000 -- (-543.597) [-544.515] (-546.574) (-544.157) * (-544.868) (-545.097) [-543.243] (-546.688) -- 0:00:50
137500 -- (-546.973) (-547.071) [-545.206] (-542.723) * [-541.939] (-546.138) (-543.403) (-544.439) -- 0:00:50
138000 -- (-543.303) (-547.032) (-543.817) [-550.686] * (-544.378) (-547.209) [-546.674] (-542.605) -- 0:00:49
138500 -- (-543.591) (-542.959) (-544.676) [-543.317] * [-545.092] (-549.848) (-545.652) (-545.333) -- 0:00:49
139000 -- (-543.557) [-541.887] (-541.905) (-546.185) * [-544.260] (-547.582) (-543.140) (-542.236) -- 0:00:49
139500 -- [-542.191] (-542.578) (-543.177) (-543.460) * [-544.681] (-546.161) (-543.093) (-549.098) -- 0:00:49
140000 -- [-542.133] (-545.753) (-545.572) (-542.018) * [-545.525] (-543.771) (-544.979) (-543.272) -- 0:00:55
Average standard deviation of split frequencies: 0.020945
140500 -- (-541.803) [-544.613] (-543.312) (-547.565) * [-545.203] (-554.167) (-545.160) (-546.988) -- 0:00:55
141000 -- (-546.951) [-546.911] (-543.553) (-544.001) * [-546.053] (-544.947) (-543.261) (-545.317) -- 0:00:54
141500 -- (-542.725) (-545.065) (-548.272) [-543.823] * (-542.279) (-546.441) (-542.899) [-543.773] -- 0:00:54
142000 -- (-547.213) (-548.444) (-546.005) [-544.804] * (-548.557) (-544.627) [-542.833] (-543.595) -- 0:00:54
142500 -- (-544.816) [-544.278] (-550.135) (-543.949) * (-542.370) [-544.364] (-544.049) (-542.701) -- 0:00:54
143000 -- [-543.463] (-544.581) (-546.703) (-543.702) * [-542.319] (-542.698) (-544.245) (-545.608) -- 0:00:53
143500 -- (-542.479) (-542.580) (-546.166) [-545.890] * (-543.110) (-546.555) [-544.245] (-545.951) -- 0:00:53
144000 -- (-542.044) (-542.995) [-545.084] (-542.247) * (-543.273) (-544.083) (-545.441) [-544.848] -- 0:00:53
144500 -- (-545.127) (-544.229) [-543.087] (-544.893) * [-542.381] (-543.342) (-546.493) (-545.308) -- 0:00:53
145000 -- (-544.154) (-543.144) (-543.826) [-543.753] * [-543.839] (-542.391) (-543.346) (-543.715) -- 0:00:53
Average standard deviation of split frequencies: 0.021281
145500 -- (-543.599) (-545.661) [-544.805] (-543.055) * (-544.251) [-545.626] (-542.723) (-547.881) -- 0:00:52
146000 -- (-542.163) [-544.593] (-543.914) (-542.919) * (-545.673) [-544.219] (-543.530) (-545.854) -- 0:00:52
146500 -- [-544.134] (-545.405) (-549.816) (-545.282) * (-547.573) (-542.281) [-542.386] (-545.997) -- 0:00:52
147000 -- (-544.844) (-544.554) [-547.887] (-542.658) * (-543.730) [-542.069] (-542.581) (-543.688) -- 0:00:52
147500 -- [-544.453] (-541.964) (-544.815) (-542.845) * (-543.367) (-541.598) (-547.503) [-542.854] -- 0:00:52
148000 -- (-546.384) [-544.106] (-543.552) (-543.393) * [-542.098] (-546.247) (-546.675) (-546.912) -- 0:00:51
148500 -- (-544.775) (-543.958) (-546.290) [-542.955] * (-546.300) (-546.083) [-542.657] (-542.494) -- 0:00:51
149000 -- (-542.222) (-543.235) [-544.714] (-542.871) * (-545.984) [-545.305] (-544.830) (-543.664) -- 0:00:51
149500 -- (-543.759) (-547.577) (-543.080) [-543.372] * (-544.509) (-544.310) (-544.731) [-544.865] -- 0:00:51
150000 -- (-549.610) (-546.132) [-544.619] (-544.635) * (-544.757) (-544.755) (-545.132) [-544.094] -- 0:00:51
Average standard deviation of split frequencies: 0.021902
150500 -- [-542.000] (-546.352) (-543.333) (-548.724) * (-543.566) [-545.246] (-543.774) (-547.248) -- 0:00:50
151000 -- (-542.210) [-544.458] (-542.056) (-545.995) * (-544.946) [-546.388] (-543.687) (-544.248) -- 0:00:50
151500 -- (-545.265) [-542.223] (-542.389) (-547.348) * [-542.615] (-543.358) (-542.151) (-544.032) -- 0:00:50
152000 -- (-543.676) [-544.802] (-545.558) (-545.040) * [-543.781] (-543.085) (-542.352) (-542.453) -- 0:00:50
152500 -- (-543.042) (-543.670) (-544.904) [-542.322] * [-546.494] (-545.467) (-543.063) (-543.501) -- 0:00:50
153000 -- [-542.504] (-543.969) (-543.138) (-543.703) * (-544.419) (-549.010) [-544.542] (-542.916) -- 0:00:49
153500 -- (-545.559) (-542.037) (-545.910) [-541.886] * [-544.266] (-544.071) (-543.265) (-544.577) -- 0:00:49
154000 -- (-545.685) [-542.141] (-545.774) (-550.385) * (-544.938) (-542.227) [-542.254] (-546.822) -- 0:00:49
154500 -- [-543.430] (-542.873) (-543.437) (-545.736) * (-543.586) [-542.714] (-545.056) (-543.789) -- 0:00:49
155000 -- [-543.679] (-543.434) (-545.532) (-543.103) * (-544.286) [-542.195] (-548.925) (-542.474) -- 0:00:49
Average standard deviation of split frequencies: 0.021908
155500 -- (-548.176) [-542.430] (-544.767) (-545.605) * (-546.327) [-543.238] (-542.714) (-546.463) -- 0:00:48
156000 -- (-543.321) (-543.149) [-542.879] (-549.169) * (-542.982) (-543.725) [-543.260] (-546.951) -- 0:00:48
156500 -- (-542.763) (-543.929) (-547.982) [-546.560] * (-543.340) (-543.132) (-542.675) [-543.807] -- 0:00:53
157000 -- (-544.472) (-542.218) (-545.272) [-544.887] * [-542.917] (-543.477) (-545.149) (-543.149) -- 0:00:53
157500 -- (-547.812) (-543.162) [-544.166] (-544.969) * (-543.448) (-542.784) [-547.581] (-546.038) -- 0:00:53
158000 -- (-543.885) (-543.961) (-542.432) [-548.416] * (-543.122) (-542.528) (-542.235) [-544.379] -- 0:00:53
158500 -- (-543.493) (-543.597) (-544.831) [-545.416] * (-542.670) (-543.767) [-544.174] (-547.141) -- 0:00:53
159000 -- (-545.220) [-544.833] (-545.077) (-542.299) * (-544.968) (-543.715) [-545.229] (-543.522) -- 0:00:52
159500 -- (-543.014) [-546.716] (-544.543) (-542.248) * [-544.125] (-543.806) (-545.412) (-542.185) -- 0:00:52
160000 -- [-542.585] (-547.265) (-548.744) (-544.163) * (-543.786) (-543.633) (-541.646) [-542.276] -- 0:00:52
Average standard deviation of split frequencies: 0.022855
160500 -- (-547.479) (-542.653) [-546.624] (-544.563) * (-543.053) [-543.233] (-545.824) (-542.948) -- 0:00:52
161000 -- [-543.607] (-542.319) (-546.545) (-544.450) * (-543.134) (-542.920) (-542.129) [-541.939] -- 0:00:52
161500 -- (-541.924) (-545.646) [-544.718] (-542.356) * (-544.577) (-545.265) (-549.986) [-542.263] -- 0:00:51
162000 -- (-542.352) [-542.707] (-547.180) (-543.799) * (-542.801) [-548.983] (-548.500) (-542.812) -- 0:00:51
162500 -- (-547.617) (-544.136) (-541.820) [-541.713] * (-542.638) (-545.066) [-544.959] (-544.392) -- 0:00:51
163000 -- (-553.544) (-543.545) (-545.441) [-543.517] * [-542.501] (-543.714) (-542.527) (-545.088) -- 0:00:51
163500 -- (-548.794) (-545.009) [-543.036] (-543.925) * [-544.436] (-542.082) (-542.592) (-547.466) -- 0:00:51
164000 -- (-543.799) [-544.711] (-542.552) (-544.266) * (-545.895) [-542.452] (-542.577) (-545.161) -- 0:00:50
164500 -- (-543.453) (-543.040) [-543.794] (-545.651) * (-542.726) [-545.043] (-543.481) (-550.646) -- 0:00:50
165000 -- [-542.773] (-542.625) (-542.792) (-547.726) * (-541.969) (-544.665) [-542.254] (-548.223) -- 0:00:50
Average standard deviation of split frequencies: 0.018459
165500 -- (-547.281) (-544.171) [-543.098] (-545.021) * (-542.011) (-543.217) (-548.924) [-544.398] -- 0:00:50
166000 -- (-541.796) (-543.717) [-544.062] (-542.034) * (-545.061) (-545.182) (-542.066) [-546.226] -- 0:00:50
166500 -- (-542.461) [-541.801] (-547.743) (-543.074) * (-543.762) [-544.630] (-546.168) (-542.864) -- 0:00:50
167000 -- (-542.153) (-542.738) (-545.977) [-542.376] * [-543.465] (-546.101) (-543.268) (-544.538) -- 0:00:49
167500 -- (-544.056) (-543.547) (-544.514) [-542.141] * (-547.605) [-550.784] (-545.474) (-546.361) -- 0:00:49
168000 -- [-544.982] (-542.791) (-543.404) (-542.516) * [-542.234] (-545.784) (-542.639) (-542.946) -- 0:00:49
168500 -- [-544.329] (-545.283) (-544.085) (-545.684) * (-542.449) (-546.620) [-543.010] (-541.664) -- 0:00:49
169000 -- (-544.108) (-544.637) [-541.781] (-543.795) * (-541.642) [-545.454] (-544.587) (-544.480) -- 0:00:49
169500 -- [-543.027] (-547.224) (-542.904) (-542.614) * (-541.904) (-542.238) [-545.750] (-543.723) -- 0:00:48
170000 -- (-543.292) (-547.406) [-542.830] (-542.500) * [-542.253] (-542.403) (-546.133) (-544.205) -- 0:00:48
Average standard deviation of split frequencies: 0.023115
170500 -- (-547.613) [-544.485] (-544.416) (-542.535) * (-542.496) [-543.958] (-544.227) (-546.798) -- 0:00:48
171000 -- (-543.757) [-546.950] (-544.710) (-545.089) * [-544.378] (-541.667) (-545.724) (-544.603) -- 0:00:48
171500 -- (-543.617) [-542.385] (-543.356) (-545.949) * (-546.022) (-544.005) (-543.903) [-543.387] -- 0:00:48
172000 -- [-543.138] (-542.720) (-543.681) (-546.008) * (-544.886) (-544.157) [-542.462] (-543.186) -- 0:00:48
172500 -- (-543.209) [-545.361] (-542.006) (-545.470) * (-544.681) (-543.464) (-546.971) [-544.703] -- 0:00:47
173000 -- (-542.399) [-541.612] (-542.367) (-543.007) * (-543.944) (-545.286) (-547.398) [-543.407] -- 0:00:47
173500 -- (-543.526) (-544.786) (-545.055) [-543.742] * (-542.446) [-543.461] (-546.268) (-543.767) -- 0:00:52
174000 -- (-543.733) (-542.584) [-543.019] (-546.309) * [-543.932] (-544.559) (-546.079) (-546.483) -- 0:00:52
174500 -- (-544.050) (-542.354) [-545.118] (-543.508) * (-542.657) [-542.380] (-542.562) (-544.222) -- 0:00:52
175000 -- [-545.688] (-542.663) (-542.239) (-542.861) * (-546.243) (-543.356) (-543.052) [-543.050] -- 0:00:51
Average standard deviation of split frequencies: 0.023542
175500 -- (-548.233) (-542.421) (-543.898) [-543.761] * [-545.989] (-545.784) (-542.614) (-545.821) -- 0:00:51
176000 -- [-543.513] (-544.214) (-543.881) (-543.305) * [-543.865] (-542.705) (-543.428) (-550.094) -- 0:00:51
176500 -- [-546.111] (-543.235) (-542.686) (-544.102) * (-545.620) (-543.226) [-551.021] (-543.777) -- 0:00:51
177000 -- (-543.011) [-542.125] (-544.234) (-543.978) * (-545.023) (-543.576) [-543.796] (-542.627) -- 0:00:51
177500 -- (-546.836) (-543.734) (-543.256) [-543.640] * [-544.688] (-550.380) (-546.340) (-545.320) -- 0:00:50
178000 -- (-542.895) (-548.061) [-542.449] (-542.361) * [-543.322] (-547.253) (-548.110) (-543.679) -- 0:00:50
178500 -- [-541.939] (-543.491) (-542.114) (-543.062) * (-542.657) (-542.424) [-543.075] (-545.020) -- 0:00:50
179000 -- [-543.371] (-546.854) (-544.441) (-545.770) * [-544.840] (-547.323) (-545.271) (-542.261) -- 0:00:50
179500 -- (-546.473) (-546.919) [-542.188] (-544.518) * (-546.150) (-546.207) [-543.901] (-542.475) -- 0:00:50
180000 -- (-542.224) [-543.583] (-542.693) (-543.320) * (-546.801) (-543.873) [-544.974] (-543.791) -- 0:00:50
Average standard deviation of split frequencies: 0.023637
180500 -- [-543.546] (-545.426) (-543.407) (-543.500) * (-546.314) (-543.992) (-544.007) [-543.329] -- 0:00:49
181000 -- (-542.362) (-544.310) (-547.108) [-542.938] * (-546.029) (-543.596) (-545.908) [-543.966] -- 0:00:49
181500 -- [-543.347] (-544.952) (-542.641) (-541.987) * [-543.168] (-546.943) (-543.839) (-547.931) -- 0:00:49
182000 -- (-544.158) (-543.151) (-543.889) [-542.410] * (-546.457) [-543.095] (-545.390) (-544.220) -- 0:00:49
182500 -- (-543.047) [-544.291] (-543.311) (-545.093) * (-543.546) (-543.648) [-544.750] (-544.131) -- 0:00:49
183000 -- (-543.413) (-543.099) (-544.282) [-543.205] * (-543.528) [-542.701] (-542.941) (-544.662) -- 0:00:49
183500 -- (-543.855) [-544.248] (-544.383) (-543.689) * (-543.296) (-546.197) [-542.532] (-547.299) -- 0:00:48
184000 -- (-544.334) (-545.559) (-544.403) [-544.573] * (-542.850) (-552.503) (-543.059) [-543.008] -- 0:00:48
184500 -- [-544.529] (-543.133) (-544.421) (-543.440) * (-543.560) (-544.018) (-543.615) [-542.543] -- 0:00:48
185000 -- (-543.653) (-542.260) [-543.426] (-542.943) * [-545.728] (-546.055) (-546.177) (-544.929) -- 0:00:48
Average standard deviation of split frequencies: 0.022943
185500 -- (-545.333) [-544.576] (-549.867) (-541.827) * (-544.864) (-547.356) [-544.852] (-546.963) -- 0:00:48
186000 -- (-543.332) (-541.804) (-546.113) [-547.374] * [-544.356] (-544.542) (-546.081) (-546.409) -- 0:00:48
186500 -- (-542.100) (-542.920) (-543.704) [-543.330] * (-545.635) [-542.092] (-543.493) (-550.668) -- 0:00:47
187000 -- (-545.790) (-544.849) [-542.476] (-544.035) * (-543.001) (-542.214) [-542.231] (-549.202) -- 0:00:47
187500 -- (-544.524) [-544.831] (-543.042) (-545.350) * (-543.358) (-543.494) (-543.164) [-544.359] -- 0:00:47
188000 -- (-545.058) [-545.866] (-542.422) (-544.342) * (-543.339) [-542.986] (-542.357) (-544.386) -- 0:00:47
188500 -- (-546.104) [-543.148] (-543.887) (-543.738) * (-544.583) (-547.546) [-545.513] (-543.443) -- 0:00:47
189000 -- [-544.352] (-542.863) (-543.466) (-543.096) * (-544.043) (-542.642) (-544.309) [-545.481] -- 0:00:47
189500 -- (-541.931) [-544.612] (-543.426) (-543.381) * [-542.986] (-544.333) (-543.690) (-544.964) -- 0:00:47
190000 -- (-542.479) (-543.641) [-543.147] (-545.354) * (-542.442) (-545.007) [-542.770] (-544.720) -- 0:00:46
Average standard deviation of split frequencies: 0.021991
190500 -- [-543.099] (-542.534) (-546.285) (-543.606) * (-544.566) [-544.444] (-544.663) (-545.078) -- 0:00:50
191000 -- [-543.882] (-551.158) (-543.676) (-544.911) * [-544.135] (-545.027) (-544.671) (-543.416) -- 0:00:50
191500 -- (-544.784) [-546.491] (-546.105) (-542.192) * (-543.030) [-544.152] (-548.135) (-547.881) -- 0:00:50
192000 -- (-543.630) (-542.162) (-542.725) [-546.337] * (-542.491) [-545.121] (-542.181) (-543.176) -- 0:00:50
192500 -- [-544.178] (-542.811) (-542.445) (-545.788) * (-543.184) [-541.893] (-542.789) (-546.437) -- 0:00:50
193000 -- (-543.194) (-543.732) (-544.233) [-543.343] * (-544.379) (-543.179) (-542.830) [-545.370] -- 0:00:50
193500 -- [-542.744] (-544.088) (-545.418) (-544.361) * (-545.476) (-544.500) [-542.969] (-544.374) -- 0:00:50
194000 -- (-543.381) (-545.851) [-542.716] (-545.060) * [-543.575] (-544.637) (-544.033) (-545.296) -- 0:00:49
194500 -- [-544.481] (-542.936) (-542.927) (-543.535) * (-542.843) (-544.589) [-542.408] (-542.341) -- 0:00:49
195000 -- (-543.097) [-543.926] (-545.017) (-542.488) * (-546.332) [-543.016] (-543.908) (-544.900) -- 0:00:49
Average standard deviation of split frequencies: 0.022279
195500 -- (-543.338) [-541.590] (-545.611) (-545.154) * (-543.851) (-543.187) (-543.967) [-543.260] -- 0:00:49
196000 -- (-543.532) [-543.265] (-548.913) (-542.977) * (-542.216) (-543.104) (-545.324) [-542.712] -- 0:00:49
196500 -- (-544.346) [-544.409] (-543.280) (-542.483) * (-542.437) (-542.654) [-543.762] (-547.389) -- 0:00:49
197000 -- (-542.644) [-543.702] (-542.201) (-545.801) * [-544.267] (-547.252) (-543.632) (-546.005) -- 0:00:48
197500 -- [-541.866] (-542.794) (-543.563) (-543.251) * (-545.421) [-544.805] (-543.902) (-544.987) -- 0:00:48
198000 -- [-546.109] (-544.437) (-548.985) (-542.919) * (-542.985) (-542.850) [-545.296] (-542.876) -- 0:00:48
198500 -- [-543.067] (-546.530) (-543.557) (-542.278) * [-544.695] (-543.561) (-545.674) (-541.946) -- 0:00:48
199000 -- (-544.165) [-546.892] (-545.132) (-545.413) * [-543.267] (-545.102) (-547.259) (-542.463) -- 0:00:48
199500 -- (-547.693) (-545.181) (-544.107) [-543.318] * [-542.908] (-542.004) (-548.046) (-543.717) -- 0:00:48
200000 -- (-545.719) [-545.731] (-546.381) (-545.809) * [-542.987] (-542.806) (-543.482) (-542.733) -- 0:00:48
Average standard deviation of split frequencies: 0.024275
200500 -- [-542.620] (-542.951) (-541.930) (-542.501) * (-544.431) (-543.629) (-542.579) [-545.621] -- 0:00:47
201000 -- (-543.517) [-543.931] (-545.981) (-544.153) * (-543.484) (-544.566) (-542.739) [-542.563] -- 0:00:47
201500 -- [-543.536] (-546.254) (-546.303) (-546.097) * (-545.786) (-542.710) [-544.126] (-543.607) -- 0:00:47
202000 -- (-543.793) [-549.748] (-547.362) (-542.717) * (-544.592) [-543.612] (-543.456) (-544.803) -- 0:00:47
202500 -- (-542.973) [-544.457] (-543.192) (-543.685) * (-544.008) (-544.821) (-542.069) [-543.857] -- 0:00:47
203000 -- (-542.406) (-545.966) (-544.622) [-543.567] * (-546.541) [-544.721] (-542.649) (-552.198) -- 0:00:47
203500 -- [-542.718] (-543.980) (-543.718) (-543.868) * (-544.515) (-544.088) (-542.885) [-541.746] -- 0:00:46
204000 -- (-543.816) (-544.522) [-543.861] (-544.299) * (-543.165) (-542.607) (-545.294) [-541.859] -- 0:00:46
204500 -- (-544.646) (-541.841) [-542.186] (-544.799) * (-543.136) (-548.525) (-544.716) [-542.440] -- 0:00:46
205000 -- (-545.025) (-541.722) (-543.145) [-544.808] * (-544.254) (-543.412) (-543.218) [-542.539] -- 0:00:46
Average standard deviation of split frequencies: 0.021282
205500 -- [-542.785] (-543.834) (-542.826) (-543.102) * [-543.674] (-543.776) (-542.607) (-548.050) -- 0:00:46
206000 -- (-544.354) (-545.958) [-541.933] (-542.135) * (-546.913) (-541.849) [-545.554] (-545.039) -- 0:00:46
206500 -- (-543.703) [-542.106] (-542.326) (-543.966) * (-543.636) [-544.570] (-548.600) (-545.205) -- 0:00:46
207000 -- (-543.171) (-542.381) (-545.248) [-547.549] * (-543.681) (-542.491) (-542.891) [-543.034] -- 0:00:49
207500 -- (-543.885) (-542.007) [-543.156] (-547.133) * (-543.549) (-544.003) [-544.005] (-542.304) -- 0:00:49
208000 -- (-543.953) (-544.183) [-545.359] (-543.084) * [-543.377] (-543.187) (-546.539) (-543.291) -- 0:00:49
208500 -- (-544.490) (-542.422) [-542.601] (-544.542) * (-546.473) (-544.028) [-542.811] (-544.056) -- 0:00:49
209000 -- (-547.876) (-544.615) [-546.277] (-544.875) * (-544.298) (-543.930) [-544.512] (-543.375) -- 0:00:49
209500 -- (-544.247) (-542.221) [-544.062] (-545.993) * (-543.313) [-542.143] (-547.206) (-542.025) -- 0:00:49
210000 -- (-543.007) [-546.962] (-542.443) (-545.424) * [-543.301] (-542.580) (-545.213) (-547.480) -- 0:00:48
Average standard deviation of split frequencies: 0.021370
210500 -- (-542.317) [-546.752] (-542.065) (-544.706) * [-544.875] (-541.794) (-544.046) (-548.319) -- 0:00:48
211000 -- [-542.276] (-545.938) (-545.806) (-543.113) * [-544.069] (-544.060) (-545.153) (-545.479) -- 0:00:48
211500 -- (-543.338) [-545.025] (-544.359) (-544.413) * (-543.112) (-544.643) [-542.978] (-542.987) -- 0:00:48
212000 -- (-548.582) (-547.679) [-542.916] (-543.097) * (-544.443) (-542.753) [-543.233] (-542.569) -- 0:00:48
212500 -- [-543.683] (-549.045) (-544.924) (-545.647) * (-543.099) (-543.428) (-541.819) [-544.714] -- 0:00:48
213000 -- (-543.389) [-544.227] (-544.973) (-547.562) * (-542.472) (-547.157) (-544.586) [-544.108] -- 0:00:48
213500 -- (-543.291) (-542.962) [-542.857] (-548.152) * [-542.644] (-544.555) (-547.454) (-542.637) -- 0:00:47
214000 -- (-544.530) [-543.739] (-545.947) (-542.342) * (-543.738) (-544.392) [-542.772] (-543.596) -- 0:00:47
214500 -- [-544.253] (-544.225) (-544.049) (-544.017) * (-545.666) [-544.992] (-542.032) (-542.783) -- 0:00:47
215000 -- (-545.713) [-545.741] (-545.635) (-543.479) * [-544.685] (-544.960) (-542.622) (-549.641) -- 0:00:47
Average standard deviation of split frequencies: 0.021365
215500 -- (-546.470) (-543.679) [-543.274] (-544.498) * (-549.180) (-542.913) (-544.253) [-544.558] -- 0:00:47
216000 -- [-547.943] (-541.726) (-544.569) (-543.935) * (-546.651) [-542.928] (-542.775) (-546.203) -- 0:00:47
216500 -- (-541.611) (-547.994) (-542.087) [-544.460] * [-545.909] (-548.039) (-542.935) (-542.461) -- 0:00:47
217000 -- [-541.843] (-545.671) (-542.615) (-543.888) * (-546.162) (-546.582) [-542.288] (-546.017) -- 0:00:46
217500 -- (-544.686) [-541.870] (-543.154) (-544.798) * (-550.272) (-543.576) [-542.614] (-542.368) -- 0:00:46
218000 -- (-547.603) [-542.204] (-547.530) (-551.099) * (-549.482) (-542.559) (-547.505) [-544.541] -- 0:00:46
218500 -- (-544.484) [-544.408] (-543.399) (-545.521) * [-544.526] (-544.481) (-542.670) (-546.302) -- 0:00:46
219000 -- [-543.692] (-547.435) (-542.540) (-543.912) * (-544.691) (-542.435) [-543.436] (-546.204) -- 0:00:46
219500 -- (-543.822) (-542.107) [-544.827] (-544.764) * [-542.829] (-544.894) (-542.886) (-544.882) -- 0:00:46
220000 -- [-545.374] (-542.622) (-544.844) (-543.979) * (-543.218) [-544.974] (-543.573) (-545.417) -- 0:00:46
Average standard deviation of split frequencies: 0.022150
220500 -- [-544.925] (-545.609) (-545.963) (-546.097) * [-543.566] (-542.503) (-544.859) (-544.170) -- 0:00:45
221000 -- (-545.120) [-544.047] (-543.699) (-543.934) * [-546.818] (-543.411) (-548.520) (-543.992) -- 0:00:45
221500 -- [-548.172] (-543.032) (-545.606) (-543.786) * (-547.745) [-543.752] (-545.287) (-544.883) -- 0:00:45
222000 -- [-542.783] (-545.161) (-544.650) (-548.919) * (-542.856) [-542.751] (-546.623) (-547.305) -- 0:00:45
222500 -- (-543.722) [-545.683] (-546.621) (-543.204) * (-542.238) [-545.251] (-545.082) (-543.083) -- 0:00:45
223000 -- (-542.834) (-542.945) (-545.738) [-544.966] * [-542.150] (-542.800) (-547.058) (-545.202) -- 0:00:45
223500 -- (-546.516) (-543.527) [-543.024] (-542.015) * (-542.835) (-542.961) [-544.931] (-543.687) -- 0:00:48
224000 -- (-546.340) [-542.152] (-544.505) (-543.029) * (-545.959) (-550.820) (-543.239) [-543.792] -- 0:00:48
224500 -- (-549.666) (-541.904) (-543.491) [-544.035] * (-545.275) [-543.418] (-542.785) (-545.537) -- 0:00:48
225000 -- (-545.008) [-543.113] (-543.887) (-544.729) * [-544.591] (-544.236) (-542.615) (-553.799) -- 0:00:48
Average standard deviation of split frequencies: 0.021517
225500 -- (-545.639) (-546.547) [-542.190] (-543.137) * (-541.702) [-545.916] (-542.615) (-543.532) -- 0:00:48
226000 -- (-543.383) [-544.121] (-544.379) (-546.145) * [-543.042] (-543.936) (-545.064) (-544.080) -- 0:00:47
226500 -- (-543.987) [-542.375] (-543.577) (-543.446) * (-542.799) (-544.423) [-543.724] (-544.444) -- 0:00:47
227000 -- [-542.496] (-545.483) (-546.991) (-545.281) * (-543.077) (-543.540) [-542.690] (-544.703) -- 0:00:47
227500 -- (-544.327) (-545.942) (-548.175) [-543.941] * [-545.054] (-546.023) (-543.130) (-542.782) -- 0:00:47
228000 -- (-547.007) (-545.392) (-543.701) [-543.774] * (-544.201) [-544.488] (-543.546) (-546.778) -- 0:00:47
228500 -- (-543.468) (-544.938) (-542.951) [-542.091] * (-543.091) [-545.953] (-542.999) (-544.292) -- 0:00:47
229000 -- [-543.042] (-542.120) (-542.016) (-542.200) * [-542.602] (-543.017) (-543.100) (-544.451) -- 0:00:47
229500 -- [-547.547] (-542.932) (-543.132) (-545.460) * (-545.120) (-543.635) (-542.455) [-545.375] -- 0:00:47
230000 -- (-545.299) (-542.039) (-544.020) [-545.969] * (-547.307) (-546.074) (-542.381) [-556.026] -- 0:00:46
Average standard deviation of split frequencies: 0.020891
230500 -- (-544.878) [-542.021] (-546.386) (-547.387) * (-542.053) (-542.670) [-543.134] (-546.226) -- 0:00:46
231000 -- (-549.153) (-543.524) [-541.588] (-549.147) * (-542.851) (-547.708) [-542.800] (-545.790) -- 0:00:46
231500 -- (-545.646) [-542.423] (-545.376) (-542.756) * (-545.899) [-545.794] (-544.482) (-543.187) -- 0:00:46
232000 -- (-542.764) (-542.885) (-544.031) [-543.742] * (-542.378) [-545.339] (-543.881) (-547.053) -- 0:00:46
232500 -- [-541.907] (-542.832) (-542.699) (-542.436) * (-542.017) [-545.529] (-543.665) (-546.776) -- 0:00:46
233000 -- (-541.856) [-542.736] (-544.529) (-544.832) * (-542.293) (-543.659) [-544.509] (-542.287) -- 0:00:46
233500 -- (-542.997) (-543.537) [-547.010] (-543.477) * [-542.623] (-545.389) (-544.906) (-545.000) -- 0:00:45
234000 -- [-546.630] (-543.895) (-546.865) (-543.186) * (-542.241) [-543.406] (-546.008) (-543.581) -- 0:00:45
234500 -- (-543.020) [-545.172] (-547.556) (-541.615) * [-544.606] (-543.458) (-545.977) (-541.863) -- 0:00:45
235000 -- (-544.076) (-543.550) (-545.452) [-542.869] * (-542.892) [-545.411] (-545.970) (-548.215) -- 0:00:45
Average standard deviation of split frequencies: 0.020974
235500 -- (-542.696) [-541.741] (-546.080) (-543.241) * [-544.009] (-545.028) (-542.143) (-542.054) -- 0:00:45
236000 -- (-545.515) (-544.338) [-544.419] (-543.327) * [-542.791] (-543.666) (-542.382) (-542.797) -- 0:00:45
236500 -- [-544.567] (-547.584) (-542.768) (-543.254) * [-542.194] (-543.997) (-546.127) (-544.759) -- 0:00:45
237000 -- (-546.043) (-544.284) (-548.303) [-545.082] * (-544.746) (-543.753) [-544.178] (-543.138) -- 0:00:45
237500 -- (-545.127) (-544.544) [-541.982] (-544.422) * (-544.847) (-550.247) (-541.764) [-543.045] -- 0:00:44
238000 -- [-542.711] (-542.615) (-541.911) (-543.893) * (-544.846) (-547.025) (-544.604) [-542.250] -- 0:00:44
238500 -- [-543.865] (-541.863) (-543.627) (-544.821) * (-544.918) [-543.907] (-542.141) (-552.226) -- 0:00:44
239000 -- (-546.571) (-543.718) [-545.448] (-543.785) * (-541.917) (-545.373) (-542.736) [-548.644] -- 0:00:44
239500 -- (-546.594) (-544.475) [-545.136] (-543.104) * [-542.858] (-542.831) (-541.943) (-547.682) -- 0:00:44
240000 -- (-546.857) [-542.954] (-543.835) (-541.893) * (-544.694) [-543.711] (-543.202) (-546.064) -- 0:00:44
Average standard deviation of split frequencies: 0.019832
240500 -- (-546.997) [-544.494] (-545.208) (-545.567) * (-542.371) (-544.664) (-544.472) [-543.653] -- 0:00:47
241000 -- [-543.540] (-545.043) (-547.141) (-546.420) * (-545.707) [-542.931] (-543.534) (-544.537) -- 0:00:47
241500 -- (-547.547) (-542.715) (-543.449) [-547.595] * (-543.763) (-549.459) (-543.785) [-544.294] -- 0:00:47
242000 -- (-544.730) [-542.043] (-543.943) (-545.659) * (-547.727) (-547.891) (-544.547) [-543.462] -- 0:00:46
242500 -- (-544.504) (-544.327) (-545.578) [-546.048] * (-544.219) (-550.101) [-542.737] (-545.661) -- 0:00:46
243000 -- [-543.189] (-541.967) (-545.393) (-547.027) * [-543.490] (-544.526) (-546.412) (-541.967) -- 0:00:46
243500 -- (-544.718) (-543.474) [-544.750] (-542.476) * [-543.668] (-545.231) (-544.925) (-544.642) -- 0:00:46
244000 -- (-543.966) (-548.714) (-542.060) [-543.326] * [-543.707] (-542.436) (-543.132) (-546.738) -- 0:00:46
244500 -- (-547.644) (-544.921) (-543.696) [-545.813] * (-542.388) (-545.737) (-543.399) [-547.573] -- 0:00:46
245000 -- (-546.654) (-545.499) (-546.916) [-546.520] * (-543.518) (-542.196) [-544.053] (-545.856) -- 0:00:46
Average standard deviation of split frequencies: 0.019501
245500 -- [-546.007] (-545.747) (-549.685) (-542.070) * [-542.287] (-545.684) (-543.337) (-543.912) -- 0:00:46
246000 -- [-542.830] (-545.809) (-544.512) (-544.292) * [-542.285] (-543.166) (-544.838) (-544.339) -- 0:00:45
246500 -- (-543.925) (-548.318) [-546.262] (-542.707) * (-543.130) [-546.683] (-545.185) (-544.467) -- 0:00:45
247000 -- (-545.475) [-544.941] (-542.568) (-543.480) * (-543.755) [-543.824] (-543.996) (-543.915) -- 0:00:45
247500 -- [-543.940] (-543.386) (-543.559) (-543.852) * [-542.837] (-546.040) (-543.744) (-550.640) -- 0:00:45
248000 -- [-543.320] (-542.869) (-541.974) (-542.598) * (-545.819) [-543.953] (-544.137) (-543.322) -- 0:00:45
248500 -- [-545.547] (-542.560) (-542.179) (-546.379) * (-545.573) (-547.038) (-546.650) [-544.392] -- 0:00:45
249000 -- (-546.580) [-543.455] (-548.256) (-545.112) * (-542.602) (-546.647) [-542.352] (-543.562) -- 0:00:45
249500 -- [-545.150] (-544.105) (-541.930) (-546.731) * (-542.880) (-545.384) [-546.112] (-544.026) -- 0:00:45
250000 -- (-543.236) [-547.066] (-541.874) (-543.963) * (-544.821) (-547.070) (-542.468) [-543.592] -- 0:00:45
Average standard deviation of split frequencies: 0.018806
250500 -- (-543.413) [-547.765] (-541.724) (-542.502) * (-542.632) (-544.443) (-544.210) [-542.796] -- 0:00:44
251000 -- (-545.470) (-543.167) (-542.758) [-542.663] * (-541.789) [-542.461] (-542.025) (-542.938) -- 0:00:44
251500 -- (-544.388) (-542.830) (-543.103) [-542.507] * [-542.173] (-542.579) (-543.561) (-542.756) -- 0:00:44
252000 -- [-543.421] (-545.343) (-543.202) (-547.016) * (-544.905) (-544.284) [-544.204] (-544.598) -- 0:00:44
252500 -- (-544.028) (-549.725) (-542.942) [-545.532] * (-542.875) (-546.700) [-543.488] (-544.565) -- 0:00:44
253000 -- (-546.340) (-545.919) (-544.695) [-543.229] * [-545.046] (-547.087) (-543.203) (-542.723) -- 0:00:44
253500 -- (-544.241) (-544.173) (-542.723) [-542.476] * (-543.609) (-543.771) [-544.284] (-544.518) -- 0:00:44
254000 -- (-543.540) (-546.154) (-544.030) [-542.010] * [-544.757] (-544.273) (-543.333) (-544.199) -- 0:00:44
254500 -- (-542.003) (-549.085) (-546.515) [-543.247] * (-543.919) (-542.697) (-542.833) [-542.400] -- 0:00:43
255000 -- (-546.468) (-542.004) [-543.614] (-543.728) * (-543.715) (-549.759) (-542.486) [-542.825] -- 0:00:43
Average standard deviation of split frequencies: 0.019281
255500 -- (-543.547) (-542.014) [-543.244] (-544.373) * (-544.571) (-549.537) [-544.822] (-543.448) -- 0:00:43
256000 -- (-545.426) (-544.980) (-544.360) [-544.462] * [-542.667] (-542.133) (-545.956) (-546.316) -- 0:00:43
256500 -- (-543.973) [-543.902] (-545.797) (-542.382) * [-545.690] (-542.944) (-545.317) (-544.848) -- 0:00:43
257000 -- (-543.844) [-543.358] (-542.345) (-545.158) * (-546.754) [-542.962] (-546.511) (-547.325) -- 0:00:43
257500 -- (-542.126) (-543.232) (-541.678) [-544.201] * (-547.020) [-542.484] (-543.413) (-544.388) -- 0:00:46
258000 -- (-542.855) (-543.010) [-544.016] (-544.064) * (-543.566) (-546.736) (-543.922) [-543.082] -- 0:00:46
258500 -- (-544.002) (-544.641) (-543.669) [-545.672] * (-546.193) (-544.054) [-542.891] (-545.854) -- 0:00:45
259000 -- (-547.594) (-545.252) [-544.758] (-543.534) * (-543.784) (-542.633) [-542.316] (-545.272) -- 0:00:45
259500 -- (-552.283) (-547.703) [-543.693] (-543.353) * (-542.732) (-544.276) (-543.357) [-544.180] -- 0:00:45
260000 -- [-544.238] (-543.580) (-544.952) (-544.485) * (-545.630) (-543.864) [-542.402] (-543.553) -- 0:00:45
Average standard deviation of split frequencies: 0.018297
260500 -- [-542.435] (-542.838) (-543.923) (-541.988) * (-546.762) (-543.816) (-542.770) [-544.944] -- 0:00:45
261000 -- [-544.246] (-545.097) (-544.485) (-542.133) * (-546.723) [-542.257] (-545.305) (-543.766) -- 0:00:45
261500 -- (-545.000) (-544.707) (-546.576) [-542.572] * [-546.320] (-542.522) (-545.660) (-544.808) -- 0:00:45
262000 -- (-548.430) [-542.668] (-546.083) (-542.155) * [-544.978] (-543.380) (-543.502) (-541.889) -- 0:00:45
262500 -- (-543.172) (-544.371) [-543.113] (-545.615) * (-546.749) [-546.691] (-543.177) (-543.483) -- 0:00:44
263000 -- (-548.030) (-545.226) [-543.018] (-542.432) * [-542.760] (-546.279) (-544.022) (-543.407) -- 0:00:44
263500 -- (-546.766) (-543.089) (-545.263) [-545.459] * [-543.539] (-544.342) (-543.134) (-544.386) -- 0:00:44
264000 -- (-544.196) (-543.167) (-543.957) [-545.636] * (-545.563) [-542.430] (-549.053) (-546.245) -- 0:00:44
264500 -- (-546.201) (-544.443) (-546.068) [-543.951] * (-543.973) [-542.540] (-545.499) (-544.565) -- 0:00:44
265000 -- (-544.657) [-542.283] (-543.078) (-546.407) * [-543.165] (-542.074) (-542.245) (-545.081) -- 0:00:44
Average standard deviation of split frequencies: 0.018035
265500 -- [-544.242] (-542.397) (-542.568) (-550.384) * (-543.976) (-543.663) (-546.138) [-543.418] -- 0:00:44
266000 -- (-545.151) (-542.457) [-542.452] (-544.753) * (-544.782) (-543.239) (-546.297) [-543.390] -- 0:00:44
266500 -- [-542.161] (-544.746) (-544.229) (-546.355) * (-542.385) (-542.003) [-542.994] (-542.885) -- 0:00:44
267000 -- [-545.217] (-544.356) (-542.535) (-546.238) * (-544.007) (-544.699) (-543.930) [-542.103] -- 0:00:43
267500 -- (-542.722) (-544.872) (-544.074) [-542.496] * (-543.733) (-545.069) (-544.430) [-545.772] -- 0:00:43
268000 -- (-543.516) (-544.679) [-542.515] (-543.465) * [-543.492] (-542.762) (-550.580) (-544.550) -- 0:00:43
268500 -- (-543.063) (-544.148) [-544.121] (-543.069) * [-544.246] (-547.977) (-550.212) (-543.741) -- 0:00:43
269000 -- (-542.759) (-546.178) [-542.709] (-541.762) * (-545.032) (-545.617) (-544.285) [-547.430] -- 0:00:43
269500 -- (-543.321) [-543.355] (-543.835) (-543.298) * (-544.707) [-548.562] (-543.656) (-542.998) -- 0:00:43
270000 -- (-541.931) (-544.744) [-545.995] (-542.360) * (-543.065) (-547.725) (-545.950) [-542.794] -- 0:00:43
Average standard deviation of split frequencies: 0.017724
270500 -- (-542.134) [-543.101] (-543.942) (-543.001) * [-543.225] (-543.505) (-547.026) (-544.022) -- 0:00:43
271000 -- (-547.782) [-543.845] (-548.848) (-542.357) * (-544.138) (-545.475) (-546.686) [-543.431] -- 0:00:43
271500 -- (-543.613) [-543.424] (-545.444) (-541.777) * (-545.391) (-546.090) (-544.110) [-544.551] -- 0:00:42
272000 -- [-544.846] (-545.124) (-544.152) (-545.918) * (-543.116) (-543.824) [-542.152] (-544.883) -- 0:00:42
272500 -- (-548.163) (-542.339) (-543.790) [-542.747] * [-544.524] (-546.098) (-541.638) (-542.448) -- 0:00:42
273000 -- [-543.099] (-542.310) (-546.830) (-547.863) * (-546.105) [-544.165] (-542.120) (-543.554) -- 0:00:42
273500 -- (-547.579) (-542.920) (-543.329) [-542.544] * (-542.765) [-546.145] (-541.766) (-546.202) -- 0:00:42
274000 -- (-545.425) (-543.142) (-545.269) [-544.481] * (-543.172) (-542.367) [-543.346] (-547.755) -- 0:00:45
274500 -- (-544.908) [-547.002] (-547.715) (-542.986) * (-543.096) [-543.393] (-543.607) (-546.019) -- 0:00:44
275000 -- (-544.123) [-542.386] (-543.221) (-544.591) * (-545.130) (-545.319) (-542.491) [-543.863] -- 0:00:44
Average standard deviation of split frequencies: 0.016979
275500 -- (-547.477) (-546.401) (-542.682) [-541.995] * (-544.017) (-543.450) (-550.653) [-544.779] -- 0:00:44
276000 -- (-547.677) (-545.647) [-541.949] (-542.828) * (-542.050) (-545.366) [-543.719] (-545.449) -- 0:00:44
276500 -- (-546.406) (-548.171) (-543.759) [-543.428] * (-542.052) (-545.461) (-541.597) [-544.183] -- 0:00:44
277000 -- [-545.194] (-546.096) (-542.089) (-543.036) * (-542.310) [-542.276] (-542.000) (-544.166) -- 0:00:44
277500 -- (-542.878) [-543.095] (-542.086) (-542.073) * (-542.109) [-544.863] (-545.926) (-545.366) -- 0:00:44
278000 -- (-543.277) [-543.164] (-543.008) (-543.328) * (-545.092) (-542.820) (-547.977) [-549.295] -- 0:00:44
278500 -- (-542.816) (-542.797) (-543.049) [-543.079] * (-543.048) (-543.287) (-548.855) [-545.665] -- 0:00:44
279000 -- (-542.328) [-542.261] (-546.880) (-544.344) * (-545.700) (-545.677) [-544.527] (-545.404) -- 0:00:43
279500 -- (-543.217) (-543.604) (-546.594) [-546.144] * (-541.727) (-542.532) [-544.674] (-545.462) -- 0:00:43
280000 -- (-542.342) (-541.928) (-545.645) [-545.210] * (-544.464) (-542.156) [-544.002] (-543.991) -- 0:00:43
Average standard deviation of split frequencies: 0.016302
280500 -- (-542.203) (-543.802) [-543.373] (-543.992) * (-545.124) [-546.293] (-543.397) (-542.223) -- 0:00:43
281000 -- [-541.816] (-544.875) (-543.352) (-542.629) * [-542.594] (-547.576) (-545.126) (-544.341) -- 0:00:43
281500 -- (-543.979) (-543.515) [-543.875] (-544.790) * [-542.224] (-542.578) (-543.067) (-543.069) -- 0:00:43
282000 -- [-543.415] (-542.143) (-542.871) (-547.458) * [-544.386] (-543.757) (-542.367) (-544.466) -- 0:00:43
282500 -- (-545.068) (-545.009) (-543.511) [-546.330] * [-544.305] (-542.761) (-542.954) (-544.537) -- 0:00:43
283000 -- (-543.620) (-543.822) [-544.858] (-546.804) * [-543.632] (-547.259) (-547.688) (-548.432) -- 0:00:43
283500 -- (-542.550) (-544.234) [-545.098] (-545.484) * (-542.744) (-550.117) (-545.068) [-543.537] -- 0:00:42
284000 -- (-544.789) [-542.070] (-543.286) (-541.667) * (-544.736) (-547.303) [-541.981] (-548.612) -- 0:00:42
284500 -- (-542.681) [-542.120] (-541.729) (-543.764) * (-548.621) [-542.430] (-542.894) (-545.001) -- 0:00:42
285000 -- (-545.160) (-543.789) [-542.004] (-541.994) * (-546.676) [-544.482] (-542.450) (-542.904) -- 0:00:42
Average standard deviation of split frequencies: 0.016483
285500 -- (-544.056) (-542.563) (-541.841) [-542.443] * (-543.572) (-544.430) [-543.520] (-546.993) -- 0:00:42
286000 -- (-543.371) (-542.698) (-543.060) [-542.556] * (-544.169) [-543.157] (-543.392) (-546.572) -- 0:00:42
286500 -- [-545.414] (-547.372) (-545.254) (-542.759) * (-542.372) [-545.193] (-545.190) (-542.808) -- 0:00:42
287000 -- (-544.545) (-554.274) (-544.867) [-543.692] * (-545.211) (-544.775) (-545.908) [-542.114] -- 0:00:42
287500 -- (-543.577) (-548.408) [-546.407] (-542.057) * (-544.586) (-545.007) (-542.138) [-542.951] -- 0:00:42
288000 -- (-543.945) [-542.280] (-544.982) (-542.321) * (-544.333) (-547.657) [-543.517] (-543.199) -- 0:00:42
288500 -- (-543.407) [-542.537] (-542.973) (-541.969) * [-542.471] (-542.901) (-545.368) (-542.167) -- 0:00:41
289000 -- [-544.432] (-547.092) (-542.494) (-541.548) * (-544.742) [-543.404] (-543.724) (-542.539) -- 0:00:41
289500 -- (-546.622) (-547.780) (-543.908) [-541.553] * (-545.672) (-545.343) [-544.227] (-542.096) -- 0:00:41
290000 -- (-548.172) [-543.435] (-544.244) (-542.752) * (-543.490) (-544.449) (-542.557) [-546.302] -- 0:00:41
Average standard deviation of split frequencies: 0.015550
290500 -- (-547.410) (-543.775) [-544.731] (-543.228) * (-545.182) (-545.734) [-543.633] (-545.054) -- 0:00:43
291000 -- [-545.324] (-544.562) (-544.350) (-548.079) * (-542.200) (-544.319) (-543.254) [-545.159] -- 0:00:43
291500 -- (-542.175) [-543.819] (-545.072) (-542.933) * (-544.385) (-544.306) [-543.757] (-543.033) -- 0:00:43
292000 -- (-544.841) [-546.482] (-544.461) (-542.745) * (-546.757) [-544.882] (-542.213) (-543.209) -- 0:00:43
292500 -- (-550.194) (-545.774) [-543.381] (-543.147) * [-542.011] (-543.340) (-543.010) (-545.173) -- 0:00:43
293000 -- [-545.990] (-545.777) (-545.678) (-543.226) * (-543.774) [-545.485] (-543.305) (-543.064) -- 0:00:43
293500 -- [-543.897] (-544.116) (-551.345) (-544.761) * (-543.318) (-545.233) (-543.891) [-542.491] -- 0:00:43
294000 -- (-544.853) (-542.951) (-544.530) [-544.525] * (-543.241) (-543.145) (-543.597) [-542.049] -- 0:00:43
294500 -- [-541.906] (-545.442) (-544.228) (-542.542) * (-542.750) (-542.792) [-549.517] (-546.404) -- 0:00:43
295000 -- (-542.257) [-543.294] (-543.932) (-542.678) * (-545.284) (-542.848) [-543.141] (-542.069) -- 0:00:43
Average standard deviation of split frequencies: 0.015083
295500 -- (-544.887) (-545.862) [-542.620] (-544.405) * (-543.689) (-542.067) (-543.120) [-542.660] -- 0:00:42
296000 -- (-547.295) [-547.665] (-542.969) (-543.766) * (-545.560) [-543.751] (-543.163) (-542.766) -- 0:00:42
296500 -- (-548.004) (-543.489) [-542.415] (-549.832) * (-543.903) (-549.654) [-542.934] (-543.472) -- 0:00:42
297000 -- (-545.491) [-544.729] (-546.006) (-546.147) * (-542.253) (-543.169) (-548.696) [-542.725] -- 0:00:42
297500 -- (-544.056) [-545.392] (-544.183) (-543.002) * [-542.180] (-544.087) (-544.957) (-543.267) -- 0:00:42
298000 -- (-542.470) [-545.329] (-544.022) (-541.998) * [-543.023] (-542.657) (-544.871) (-543.038) -- 0:00:42
298500 -- (-544.213) [-544.395] (-546.153) (-545.650) * (-543.209) (-542.457) [-545.043] (-544.270) -- 0:00:42
299000 -- (-545.647) (-552.529) (-542.924) [-543.127] * (-544.228) [-544.666] (-543.440) (-550.220) -- 0:00:42
299500 -- (-548.202) (-546.536) (-544.337) [-542.187] * (-542.918) [-545.966] (-544.631) (-542.348) -- 0:00:42
300000 -- [-545.035] (-545.281) (-545.317) (-544.057) * (-542.512) (-545.127) (-545.927) [-543.537] -- 0:00:42
Average standard deviation of split frequencies: 0.014756
300500 -- (-542.526) (-544.611) [-544.071] (-545.215) * [-543.375] (-543.931) (-544.799) (-542.293) -- 0:00:41
301000 -- (-548.159) (-544.836) [-543.156] (-542.375) * (-542.285) [-542.010] (-543.517) (-545.576) -- 0:00:41
301500 -- (-544.590) (-544.575) (-545.438) [-546.809] * (-544.428) (-543.953) [-544.753] (-544.198) -- 0:00:41
302000 -- [-544.493] (-546.114) (-543.221) (-546.747) * [-545.100] (-543.841) (-547.399) (-544.996) -- 0:00:41
302500 -- [-543.279] (-542.618) (-545.521) (-547.947) * (-547.091) (-544.935) (-544.662) [-544.288] -- 0:00:41
303000 -- (-543.083) (-545.603) (-542.852) [-544.337] * (-545.586) (-543.955) (-545.869) [-542.986] -- 0:00:41
303500 -- (-545.592) [-544.775] (-549.561) (-544.138) * (-544.510) (-543.566) (-543.787) [-542.602] -- 0:00:41
304000 -- (-546.214) [-543.720] (-551.412) (-543.061) * (-545.213) (-545.562) [-542.587] (-542.859) -- 0:00:41
304500 -- (-542.674) (-544.581) (-551.962) [-544.810] * (-542.245) (-547.515) (-543.145) [-544.748] -- 0:00:41
305000 -- (-543.511) (-544.185) (-545.287) [-546.309] * (-541.838) [-544.892] (-543.438) (-544.453) -- 0:00:41
Average standard deviation of split frequencies: 0.013865
305500 -- (-543.053) (-542.453) [-544.508] (-544.324) * [-542.481] (-545.344) (-541.818) (-545.850) -- 0:00:40
306000 -- [-542.662] (-545.215) (-543.182) (-545.272) * (-542.414) [-545.265] (-543.753) (-547.645) -- 0:00:40
306500 -- (-542.643) [-544.243] (-542.225) (-542.480) * [-542.133] (-542.584) (-545.550) (-544.840) -- 0:00:40
307000 -- (-546.735) (-546.168) [-547.167] (-542.779) * (-544.240) [-542.207] (-544.966) (-548.319) -- 0:00:42
307500 -- [-547.981] (-543.007) (-543.976) (-542.013) * (-547.388) [-546.684] (-542.355) (-544.647) -- 0:00:42
308000 -- (-545.893) (-543.225) [-543.203] (-541.927) * (-544.220) (-546.060) (-546.117) [-546.361] -- 0:00:42
308500 -- (-545.424) [-544.027] (-543.914) (-544.666) * (-546.252) (-542.705) (-546.466) [-542.272] -- 0:00:42
309000 -- (-542.450) (-544.590) (-545.418) [-544.393] * [-544.905] (-542.894) (-542.926) (-542.206) -- 0:00:42
309500 -- (-543.277) [-544.900] (-545.914) (-543.228) * (-543.214) (-544.125) (-542.444) [-543.031] -- 0:00:42
310000 -- (-542.022) (-544.676) (-543.585) [-542.849] * (-543.345) [-542.334] (-544.339) (-548.505) -- 0:00:42
Average standard deviation of split frequencies: 0.012585
310500 -- (-545.374) (-543.362) (-543.038) [-544.454] * (-547.085) (-542.237) (-544.568) [-542.087] -- 0:00:42
311000 -- [-541.981] (-544.786) (-544.031) (-542.375) * [-543.203] (-542.609) (-541.643) (-543.608) -- 0:00:42
311500 -- [-544.392] (-550.276) (-544.387) (-541.854) * [-543.226] (-542.714) (-549.375) (-542.304) -- 0:00:41
312000 -- (-551.403) (-543.078) [-544.602] (-543.233) * (-543.517) [-547.321] (-550.144) (-543.274) -- 0:00:41
312500 -- (-544.006) (-543.844) (-546.508) [-544.033] * [-545.736] (-546.158) (-543.048) (-546.117) -- 0:00:41
313000 -- (-543.757) (-543.662) (-546.020) [-546.461] * (-543.194) (-546.452) [-543.487] (-542.971) -- 0:00:41
313500 -- (-543.087) (-544.375) (-549.192) [-542.320] * (-542.651) [-542.242] (-544.085) (-543.602) -- 0:00:41
314000 -- (-545.082) (-542.246) (-547.910) [-542.236] * (-541.633) (-545.562) [-543.006] (-543.447) -- 0:00:41
314500 -- (-545.184) (-544.004) [-544.152] (-543.990) * (-542.212) (-542.353) [-542.169] (-544.586) -- 0:00:41
315000 -- (-548.260) (-543.899) [-545.064] (-543.892) * (-541.557) [-543.694] (-546.217) (-543.787) -- 0:00:41
Average standard deviation of split frequencies: 0.013426
315500 -- (-544.874) [-546.779] (-544.243) (-543.401) * [-542.212] (-543.005) (-548.087) (-551.904) -- 0:00:41
316000 -- (-545.299) [-543.493] (-543.734) (-545.466) * (-546.818) [-543.207] (-546.365) (-546.063) -- 0:00:41
316500 -- (-544.958) [-543.771] (-543.196) (-542.361) * [-545.753] (-546.180) (-547.319) (-543.794) -- 0:00:41
317000 -- (-545.018) (-545.508) [-542.026] (-542.560) * (-545.250) [-544.625] (-542.516) (-542.330) -- 0:00:40
317500 -- (-544.901) (-544.470) [-541.983] (-547.450) * (-543.670) [-542.765] (-542.639) (-544.415) -- 0:00:40
318000 -- [-542.277] (-544.493) (-542.699) (-546.688) * [-545.205] (-545.334) (-546.292) (-542.946) -- 0:00:40
318500 -- (-544.853) [-544.254] (-543.783) (-543.652) * (-541.847) [-543.107] (-548.206) (-542.498) -- 0:00:40
319000 -- (-543.222) [-544.423] (-543.676) (-542.452) * (-544.868) [-544.392] (-554.352) (-546.733) -- 0:00:40
319500 -- (-544.186) (-544.746) [-544.159] (-544.450) * [-541.515] (-548.165) (-545.278) (-543.973) -- 0:00:40
320000 -- [-542.612] (-544.775) (-547.066) (-544.044) * (-544.525) (-545.335) (-543.403) [-542.428] -- 0:00:40
Average standard deviation of split frequencies: 0.011597
320500 -- (-543.340) [-547.047] (-543.544) (-542.352) * [-545.501] (-542.688) (-543.830) (-543.582) -- 0:00:40
321000 -- (-544.312) [-544.539] (-543.964) (-542.573) * (-544.541) [-543.567] (-544.869) (-542.715) -- 0:00:40
321500 -- [-545.620] (-545.819) (-545.171) (-545.379) * (-545.884) [-544.255] (-546.936) (-545.632) -- 0:00:40
322000 -- [-543.116] (-545.101) (-543.059) (-542.924) * (-543.960) (-544.650) [-542.244] (-541.894) -- 0:00:40
322500 -- (-544.280) [-543.952] (-543.122) (-542.674) * (-544.564) [-542.529] (-543.507) (-543.306) -- 0:00:39
323000 -- (-542.364) [-543.161] (-542.378) (-542.871) * (-543.429) (-542.529) (-543.530) [-545.371] -- 0:00:39
323500 -- [-543.118] (-544.733) (-542.832) (-542.114) * (-542.307) (-549.381) [-546.423] (-549.016) -- 0:00:39
324000 -- [-544.020] (-545.502) (-542.406) (-542.253) * (-545.089) (-545.892) (-548.223) [-543.656] -- 0:00:41
324500 -- [-543.265] (-543.325) (-543.990) (-542.320) * [-546.739] (-545.623) (-546.266) (-542.894) -- 0:00:41
325000 -- (-543.030) [-543.625] (-543.755) (-542.016) * [-542.662] (-543.137) (-544.827) (-542.300) -- 0:00:41
Average standard deviation of split frequencies: 0.011247
325500 -- (-547.448) (-546.456) [-543.092] (-545.692) * (-542.182) [-543.192] (-543.983) (-542.918) -- 0:00:41
326000 -- (-547.406) (-548.025) [-543.584] (-543.976) * (-542.036) (-544.665) [-545.088] (-546.180) -- 0:00:41
326500 -- (-549.674) (-544.456) [-541.612] (-543.076) * (-542.457) (-542.201) (-546.043) [-550.699] -- 0:00:41
327000 -- (-549.238) [-546.625] (-542.989) (-542.701) * (-543.226) (-542.870) (-544.134) [-542.141] -- 0:00:41
327500 -- (-546.569) (-543.799) (-542.627) [-542.687] * [-541.794] (-543.846) (-546.019) (-544.979) -- 0:00:41
328000 -- [-545.538] (-545.289) (-545.921) (-542.784) * (-542.700) (-543.883) [-544.575] (-544.850) -- 0:00:40
328500 -- (-545.384) (-545.915) (-547.350) [-543.035] * (-543.296) [-543.348] (-541.907) (-548.434) -- 0:00:40
329000 -- (-543.609) (-546.298) (-543.890) [-543.762] * (-541.580) (-547.434) (-544.632) [-545.978] -- 0:00:40
329500 -- (-546.900) [-543.896] (-545.390) (-542.676) * (-543.869) (-544.182) (-547.055) [-543.844] -- 0:00:40
330000 -- (-546.605) (-543.674) (-543.856) [-544.067] * [-542.878] (-542.878) (-545.610) (-544.636) -- 0:00:40
Average standard deviation of split frequencies: 0.010986
330500 -- [-548.085] (-544.144) (-542.371) (-542.542) * (-543.272) (-546.045) [-543.732] (-543.545) -- 0:00:40
331000 -- (-549.013) (-545.453) (-542.835) [-544.858] * [-541.842] (-544.151) (-542.111) (-542.778) -- 0:00:40
331500 -- (-543.294) (-544.075) (-545.829) [-544.535] * (-544.386) (-546.198) [-543.755] (-545.374) -- 0:00:40
332000 -- [-542.840] (-546.965) (-546.082) (-542.935) * (-547.379) [-543.705] (-542.014) (-543.375) -- 0:00:40
332500 -- [-542.646] (-542.777) (-545.909) (-543.525) * (-544.411) (-545.070) (-544.218) [-543.231] -- 0:00:40
333000 -- (-547.554) (-542.560) [-543.675] (-543.117) * (-543.992) (-542.717) [-543.865] (-541.956) -- 0:00:40
333500 -- (-550.891) (-543.277) [-543.122] (-542.596) * (-542.920) (-544.819) [-548.013] (-542.130) -- 0:00:39
334000 -- (-543.415) (-543.697) [-547.789] (-542.574) * (-542.540) (-543.170) [-543.851] (-541.932) -- 0:00:39
334500 -- (-547.869) (-548.163) (-547.286) [-546.993] * (-548.777) [-543.334] (-544.476) (-545.560) -- 0:00:39
335000 -- (-544.926) (-543.466) [-546.264] (-547.126) * [-543.567] (-544.679) (-543.750) (-543.516) -- 0:00:39
Average standard deviation of split frequencies: 0.010084
335500 -- (-543.444) (-543.582) [-543.306] (-547.675) * [-543.782] (-543.995) (-549.012) (-548.694) -- 0:00:39
336000 -- [-542.628] (-543.666) (-543.859) (-544.871) * (-544.536) (-542.184) (-546.440) [-543.559] -- 0:00:39
336500 -- (-543.388) (-543.678) [-545.371] (-546.806) * (-543.227) [-544.693] (-548.226) (-542.631) -- 0:00:39
337000 -- [-546.680] (-548.541) (-544.347) (-542.887) * (-547.368) [-543.154] (-543.992) (-543.386) -- 0:00:39
337500 -- (-546.987) (-549.998) (-543.871) [-543.108] * [-544.542] (-543.702) (-543.267) (-543.117) -- 0:00:39
338000 -- (-542.567) (-544.917) [-546.202] (-542.414) * [-543.137] (-544.491) (-543.279) (-542.075) -- 0:00:39
338500 -- (-543.331) (-542.546) [-543.168] (-545.922) * (-546.213) [-544.734] (-554.332) (-542.094) -- 0:00:39
339000 -- (-543.482) [-543.811] (-544.698) (-544.053) * (-542.328) [-545.637] (-543.386) (-542.835) -- 0:00:38
339500 -- [-546.141] (-544.562) (-544.567) (-543.266) * (-544.192) [-546.856] (-543.384) (-544.167) -- 0:00:38
340000 -- [-543.797] (-544.306) (-543.172) (-543.362) * [-543.512] (-542.871) (-543.537) (-542.628) -- 0:00:38
Average standard deviation of split frequencies: 0.011477
340500 -- (-542.524) (-542.410) [-543.497] (-542.054) * (-544.201) (-543.688) (-545.117) [-546.078] -- 0:00:38
341000 -- [-545.435] (-542.111) (-543.525) (-542.021) * (-545.246) [-542.569] (-542.811) (-542.560) -- 0:00:40
341500 -- (-544.575) (-545.961) [-542.827] (-548.320) * (-554.180) (-545.040) (-545.475) [-542.553] -- 0:00:40
342000 -- (-546.217) (-547.356) [-543.810] (-544.289) * (-543.260) [-545.896] (-543.497) (-542.216) -- 0:00:40
342500 -- (-541.961) [-543.072] (-542.659) (-544.617) * [-545.961] (-546.238) (-542.925) (-542.717) -- 0:00:40
343000 -- (-544.972) [-542.913] (-542.579) (-545.058) * (-542.797) [-543.784] (-543.341) (-548.111) -- 0:00:40
343500 -- (-541.797) [-542.772] (-544.480) (-543.193) * [-543.075] (-544.472) (-542.997) (-542.075) -- 0:00:40
344000 -- (-544.804) (-544.768) (-541.973) [-542.372] * [-542.624] (-545.614) (-545.537) (-545.156) -- 0:00:40
344500 -- (-543.078) (-547.372) (-543.173) [-543.756] * (-544.401) (-542.846) (-541.960) [-545.966] -- 0:00:39
345000 -- (-542.521) [-543.682] (-549.098) (-549.313) * (-542.920) [-543.314] (-543.629) (-545.923) -- 0:00:39
Average standard deviation of split frequencies: 0.010900
345500 -- [-542.461] (-543.904) (-548.279) (-544.771) * (-545.537) (-544.222) (-547.955) [-542.886] -- 0:00:39
346000 -- (-544.640) [-543.922] (-548.992) (-543.392) * (-543.790) (-542.489) (-546.082) [-542.697] -- 0:00:39
346500 -- [-543.235] (-543.254) (-542.651) (-543.894) * (-550.879) [-543.254] (-542.956) (-545.683) -- 0:00:39
347000 -- (-542.726) (-543.094) [-543.813] (-543.001) * (-546.252) (-545.190) [-542.302] (-545.599) -- 0:00:39
347500 -- [-542.452] (-543.052) (-543.678) (-546.338) * (-544.899) [-546.315] (-542.553) (-549.017) -- 0:00:39
348000 -- (-542.683) (-543.672) (-546.223) [-545.842] * (-543.727) [-543.110] (-547.165) (-550.335) -- 0:00:39
348500 -- (-542.735) (-549.201) [-543.421] (-544.346) * (-544.054) [-542.936] (-543.349) (-545.562) -- 0:00:39
349000 -- [-545.970] (-547.611) (-544.798) (-553.789) * (-544.361) [-544.265] (-543.418) (-544.859) -- 0:00:39
349500 -- (-547.795) (-545.352) [-546.548] (-542.947) * (-544.162) (-546.257) [-544.018] (-543.227) -- 0:00:39
350000 -- (-544.822) (-541.943) (-544.366) [-542.499] * (-546.728) [-546.672] (-546.209) (-542.817) -- 0:00:39
Average standard deviation of split frequencies: 0.011308
350500 -- (-544.698) [-543.093] (-543.927) (-542.818) * (-547.501) (-544.362) [-546.339] (-543.694) -- 0:00:38
351000 -- (-542.612) (-543.123) (-543.989) [-542.913] * (-544.528) (-549.755) (-544.950) [-544.259] -- 0:00:38
351500 -- [-542.126] (-545.186) (-542.163) (-543.425) * (-542.204) (-546.380) (-543.808) [-542.745] -- 0:00:38
352000 -- (-546.331) (-545.721) [-544.326] (-544.010) * (-546.057) (-542.766) (-543.924) [-544.084] -- 0:00:38
352500 -- (-548.102) [-547.035] (-545.599) (-546.342) * [-546.020] (-543.504) (-543.516) (-545.126) -- 0:00:38
353000 -- [-542.483] (-542.677) (-545.320) (-543.235) * (-542.908) (-548.574) (-543.967) [-544.491] -- 0:00:38
353500 -- (-542.904) (-542.374) [-545.076] (-545.387) * [-542.783] (-547.343) (-544.807) (-547.563) -- 0:00:38
354000 -- [-543.117] (-547.085) (-548.610) (-543.879) * (-542.726) (-545.470) (-544.740) [-544.262] -- 0:00:38
354500 -- [-544.123] (-546.215) (-543.245) (-549.461) * [-542.403] (-543.425) (-542.330) (-546.562) -- 0:00:38
355000 -- (-546.282) [-542.747] (-542.628) (-543.471) * (-544.046) (-541.561) (-543.957) [-544.246] -- 0:00:38
Average standard deviation of split frequencies: 0.011216
355500 -- (-543.620) [-541.891] (-544.000) (-546.158) * (-543.887) [-544.480] (-546.478) (-546.032) -- 0:00:38
356000 -- (-545.592) (-543.362) [-545.674] (-546.854) * (-547.114) (-544.519) (-544.479) [-544.384] -- 0:00:37
356500 -- (-542.346) (-544.883) [-542.977] (-545.673) * (-547.494) (-545.287) (-542.341) [-544.064] -- 0:00:37
357000 -- [-543.511] (-544.965) (-545.680) (-543.684) * [-545.023] (-545.562) (-543.869) (-542.346) -- 0:00:37
357500 -- (-545.478) (-542.824) [-544.508] (-545.495) * [-544.716] (-545.650) (-546.912) (-542.564) -- 0:00:39
358000 -- (-544.334) (-546.167) (-544.225) [-545.031] * [-543.405] (-542.315) (-548.489) (-542.989) -- 0:00:39
358500 -- (-543.742) (-546.998) (-544.464) [-545.315] * (-543.552) [-542.274] (-544.933) (-544.506) -- 0:00:39
359000 -- (-543.633) (-543.120) (-546.597) [-542.930] * (-543.118) (-542.130) (-543.319) [-543.093] -- 0:00:39
359500 -- (-542.727) (-543.184) [-545.613] (-541.889) * (-549.720) [-543.849] (-544.459) (-542.455) -- 0:00:39
360000 -- (-543.242) (-545.153) [-542.287] (-543.216) * (-549.221) [-544.642] (-542.403) (-542.881) -- 0:00:39
Average standard deviation of split frequencies: 0.010610
360500 -- [-545.715] (-542.581) (-546.825) (-542.089) * [-548.960] (-544.293) (-544.438) (-544.306) -- 0:00:39
361000 -- (-544.509) (-545.334) (-544.216) [-542.639] * (-546.378) (-544.448) [-544.252] (-543.779) -- 0:00:38
361500 -- (-544.168) (-543.111) (-546.159) [-545.998] * (-548.600) (-544.277) (-545.685) [-544.587] -- 0:00:38
362000 -- (-543.058) (-542.892) [-544.310] (-544.454) * (-546.445) (-542.654) [-543.883] (-543.071) -- 0:00:38
362500 -- (-543.528) [-542.696] (-546.083) (-545.417) * (-544.764) (-543.774) [-542.631] (-545.365) -- 0:00:38
363000 -- (-543.442) (-543.298) (-544.116) [-543.579] * (-544.119) (-544.670) [-543.633] (-544.034) -- 0:00:38
363500 -- (-544.470) [-542.328] (-547.399) (-544.635) * [-542.714] (-548.170) (-545.944) (-547.963) -- 0:00:38
364000 -- (-542.999) (-543.720) [-544.545] (-544.128) * (-543.055) (-547.839) (-545.152) [-548.045] -- 0:00:38
364500 -- (-542.453) (-543.382) [-544.680] (-543.516) * (-550.220) (-543.719) [-543.400] (-543.776) -- 0:00:38
365000 -- (-542.714) [-543.012] (-545.545) (-542.136) * (-543.732) (-545.037) (-544.003) [-542.902] -- 0:00:38
Average standard deviation of split frequencies: 0.010304
365500 -- [-543.285] (-542.567) (-544.188) (-542.679) * [-545.948] (-543.919) (-546.185) (-544.472) -- 0:00:38
366000 -- (-543.295) (-543.281) [-544.841] (-544.579) * (-542.762) [-543.442] (-543.629) (-542.469) -- 0:00:38
366500 -- (-543.609) [-545.326] (-543.016) (-545.197) * [-544.844] (-544.955) (-542.259) (-544.838) -- 0:00:38
367000 -- (-542.007) (-543.099) [-542.272] (-542.450) * (-542.348) (-545.282) [-544.004] (-544.027) -- 0:00:37
367500 -- (-543.954) (-544.043) [-543.273] (-544.227) * (-544.146) (-545.621) [-545.253] (-546.073) -- 0:00:37
368000 -- [-544.272] (-547.707) (-547.484) (-545.986) * (-547.565) (-545.494) [-542.487] (-544.879) -- 0:00:37
368500 -- (-543.328) [-542.697] (-549.598) (-542.790) * [-544.644] (-542.929) (-541.912) (-545.408) -- 0:00:37
369000 -- (-541.891) (-543.391) (-543.549) [-542.146] * (-545.106) [-542.808] (-542.588) (-542.926) -- 0:00:37
369500 -- [-541.857] (-543.944) (-543.897) (-541.840) * (-543.187) (-543.042) (-542.644) [-544.591] -- 0:00:37
370000 -- (-545.310) [-544.496] (-544.427) (-545.228) * [-542.014] (-542.030) (-542.335) (-543.186) -- 0:00:37
Average standard deviation of split frequencies: 0.010773
370500 -- (-546.815) [-542.691] (-549.244) (-544.155) * (-543.217) [-546.656] (-544.066) (-542.639) -- 0:00:37
371000 -- (-542.077) (-542.654) (-546.527) [-542.429] * (-545.349) (-543.201) (-547.110) [-543.275] -- 0:00:37
371500 -- (-542.295) (-542.370) [-544.864] (-541.671) * [-543.401] (-543.152) (-545.860) (-542.919) -- 0:00:37
372000 -- (-544.644) [-545.726] (-544.199) (-547.474) * (-546.218) (-544.402) (-543.502) [-544.650] -- 0:00:37
372500 -- (-543.744) (-544.130) [-544.307] (-543.662) * [-544.612] (-542.245) (-542.155) (-543.561) -- 0:00:37
373000 -- (-547.919) [-545.604] (-543.397) (-544.689) * [-545.277] (-545.087) (-542.474) (-542.590) -- 0:00:36
373500 -- (-544.372) (-546.134) [-543.690] (-546.420) * (-547.838) (-543.414) (-543.614) [-542.587] -- 0:00:36
374000 -- (-542.039) (-546.349) (-543.361) [-549.573] * (-545.627) (-541.877) [-545.868] (-542.352) -- 0:00:38
374500 -- [-543.368] (-543.892) (-544.798) (-542.696) * (-543.690) (-544.861) [-543.461] (-544.391) -- 0:00:38
375000 -- (-543.547) (-544.776) (-547.778) [-543.829] * (-543.394) (-544.006) [-542.415] (-543.526) -- 0:00:38
Average standard deviation of split frequencies: 0.010108
375500 -- [-542.683] (-549.160) (-542.595) (-543.465) * (-551.879) (-546.168) [-544.743] (-548.976) -- 0:00:38
376000 -- (-547.601) (-547.228) [-542.147] (-544.841) * [-548.129] (-545.103) (-543.677) (-544.296) -- 0:00:38
376500 -- (-544.005) (-546.015) [-543.563] (-544.994) * (-546.578) [-548.686] (-545.360) (-542.956) -- 0:00:38
377000 -- [-541.987] (-543.318) (-543.500) (-542.307) * (-547.104) [-544.824] (-542.892) (-543.675) -- 0:00:38
377500 -- (-543.510) [-543.020] (-542.922) (-543.228) * [-552.174] (-542.212) (-543.639) (-542.132) -- 0:00:37
378000 -- [-542.481] (-542.407) (-542.120) (-543.963) * [-548.380] (-543.811) (-544.652) (-543.041) -- 0:00:37
378500 -- (-544.281) [-541.750] (-542.425) (-543.805) * (-550.217) (-548.357) (-544.688) [-542.661] -- 0:00:37
379000 -- (-546.171) [-543.716] (-542.541) (-543.269) * (-542.595) [-544.843] (-542.593) (-543.948) -- 0:00:37
379500 -- (-542.344) (-542.433) [-542.683] (-541.645) * (-544.509) (-542.670) [-545.611] (-542.575) -- 0:00:37
380000 -- (-544.317) (-542.507) (-545.460) [-542.381] * (-542.972) (-542.094) (-548.013) [-543.174] -- 0:00:37
Average standard deviation of split frequencies: 0.008901
380500 -- (-544.523) (-544.701) [-544.999] (-545.299) * (-543.951) (-544.892) [-547.584] (-543.629) -- 0:00:37
381000 -- (-543.782) (-550.834) [-542.425] (-542.795) * (-545.288) (-545.252) (-542.753) [-541.758] -- 0:00:37
381500 -- (-543.164) [-542.817] (-542.760) (-543.196) * (-546.621) (-546.140) [-542.623] (-542.566) -- 0:00:37
382000 -- [-542.495] (-543.976) (-541.869) (-543.267) * [-545.249] (-542.841) (-548.972) (-548.487) -- 0:00:37
382500 -- [-542.954] (-543.252) (-544.196) (-547.929) * (-546.906) [-542.726] (-543.702) (-543.437) -- 0:00:37
383000 -- (-544.048) (-542.900) [-543.720] (-546.678) * (-546.463) (-544.241) [-544.827] (-542.746) -- 0:00:37
383500 -- (-544.347) (-542.001) (-548.239) [-543.418] * [-542.902] (-544.032) (-543.090) (-543.205) -- 0:00:36
384000 -- (-542.706) (-542.586) [-542.539] (-542.798) * (-542.276) (-542.636) [-542.869] (-543.415) -- 0:00:36
384500 -- [-544.673] (-543.397) (-547.179) (-541.719) * (-542.633) [-543.866] (-545.796) (-542.805) -- 0:00:36
385000 -- (-544.590) (-544.862) [-543.136] (-541.817) * (-544.956) (-542.591) [-545.446] (-545.483) -- 0:00:36
Average standard deviation of split frequencies: 0.008320
385500 -- (-544.922) [-541.684] (-544.715) (-543.088) * (-548.413) (-542.830) [-542.555] (-545.629) -- 0:00:36
386000 -- [-543.175] (-543.204) (-543.713) (-542.870) * (-547.106) [-542.982] (-543.318) (-545.051) -- 0:00:36
386500 -- (-544.201) [-542.860] (-542.992) (-544.304) * (-543.140) (-542.159) (-544.361) [-546.154] -- 0:00:36
387000 -- (-543.920) (-547.105) [-543.481] (-542.392) * (-543.140) (-542.766) (-542.749) [-542.983] -- 0:00:36
387500 -- (-544.597) (-545.562) [-544.034] (-544.330) * (-543.282) [-543.421] (-544.050) (-543.227) -- 0:00:36
388000 -- (-542.737) (-542.892) [-542.771] (-542.581) * (-544.816) [-543.846] (-542.759) (-545.301) -- 0:00:36
388500 -- (-547.999) (-542.009) [-543.358] (-543.243) * (-548.413) (-546.324) (-541.800) [-543.248] -- 0:00:36
389000 -- (-543.798) [-542.185] (-546.486) (-543.983) * (-546.200) [-544.199] (-544.046) (-545.604) -- 0:00:36
389500 -- [-542.761] (-543.839) (-554.557) (-544.087) * (-548.618) (-545.756) [-543.217] (-543.794) -- 0:00:36
390000 -- (-544.022) [-543.069] (-543.203) (-543.011) * (-542.283) (-543.097) (-543.770) [-546.253] -- 0:00:35
Average standard deviation of split frequencies: 0.008371
390500 -- (-545.543) (-546.971) (-542.252) [-545.531] * [-542.447] (-544.796) (-545.304) (-545.271) -- 0:00:37
391000 -- (-545.772) [-546.396] (-543.281) (-543.499) * (-547.278) (-543.368) [-543.881] (-545.709) -- 0:00:37
391500 -- (-545.381) [-544.651] (-543.603) (-547.356) * (-546.292) [-544.368] (-542.672) (-544.007) -- 0:00:37
392000 -- (-544.804) [-543.767] (-548.988) (-549.561) * (-544.044) [-541.864] (-550.018) (-546.238) -- 0:00:37
392500 -- [-543.340] (-543.908) (-542.590) (-543.743) * [-542.806] (-547.463) (-545.786) (-545.003) -- 0:00:37
393000 -- (-546.192) (-543.920) [-543.031] (-543.960) * (-545.229) [-547.780] (-541.581) (-545.670) -- 0:00:37
393500 -- (-547.809) (-542.215) [-542.150] (-543.071) * (-545.199) (-543.696) [-543.061] (-544.065) -- 0:00:36
394000 -- [-543.275] (-544.981) (-544.296) (-545.728) * (-546.410) [-543.572] (-543.620) (-546.108) -- 0:00:36
394500 -- (-542.999) (-545.435) (-547.179) [-544.956] * [-543.864] (-542.875) (-543.435) (-543.839) -- 0:00:36
395000 -- (-543.893) (-544.406) (-546.503) [-543.525] * (-544.438) (-542.335) (-543.906) [-543.274] -- 0:00:36
Average standard deviation of split frequencies: 0.007663
395500 -- (-543.955) (-545.718) (-543.864) [-544.067] * [-545.338] (-541.912) (-543.906) (-547.263) -- 0:00:36
396000 -- [-544.481] (-542.730) (-543.745) (-542.385) * [-543.801] (-541.782) (-543.241) (-546.965) -- 0:00:36
396500 -- (-545.243) [-543.570] (-544.464) (-543.387) * (-545.216) (-542.434) (-543.547) [-542.283] -- 0:00:36
397000 -- (-545.976) (-542.294) (-546.189) [-541.934] * (-543.758) (-542.649) (-544.009) [-541.711] -- 0:00:36
397500 -- [-546.421] (-543.065) (-549.220) (-542.040) * (-546.116) (-542.199) [-544.348] (-544.843) -- 0:00:36
398000 -- (-542.714) (-543.031) [-544.096] (-543.015) * (-545.619) (-542.919) (-546.513) [-542.214] -- 0:00:36
398500 -- (-541.767) (-543.649) [-543.626] (-542.072) * (-542.491) (-544.753) [-544.577] (-544.274) -- 0:00:36
399000 -- (-545.121) (-545.211) [-546.000] (-542.860) * (-545.942) (-545.126) [-544.077] (-544.184) -- 0:00:36
399500 -- (-543.281) (-544.100) (-542.146) [-541.837] * (-543.583) (-545.361) [-543.893] (-546.415) -- 0:00:36
400000 -- (-542.259) [-544.289] (-544.903) (-543.327) * (-546.194) [-543.412] (-542.772) (-542.904) -- 0:00:36
Average standard deviation of split frequencies: 0.008530
400500 -- (-542.161) (-544.393) (-549.518) [-542.443] * (-543.272) [-545.084] (-545.093) (-543.677) -- 0:00:35
401000 -- [-544.784] (-546.075) (-546.674) (-546.861) * (-543.796) (-542.714) [-542.977] (-547.205) -- 0:00:35
401500 -- [-545.109] (-543.766) (-545.276) (-544.893) * (-547.350) (-543.358) (-544.858) [-544.040] -- 0:00:35
402000 -- (-542.255) [-542.724] (-545.856) (-543.446) * [-544.197] (-543.545) (-545.072) (-544.889) -- 0:00:35
402500 -- (-542.041) (-542.027) (-544.144) [-545.599] * (-543.357) (-544.091) [-542.254] (-545.024) -- 0:00:35
403000 -- (-543.377) (-543.956) [-542.844] (-551.884) * (-544.759) (-549.396) (-541.909) [-545.380] -- 0:00:35
403500 -- (-542.554) (-549.556) (-542.691) [-543.969] * (-544.185) (-546.045) [-542.050] (-547.651) -- 0:00:35
404000 -- (-543.108) (-543.739) (-543.475) [-544.628] * (-543.014) (-542.921) (-542.300) [-545.378] -- 0:00:35
404500 -- (-542.927) (-546.154) (-544.465) [-542.595] * (-542.675) (-541.869) (-541.828) [-543.250] -- 0:00:35
405000 -- [-542.905] (-544.407) (-545.777) (-546.024) * (-544.495) (-542.060) (-542.307) [-542.726] -- 0:00:35
Average standard deviation of split frequencies: 0.007718
405500 -- (-545.392) (-545.196) (-543.207) [-543.368] * [-543.407] (-544.547) (-543.768) (-543.540) -- 0:00:35
406000 -- (-545.473) (-546.502) [-543.109] (-542.740) * (-542.987) (-545.981) [-542.191] (-545.333) -- 0:00:35
406500 -- (-544.736) (-545.239) (-543.091) [-542.255] * [-542.371] (-549.742) (-541.956) (-545.603) -- 0:00:35
407000 -- (-543.677) [-543.331] (-543.132) (-543.219) * (-542.616) (-545.596) [-542.847] (-544.345) -- 0:00:36
407500 -- [-542.972] (-543.003) (-544.610) (-542.622) * (-543.443) [-543.338] (-544.194) (-543.749) -- 0:00:36
408000 -- (-542.637) (-542.574) [-546.558] (-542.797) * (-542.800) (-542.553) (-543.667) [-546.962] -- 0:00:36
408500 -- (-547.012) [-542.820] (-546.443) (-543.813) * (-544.670) [-547.755] (-544.016) (-546.363) -- 0:00:36
409000 -- (-543.897) [-543.071] (-546.020) (-545.907) * (-542.133) [-543.488] (-542.417) (-543.568) -- 0:00:36
409500 -- [-544.596] (-543.412) (-545.397) (-543.499) * (-542.624) (-543.672) [-546.988] (-545.801) -- 0:00:36
410000 -- (-544.163) (-545.298) [-544.203] (-543.052) * [-543.154] (-547.614) (-545.380) (-543.721) -- 0:00:35
Average standard deviation of split frequencies: 0.007900
410500 -- (-544.597) (-545.915) (-543.096) [-542.809] * (-543.503) [-543.891] (-544.957) (-543.608) -- 0:00:35
411000 -- [-543.064] (-546.864) (-547.646) (-544.409) * (-543.984) [-542.843] (-543.748) (-545.948) -- 0:00:35
411500 -- [-546.784] (-546.264) (-542.306) (-546.763) * (-547.245) [-542.554] (-544.916) (-543.284) -- 0:00:35
412000 -- [-543.795] (-545.120) (-545.011) (-542.848) * (-544.700) (-542.059) [-543.338] (-546.367) -- 0:00:35
412500 -- [-543.977] (-545.122) (-549.857) (-542.738) * (-544.660) (-546.247) (-546.060) [-541.866] -- 0:00:35
413000 -- (-544.935) (-542.723) (-542.684) [-541.860] * (-546.453) (-544.590) [-545.691] (-544.701) -- 0:00:35
413500 -- (-544.642) (-542.620) [-542.684] (-546.599) * (-543.438) [-543.155] (-546.471) (-542.685) -- 0:00:35
414000 -- [-543.364] (-544.248) (-544.609) (-543.572) * (-543.269) (-546.088) [-543.607] (-544.582) -- 0:00:35
414500 -- [-544.394] (-547.813) (-543.644) (-544.777) * [-546.887] (-542.883) (-544.970) (-542.429) -- 0:00:35
415000 -- (-546.499) (-546.245) [-545.165] (-545.581) * (-545.535) (-546.308) (-545.077) [-541.830] -- 0:00:35
Average standard deviation of split frequencies: 0.007295
415500 -- (-544.494) (-541.861) (-543.990) [-542.407] * [-544.268] (-545.412) (-547.075) (-544.490) -- 0:00:35
416000 -- (-544.367) [-542.036] (-542.678) (-542.237) * [-544.749] (-545.847) (-545.989) (-542.836) -- 0:00:35
416500 -- (-550.252) (-543.700) [-542.940] (-542.744) * (-546.813) (-544.493) [-543.827] (-545.074) -- 0:00:35
417000 -- (-545.475) (-543.275) [-542.145] (-545.798) * [-542.619] (-553.550) (-544.249) (-544.653) -- 0:00:34
417500 -- (-545.519) (-545.377) (-542.755) [-544.939] * (-545.662) [-546.670] (-545.778) (-543.487) -- 0:00:34
418000 -- (-542.499) (-547.395) [-543.578] (-543.119) * (-543.311) (-542.449) [-543.759] (-544.571) -- 0:00:34
418500 -- (-543.403) (-548.810) (-542.074) [-545.715] * (-546.240) (-543.701) (-545.723) [-541.766] -- 0:00:34
419000 -- (-546.513) (-543.773) [-542.499] (-550.294) * [-544.452] (-543.444) (-544.141) (-543.551) -- 0:00:34
419500 -- [-544.369] (-542.159) (-542.076) (-546.080) * [-543.506] (-542.781) (-545.065) (-548.289) -- 0:00:34
420000 -- [-543.952] (-542.572) (-542.546) (-543.190) * (-544.694) (-544.891) [-543.696] (-544.102) -- 0:00:34
Average standard deviation of split frequencies: 0.007620
420500 -- (-548.852) (-544.174) [-543.077] (-543.281) * (-544.747) (-543.530) (-544.183) [-545.581] -- 0:00:34
421000 -- (-547.154) (-546.485) (-544.038) [-543.181] * (-543.161) (-545.539) [-546.356] (-544.096) -- 0:00:34
421500 -- (-542.930) (-546.007) [-543.889] (-546.350) * (-546.410) (-542.090) [-543.285] (-542.892) -- 0:00:34
422000 -- (-547.996) (-547.144) (-541.823) [-544.990] * (-543.097) (-546.335) [-545.363] (-544.797) -- 0:00:34
422500 -- (-546.054) (-545.429) (-543.526) [-544.801] * [-545.502] (-543.287) (-545.701) (-542.709) -- 0:00:34
423000 -- [-543.444] (-544.444) (-543.568) (-545.225) * (-545.370) (-542.088) (-543.476) [-545.119] -- 0:00:34
423500 -- (-544.100) (-543.498) [-545.689] (-543.051) * (-542.124) [-545.866] (-546.419) (-544.853) -- 0:00:34
424000 -- [-543.488] (-542.536) (-542.725) (-543.025) * [-542.883] (-543.222) (-542.222) (-543.794) -- 0:00:35
424500 -- [-544.240] (-545.703) (-542.647) (-550.787) * [-544.764] (-546.834) (-544.012) (-542.383) -- 0:00:35
425000 -- (-544.237) (-542.930) [-543.648] (-548.947) * (-545.615) [-543.552] (-545.093) (-545.237) -- 0:00:35
Average standard deviation of split frequencies: 0.007746
425500 -- (-543.799) (-543.507) (-542.879) [-543.346] * (-546.848) [-544.008] (-542.316) (-547.084) -- 0:00:35
426000 -- (-543.264) (-544.395) (-543.138) [-541.983] * (-546.636) [-544.215] (-542.413) (-545.316) -- 0:00:35
426500 -- (-548.426) (-544.580) (-544.384) [-544.689] * [-544.368] (-544.171) (-546.825) (-545.597) -- 0:00:34
427000 -- [-542.703] (-542.325) (-542.682) (-544.884) * (-543.229) (-544.102) (-553.207) [-546.830] -- 0:00:34
427500 -- (-546.019) (-543.948) (-543.717) [-543.705] * [-543.283] (-543.074) (-542.261) (-542.431) -- 0:00:34
428000 -- (-545.829) [-542.924] (-546.787) (-544.297) * (-542.290) (-543.004) [-543.135] (-542.317) -- 0:00:34
428500 -- (-542.510) [-542.755] (-545.227) (-544.498) * (-542.083) (-543.149) (-542.790) [-541.882] -- 0:00:34
429000 -- (-543.071) [-547.886] (-543.908) (-543.025) * [-542.477] (-543.802) (-545.586) (-547.640) -- 0:00:34
429500 -- [-542.519] (-543.342) (-544.615) (-543.272) * (-546.436) [-542.201] (-545.845) (-546.111) -- 0:00:34
430000 -- (-541.888) [-541.733] (-546.305) (-549.368) * [-543.437] (-546.336) (-543.408) (-544.994) -- 0:00:34
Average standard deviation of split frequencies: 0.008757
430500 -- (-542.462) (-545.928) (-545.190) [-551.464] * (-544.040) (-544.572) [-544.007] (-544.518) -- 0:00:34
431000 -- (-542.305) (-542.445) (-542.909) [-544.562] * (-544.438) [-545.077] (-544.350) (-547.816) -- 0:00:34
431500 -- (-545.538) [-543.259] (-543.648) (-542.420) * (-542.021) (-542.725) [-546.692] (-545.988) -- 0:00:34
432000 -- (-549.205) (-543.072) [-542.544] (-542.584) * [-544.489] (-544.241) (-549.801) (-543.540) -- 0:00:34
432500 -- [-544.479] (-542.088) (-543.226) (-546.177) * (-548.661) (-547.101) (-546.474) [-545.491] -- 0:00:34
433000 -- (-543.347) (-543.066) [-544.934] (-544.066) * (-546.366) (-546.383) [-547.514] (-545.950) -- 0:00:34
433500 -- (-543.970) (-544.956) (-542.408) [-543.931] * [-543.407] (-548.218) (-545.727) (-542.766) -- 0:00:33
434000 -- [-542.333] (-545.075) (-543.835) (-545.552) * (-543.116) (-543.702) [-542.592] (-543.739) -- 0:00:33
434500 -- (-543.554) [-542.885] (-544.226) (-545.874) * [-545.887] (-543.811) (-544.182) (-543.050) -- 0:00:33
435000 -- (-543.714) (-542.423) [-544.625] (-545.503) * (-542.954) (-544.403) (-545.880) [-543.585] -- 0:00:33
Average standard deviation of split frequencies: 0.008904
435500 -- [-543.639] (-542.604) (-545.618) (-546.792) * (-542.401) [-542.074] (-543.872) (-542.227) -- 0:00:33
436000 -- (-545.798) (-542.663) [-542.490] (-546.387) * (-545.538) (-549.160) (-544.789) [-546.229] -- 0:00:33
436500 -- [-548.735] (-541.897) (-543.290) (-544.706) * (-542.826) (-541.976) (-544.829) [-546.927] -- 0:00:33
437000 -- (-546.582) (-541.976) [-541.750] (-541.880) * (-546.190) (-542.685) (-544.129) [-544.222] -- 0:00:33
437500 -- (-544.402) (-543.067) [-542.425] (-544.760) * (-541.882) (-545.428) (-543.266) [-543.210] -- 0:00:33
438000 -- (-543.467) (-542.526) [-542.851] (-542.527) * (-544.218) (-544.803) [-542.536] (-542.401) -- 0:00:33
438500 -- (-545.531) (-544.963) (-542.995) [-542.480] * (-541.924) (-544.341) [-543.786] (-543.680) -- 0:00:33
439000 -- (-543.945) (-544.746) (-543.132) [-543.131] * (-544.757) (-544.286) (-543.246) [-545.168] -- 0:00:33
439500 -- (-542.471) (-543.575) (-544.951) [-542.667] * (-544.569) (-543.533) (-551.274) [-545.974] -- 0:00:33
440000 -- (-543.108) (-546.695) (-541.986) [-542.054] * [-543.197] (-544.449) (-545.076) (-542.792) -- 0:00:33
Average standard deviation of split frequencies: 0.009817
440500 -- [-543.293] (-544.068) (-543.697) (-543.944) * (-544.966) (-543.291) (-546.294) [-542.371] -- 0:00:34
441000 -- (-542.372) (-543.471) (-544.859) [-542.698] * (-547.554) (-542.551) [-544.211] (-541.992) -- 0:00:34
441500 -- [-544.107] (-543.965) (-542.425) (-541.906) * (-546.695) (-544.127) (-544.284) [-542.729] -- 0:00:34
442000 -- (-544.262) (-542.306) (-542.743) [-542.826] * (-544.109) [-542.908] (-546.112) (-544.353) -- 0:00:34
442500 -- (-543.831) (-544.357) (-545.831) [-542.548] * [-543.077] (-546.140) (-544.190) (-547.338) -- 0:00:34
443000 -- (-546.182) [-546.221] (-543.508) (-543.658) * (-545.774) (-542.195) [-542.848] (-546.401) -- 0:00:33
443500 -- (-541.935) (-543.816) [-542.413] (-546.001) * (-544.535) [-541.856] (-544.870) (-545.191) -- 0:00:33
444000 -- (-545.047) (-544.597) (-543.009) [-543.522] * [-543.527] (-542.070) (-546.949) (-546.911) -- 0:00:33
444500 -- (-542.637) (-544.471) [-543.936] (-541.982) * (-542.144) (-545.185) (-548.572) [-544.267] -- 0:00:33
445000 -- (-541.707) (-542.861) (-547.115) [-543.623] * (-549.475) (-542.449) [-543.834] (-546.393) -- 0:00:33
Average standard deviation of split frequencies: 0.009824
445500 -- (-543.021) [-543.489] (-546.482) (-542.613) * (-543.315) (-544.634) [-542.118] (-543.546) -- 0:00:33
446000 -- (-543.149) (-544.304) [-542.867] (-541.879) * (-542.256) [-542.972] (-542.650) (-543.250) -- 0:00:33
446500 -- (-543.654) (-545.857) [-542.389] (-542.043) * (-545.371) (-545.081) [-544.543] (-541.705) -- 0:00:33
447000 -- (-543.567) (-546.977) [-545.429] (-545.134) * (-542.689) (-544.421) (-550.358) [-543.148] -- 0:00:33
447500 -- [-542.760] (-542.889) (-543.355) (-545.273) * (-543.438) [-543.144] (-544.664) (-548.627) -- 0:00:33
448000 -- (-543.761) [-544.449] (-543.107) (-545.333) * [-545.467] (-542.671) (-543.971) (-545.689) -- 0:00:33
448500 -- [-544.338] (-544.582) (-546.502) (-546.783) * (-543.908) (-543.139) (-543.536) [-543.770] -- 0:00:33
449000 -- (-542.904) [-543.727] (-544.644) (-543.362) * (-542.922) (-545.747) (-546.523) [-543.310] -- 0:00:33
449500 -- (-543.752) (-543.607) [-544.663] (-542.530) * (-545.438) [-544.129] (-544.619) (-545.399) -- 0:00:33
450000 -- (-547.433) (-542.194) (-543.402) [-543.884] * (-544.305) [-542.622] (-542.158) (-544.977) -- 0:00:33
Average standard deviation of split frequencies: 0.010264
450500 -- (-543.684) (-544.306) (-545.630) [-549.379] * [-542.821] (-545.794) (-544.140) (-546.895) -- 0:00:32
451000 -- (-541.928) [-542.755] (-543.605) (-543.983) * (-542.976) (-546.189) (-543.087) [-544.338] -- 0:00:32
451500 -- (-541.899) (-545.909) (-543.772) [-543.439] * (-542.573) [-545.833] (-543.109) (-543.358) -- 0:00:32
452000 -- (-542.794) [-543.937] (-542.006) (-548.989) * (-544.066) (-544.924) [-545.212] (-544.562) -- 0:00:32
452500 -- (-542.139) (-542.409) (-544.536) [-548.414] * (-546.780) [-546.722] (-543.082) (-545.582) -- 0:00:32
453000 -- (-543.966) (-545.184) [-543.645] (-548.290) * (-542.602) (-548.970) (-542.489) [-543.092] -- 0:00:32
453500 -- (-542.393) (-544.604) [-546.042] (-543.323) * [-543.291] (-543.664) (-542.925) (-542.983) -- 0:00:32
454000 -- (-543.126) (-545.065) [-548.013] (-545.834) * (-545.066) (-547.078) [-542.201] (-545.287) -- 0:00:32
454500 -- [-544.487] (-545.665) (-546.322) (-550.456) * (-546.933) (-544.586) [-542.081] (-545.740) -- 0:00:32
455000 -- [-545.855] (-548.730) (-552.904) (-543.615) * (-544.405) (-547.896) (-543.792) [-545.167] -- 0:00:32
Average standard deviation of split frequencies: 0.010596
455500 -- (-547.793) [-542.753] (-543.888) (-545.915) * (-543.851) (-542.730) (-546.124) [-546.383] -- 0:00:32
456000 -- (-546.837) (-544.186) (-542.735) [-546.144] * (-546.536) [-542.386] (-549.112) (-542.556) -- 0:00:32
456500 -- [-545.053] (-544.532) (-548.905) (-548.896) * (-543.156) (-543.451) (-543.901) [-543.605] -- 0:00:32
457000 -- (-542.748) [-542.003] (-543.427) (-544.894) * [-544.561] (-545.654) (-544.215) (-544.725) -- 0:00:32
457500 -- (-543.125) (-543.957) [-542.712] (-543.191) * (-545.207) (-545.997) [-543.588] (-544.665) -- 0:00:33
458000 -- (-543.947) (-544.135) [-542.654] (-543.359) * (-543.052) (-543.911) (-542.073) [-542.319] -- 0:00:33
458500 -- (-543.533) [-541.648] (-544.516) (-544.280) * (-544.480) [-543.080] (-543.261) (-544.224) -- 0:00:33
459000 -- [-542.454] (-543.911) (-544.909) (-542.897) * (-548.373) (-543.791) [-542.253] (-543.845) -- 0:00:33
459500 -- (-541.965) [-545.116] (-548.103) (-542.474) * (-548.654) [-545.744] (-544.351) (-542.534) -- 0:00:32
460000 -- (-543.448) (-545.759) (-543.451) [-542.940] * [-546.199] (-547.156) (-546.194) (-543.466) -- 0:00:32
Average standard deviation of split frequencies: 0.011192
460500 -- [-543.431] (-544.354) (-544.147) (-542.991) * (-546.312) [-543.474] (-544.051) (-542.750) -- 0:00:32
461000 -- [-542.526] (-546.607) (-542.710) (-546.364) * (-543.789) (-546.952) (-543.249) [-544.817] -- 0:00:32
461500 -- [-544.218] (-546.662) (-548.162) (-542.000) * (-542.416) [-542.292] (-545.462) (-544.700) -- 0:00:32
462000 -- (-546.191) [-543.737] (-543.272) (-544.688) * (-542.849) (-547.448) [-543.356] (-542.260) -- 0:00:32
462500 -- [-542.684] (-544.330) (-541.761) (-543.107) * (-544.689) [-546.053] (-543.358) (-544.466) -- 0:00:32
463000 -- (-544.743) [-544.130] (-542.443) (-542.726) * (-543.200) (-545.876) (-544.781) [-542.984] -- 0:00:32
463500 -- (-545.929) (-544.205) [-542.960] (-547.103) * (-545.374) (-542.810) (-544.889) [-546.096] -- 0:00:32
464000 -- (-546.988) (-546.169) (-544.770) [-543.714] * (-545.582) (-546.266) (-547.475) [-543.729] -- 0:00:32
464500 -- (-543.939) (-544.025) [-543.056] (-543.179) * (-546.504) (-543.162) [-542.893] (-544.549) -- 0:00:32
465000 -- (-542.430) (-545.799) [-543.894] (-542.226) * [-543.484] (-543.847) (-542.870) (-544.073) -- 0:00:32
Average standard deviation of split frequencies: 0.011823
465500 -- (-543.560) [-544.266] (-544.816) (-543.902) * (-546.025) (-543.520) [-545.204] (-542.501) -- 0:00:32
466000 -- [-543.583] (-541.863) (-543.257) (-548.501) * (-542.520) (-549.104) (-543.178) [-542.946] -- 0:00:32
466500 -- [-545.965] (-544.029) (-543.480) (-545.421) * [-543.385] (-543.659) (-542.121) (-547.689) -- 0:00:32
467000 -- (-546.248) [-546.922] (-542.681) (-543.699) * (-545.708) [-544.012] (-542.796) (-544.933) -- 0:00:31
467500 -- [-543.787] (-548.542) (-544.462) (-544.706) * (-546.376) [-542.913] (-544.566) (-547.295) -- 0:00:31
468000 -- (-543.185) (-543.030) (-544.987) [-543.011] * (-545.683) [-541.906] (-543.181) (-545.252) -- 0:00:31
468500 -- (-544.899) (-542.558) [-543.250] (-542.356) * (-542.527) (-543.538) (-542.179) [-543.325] -- 0:00:31
469000 -- (-545.350) (-546.686) [-542.672] (-542.513) * (-542.016) (-546.445) (-545.517) [-542.314] -- 0:00:31
469500 -- (-542.309) (-549.285) (-545.113) [-544.170] * [-544.129] (-542.608) (-545.302) (-546.817) -- 0:00:31
470000 -- [-542.310] (-543.084) (-546.919) (-545.140) * (-544.102) (-542.316) (-546.889) [-543.747] -- 0:00:31
Average standard deviation of split frequencies: 0.012207
470500 -- (-543.079) (-544.488) (-552.921) [-542.798] * [-543.678] (-543.787) (-546.693) (-544.585) -- 0:00:31
471000 -- (-545.924) (-544.235) (-546.463) [-543.255] * (-546.792) (-542.182) [-543.001] (-543.969) -- 0:00:31
471500 -- [-543.876] (-542.190) (-541.823) (-542.617) * (-543.395) (-547.102) (-542.848) [-543.957] -- 0:00:31
472000 -- [-542.678] (-547.203) (-542.797) (-543.752) * (-541.880) [-544.342] (-542.679) (-542.848) -- 0:00:31
472500 -- (-546.403) (-541.779) [-543.348] (-541.960) * (-545.633) (-543.186) [-543.053] (-543.885) -- 0:00:31
473000 -- (-548.900) [-543.788] (-545.640) (-542.658) * [-543.909] (-544.873) (-544.875) (-545.209) -- 0:00:31
473500 -- [-546.026] (-542.432) (-542.191) (-542.293) * (-543.408) [-543.750] (-546.619) (-544.939) -- 0:00:31
474000 -- [-544.890] (-550.315) (-545.254) (-543.181) * [-552.385] (-545.440) (-545.175) (-547.024) -- 0:00:32
474500 -- (-545.763) (-548.167) (-542.974) [-543.772] * (-547.648) (-544.446) [-542.421] (-542.674) -- 0:00:32
475000 -- (-542.194) (-545.645) (-542.070) [-542.779] * [-544.212] (-543.919) (-544.477) (-542.902) -- 0:00:32
Average standard deviation of split frequencies: 0.011760
475500 -- (-543.885) [-542.873] (-543.271) (-545.436) * (-544.489) (-542.835) [-542.608] (-543.737) -- 0:00:31
476000 -- (-542.670) (-542.976) (-544.299) [-544.933] * (-543.026) (-544.966) [-543.592] (-545.286) -- 0:00:31
476500 -- (-544.045) (-542.861) [-545.132] (-544.932) * (-542.409) (-543.549) [-542.774] (-542.547) -- 0:00:31
477000 -- [-545.350] (-542.232) (-545.090) (-542.473) * [-547.896] (-543.454) (-545.023) (-544.330) -- 0:00:31
477500 -- (-542.703) (-543.849) (-546.883) [-542.145] * (-542.319) (-542.046) (-549.615) [-544.144] -- 0:00:31
478000 -- (-543.688) (-544.418) [-542.612] (-545.116) * [-542.633] (-541.826) (-543.096) (-544.392) -- 0:00:31
478500 -- (-541.761) (-543.513) (-542.780) [-542.649] * (-544.258) (-544.168) [-542.463] (-549.523) -- 0:00:31
479000 -- [-548.535] (-543.960) (-542.934) (-542.993) * (-543.417) [-543.432] (-542.408) (-545.967) -- 0:00:31
479500 -- [-547.273] (-543.141) (-542.032) (-545.758) * (-543.962) (-542.505) (-545.401) [-544.001] -- 0:00:31
480000 -- (-546.685) [-543.518] (-541.701) (-542.694) * [-541.926] (-545.227) (-542.825) (-542.579) -- 0:00:31
Average standard deviation of split frequencies: 0.012320
480500 -- (-543.923) (-547.747) (-543.064) [-542.735] * [-542.584] (-546.374) (-544.441) (-543.675) -- 0:00:31
481000 -- [-542.536] (-546.588) (-543.011) (-544.111) * (-544.323) (-546.089) [-543.886] (-543.828) -- 0:00:31
481500 -- (-543.325) [-542.387] (-543.096) (-541.674) * (-542.942) (-542.902) (-545.588) [-543.924] -- 0:00:31
482000 -- (-544.041) [-544.612] (-546.402) (-541.875) * (-544.184) [-542.631] (-546.235) (-546.318) -- 0:00:31
482500 -- (-542.535) (-546.827) [-549.855] (-545.020) * [-543.161] (-542.183) (-542.081) (-542.834) -- 0:00:31
483000 -- (-546.107) (-544.253) (-545.075) [-543.765] * [-544.379] (-542.954) (-541.693) (-547.821) -- 0:00:31
483500 -- (-544.810) (-545.932) (-543.919) [-543.516] * (-542.446) [-542.856] (-544.856) (-543.992) -- 0:00:30
484000 -- [-548.583] (-541.861) (-544.027) (-543.701) * [-542.728] (-543.737) (-543.238) (-542.499) -- 0:00:30
484500 -- (-545.078) [-541.881] (-542.507) (-552.132) * (-544.034) (-543.790) [-542.120] (-544.977) -- 0:00:30
485000 -- (-543.925) (-543.150) (-544.188) [-545.141] * (-548.253) (-546.793) [-542.570] (-547.293) -- 0:00:30
Average standard deviation of split frequencies: 0.012495
485500 -- [-544.693] (-547.801) (-543.480) (-549.918) * (-543.926) (-543.159) [-542.497] (-542.388) -- 0:00:30
486000 -- [-543.790] (-544.033) (-543.476) (-544.288) * [-544.084] (-544.652) (-543.233) (-542.807) -- 0:00:30
486500 -- (-543.853) [-544.532] (-543.138) (-543.788) * [-545.010] (-549.289) (-544.227) (-542.185) -- 0:00:30
487000 -- (-546.233) [-542.949] (-543.938) (-546.500) * (-545.223) [-550.024] (-545.797) (-542.267) -- 0:00:30
487500 -- (-544.495) [-544.940] (-542.975) (-544.698) * [-546.852] (-547.504) (-548.683) (-545.716) -- 0:00:30
488000 -- (-542.405) (-547.341) [-542.907] (-542.841) * [-546.645] (-546.358) (-544.471) (-543.581) -- 0:00:30
488500 -- (-543.744) (-544.016) (-545.353) [-544.762] * (-544.525) (-544.412) [-545.973] (-544.134) -- 0:00:30
489000 -- (-544.991) [-544.680] (-544.280) (-543.047) * (-546.537) (-543.828) [-544.128] (-546.258) -- 0:00:30
489500 -- (-541.992) (-546.095) (-543.940) [-543.646] * [-545.296] (-543.057) (-548.127) (-543.593) -- 0:00:30
490000 -- (-544.731) (-543.426) (-542.378) [-544.481] * (-547.946) (-544.161) (-548.113) [-543.563] -- 0:00:30
Average standard deviation of split frequencies: 0.013330
490500 -- (-544.623) (-543.292) (-547.829) [-542.730] * [-544.415] (-543.801) (-544.214) (-543.341) -- 0:00:31
491000 -- (-541.998) (-545.250) [-543.696] (-543.281) * (-545.024) (-543.588) (-543.337) [-544.937] -- 0:00:31
491500 -- [-542.476] (-543.216) (-542.665) (-542.416) * [-542.792] (-542.234) (-543.706) (-544.112) -- 0:00:31
492000 -- (-544.158) [-544.067] (-545.407) (-543.292) * (-545.432) (-546.529) (-545.579) [-542.067] -- 0:00:30
492500 -- [-542.752] (-546.978) (-544.065) (-542.145) * [-542.372] (-543.672) (-545.344) (-543.793) -- 0:00:30
493000 -- [-542.340] (-547.788) (-545.602) (-543.458) * [-545.020] (-545.679) (-544.596) (-543.201) -- 0:00:30
493500 -- [-542.678] (-547.906) (-546.705) (-544.430) * [-543.448] (-543.175) (-542.132) (-543.908) -- 0:00:30
494000 -- (-541.857) [-542.805] (-545.068) (-546.281) * (-546.450) (-545.635) [-544.234] (-543.761) -- 0:00:30
494500 -- (-541.826) [-546.090] (-554.634) (-543.563) * (-555.123) (-546.283) [-543.051] (-545.649) -- 0:00:30
495000 -- [-544.757] (-544.679) (-545.561) (-545.555) * (-546.089) (-543.958) (-544.063) [-543.703] -- 0:00:30
Average standard deviation of split frequencies: 0.012076
495500 -- (-544.023) (-549.286) (-545.370) [-549.059] * (-544.827) [-542.529] (-544.103) (-546.366) -- 0:00:30
496000 -- (-547.166) [-542.588] (-545.635) (-546.365) * (-542.761) (-543.681) (-544.822) [-545.272] -- 0:00:30
496500 -- [-544.661] (-543.584) (-544.701) (-547.017) * (-543.363) (-543.432) [-543.207] (-543.501) -- 0:00:30
497000 -- (-544.456) (-542.990) (-542.704) [-545.448] * [-545.436] (-544.611) (-543.478) (-545.440) -- 0:00:30
497500 -- (-542.960) (-542.521) [-542.439] (-543.226) * (-548.191) (-545.056) [-542.923] (-542.002) -- 0:00:30
498000 -- [-544.083] (-543.566) (-544.252) (-543.393) * [-545.688] (-545.957) (-544.188) (-543.170) -- 0:00:30
498500 -- (-543.554) [-541.929] (-544.887) (-543.673) * (-543.099) (-546.515) [-545.740] (-542.952) -- 0:00:30
499000 -- (-546.739) (-544.250) (-545.578) [-547.738] * (-542.222) (-545.681) (-547.321) [-544.611] -- 0:00:30
499500 -- [-545.564] (-546.577) (-544.789) (-546.818) * [-543.140] (-544.234) (-544.569) (-543.076) -- 0:00:30
500000 -- (-544.098) (-544.614) [-544.739] (-543.537) * (-542.587) [-543.085] (-545.920) (-543.579) -- 0:00:30
Average standard deviation of split frequencies: 0.012351
500500 -- (-544.396) (-544.924) [-542.252] (-549.749) * [-542.039] (-545.304) (-546.463) (-546.227) -- 0:00:29
501000 -- (-545.428) (-542.788) [-543.509] (-542.481) * (-542.194) (-545.249) [-544.863] (-545.693) -- 0:00:29
501500 -- (-543.562) (-542.597) (-548.634) [-548.440] * (-543.080) [-546.024] (-546.192) (-543.371) -- 0:00:29
502000 -- (-541.954) (-542.932) (-542.998) [-546.104] * (-544.314) (-541.873) [-544.988] (-546.857) -- 0:00:29
502500 -- (-546.326) (-545.665) [-544.674] (-545.746) * (-543.071) (-544.488) (-542.858) [-543.371] -- 0:00:29
503000 -- (-546.484) (-545.035) (-542.964) [-542.954] * (-544.124) [-545.198] (-542.899) (-544.335) -- 0:00:29
503500 -- (-543.791) [-543.429] (-543.195) (-543.957) * [-548.192] (-543.239) (-542.551) (-543.707) -- 0:00:29
504000 -- (-544.239) (-542.482) [-544.170] (-544.279) * (-550.011) (-546.380) [-542.818] (-542.673) -- 0:00:29
504500 -- (-543.173) (-545.695) [-546.100] (-547.613) * (-544.068) (-544.188) [-543.529] (-541.825) -- 0:00:29
505000 -- [-543.390] (-544.298) (-544.577) (-543.651) * (-541.870) [-546.498] (-544.146) (-543.133) -- 0:00:29
Average standard deviation of split frequencies: 0.012495
505500 -- (-549.694) [-542.826] (-545.101) (-543.320) * (-541.870) (-545.937) [-545.054] (-543.617) -- 0:00:29
506000 -- [-543.056] (-542.169) (-543.131) (-542.015) * (-543.200) (-546.553) [-545.977] (-542.295) -- 0:00:29
506500 -- (-542.113) [-544.091] (-546.136) (-542.648) * (-545.545) [-543.511] (-543.873) (-541.994) -- 0:00:29
507000 -- (-543.314) (-546.544) [-543.979] (-546.828) * (-544.737) (-546.748) (-544.411) [-541.906] -- 0:00:30
507500 -- [-542.848] (-542.118) (-542.826) (-546.044) * (-543.290) (-545.162) [-546.288] (-546.334) -- 0:00:30
508000 -- [-543.543] (-544.216) (-542.758) (-545.809) * (-543.719) [-543.395] (-543.961) (-546.760) -- 0:00:30
508500 -- (-542.152) (-550.871) [-544.071] (-545.183) * (-543.112) [-544.538] (-541.796) (-547.025) -- 0:00:29
509000 -- (-542.107) (-546.412) [-542.436] (-547.297) * (-544.947) [-544.894] (-545.311) (-543.224) -- 0:00:29
509500 -- (-545.335) [-548.312] (-550.923) (-542.829) * (-544.504) (-544.372) [-544.322] (-546.077) -- 0:00:29
510000 -- (-545.234) (-544.686) (-542.764) [-542.492] * (-542.338) [-543.348] (-543.590) (-544.478) -- 0:00:29
Average standard deviation of split frequencies: 0.012218
510500 -- (-542.232) (-541.838) [-542.679] (-543.674) * (-543.627) (-542.425) [-544.548] (-543.848) -- 0:00:29
511000 -- (-548.710) (-543.874) (-542.181) [-546.372] * [-543.339] (-542.249) (-543.490) (-542.952) -- 0:00:29
511500 -- [-543.003] (-544.138) (-544.179) (-544.399) * (-545.441) (-543.401) (-543.555) [-542.592] -- 0:00:29
512000 -- (-545.552) (-542.332) [-542.203] (-545.327) * (-541.764) [-541.853] (-546.633) (-542.849) -- 0:00:29
512500 -- (-547.622) (-543.200) [-543.293] (-542.980) * [-542.606] (-545.680) (-542.764) (-543.976) -- 0:00:29
513000 -- [-542.874] (-543.082) (-547.012) (-543.856) * (-544.276) (-543.542) (-546.177) [-544.548] -- 0:00:29
513500 -- (-542.313) (-545.238) [-545.281] (-542.758) * (-545.146) (-543.379) (-546.166) [-541.685] -- 0:00:29
514000 -- (-546.273) (-541.947) (-542.752) [-543.535] * (-544.834) (-549.114) [-549.554] (-545.523) -- 0:00:29
514500 -- [-542.746] (-542.393) (-543.524) (-542.274) * (-544.478) (-542.970) (-544.532) [-547.443] -- 0:00:29
515000 -- [-542.183] (-542.234) (-543.332) (-546.437) * [-544.066] (-552.353) (-543.591) (-543.537) -- 0:00:29
Average standard deviation of split frequencies: 0.012629
515500 -- [-544.281] (-547.789) (-543.667) (-544.682) * (-548.590) (-543.371) [-542.955] (-545.636) -- 0:00:29
516000 -- [-542.492] (-543.983) (-543.584) (-546.532) * (-548.374) (-545.368) (-543.557) [-543.275] -- 0:00:29
516500 -- [-542.531] (-544.591) (-545.856) (-543.236) * (-544.987) [-542.099] (-545.755) (-541.898) -- 0:00:29
517000 -- (-543.592) [-545.075] (-545.583) (-543.141) * (-543.833) (-544.700) [-543.408] (-543.053) -- 0:00:28
517500 -- (-543.854) [-544.421] (-543.004) (-544.776) * (-544.116) (-550.113) [-543.368] (-544.380) -- 0:00:28
518000 -- (-546.194) (-542.999) (-547.753) [-544.972] * (-544.593) (-543.668) [-542.200] (-546.004) -- 0:00:28
518500 -- [-547.419] (-542.952) (-543.256) (-543.419) * (-544.553) (-543.310) (-543.554) [-543.344] -- 0:00:28
519000 -- (-541.892) [-545.139] (-544.265) (-546.411) * (-542.611) [-542.109] (-544.691) (-542.451) -- 0:00:28
519500 -- (-546.455) (-545.331) [-545.993] (-545.192) * (-549.109) (-543.417) (-546.247) [-543.395] -- 0:00:28
520000 -- [-544.486] (-542.891) (-543.125) (-544.152) * (-543.235) (-542.479) [-543.014] (-542.484) -- 0:00:28
Average standard deviation of split frequencies: 0.012462
520500 -- (-548.475) (-545.193) (-543.514) [-544.577] * (-542.412) (-543.025) [-542.983] (-543.495) -- 0:00:28
521000 -- (-544.422) (-545.460) [-543.143] (-543.138) * (-544.606) (-545.313) (-542.843) [-544.101] -- 0:00:28
521500 -- (-545.829) (-547.868) (-544.923) [-543.235] * (-544.112) (-543.431) (-543.635) [-546.693] -- 0:00:28
522000 -- [-545.250] (-542.406) (-546.138) (-543.140) * (-546.052) [-543.259] (-546.693) (-548.927) -- 0:00:28
522500 -- (-543.239) [-542.315] (-543.238) (-543.084) * (-544.775) (-546.035) (-543.604) [-542.296] -- 0:00:28
523000 -- (-546.677) (-547.059) [-543.206] (-544.071) * (-545.218) (-546.315) (-543.089) [-542.949] -- 0:00:28
523500 -- [-543.789] (-544.638) (-544.995) (-544.373) * [-545.202] (-542.790) (-546.805) (-544.296) -- 0:00:28
524000 -- (-542.833) (-550.377) (-546.127) [-545.626] * [-544.017] (-543.282) (-543.823) (-543.116) -- 0:00:29
524500 -- (-542.669) (-544.310) [-545.935] (-548.442) * (-544.595) (-542.445) (-546.502) [-542.898] -- 0:00:29
525000 -- (-543.999) [-544.131] (-542.415) (-541.706) * [-544.525] (-543.577) (-543.638) (-545.991) -- 0:00:28
Average standard deviation of split frequencies: 0.012231
525500 -- (-543.570) [-543.805] (-545.480) (-541.690) * (-543.930) [-544.259] (-544.348) (-543.233) -- 0:00:28
526000 -- (-545.842) [-543.018] (-542.150) (-541.509) * (-542.900) (-543.809) [-545.075] (-543.196) -- 0:00:28
526500 -- (-544.779) (-543.211) (-542.456) [-543.144] * [-542.087] (-543.905) (-543.528) (-544.610) -- 0:00:28
527000 -- (-550.863) (-543.287) [-543.372] (-543.402) * (-543.770) (-543.189) (-551.628) [-545.290] -- 0:00:28
527500 -- (-545.138) [-542.794] (-549.750) (-542.468) * (-543.977) [-544.454] (-544.743) (-546.482) -- 0:00:28
528000 -- (-543.586) (-542.374) [-545.078] (-543.027) * [-542.158] (-544.241) (-545.482) (-544.106) -- 0:00:28
528500 -- (-543.039) (-542.466) [-544.425] (-544.259) * (-542.518) (-544.410) (-543.761) [-542.562] -- 0:00:28
529000 -- (-550.776) [-542.831] (-544.684) (-542.670) * (-543.975) (-543.372) [-546.584] (-542.874) -- 0:00:28
529500 -- (-543.851) (-545.004) (-544.051) [-543.341] * (-544.156) (-543.172) [-543.669] (-546.301) -- 0:00:28
530000 -- (-543.404) (-547.996) [-542.383] (-542.792) * (-544.646) (-543.179) [-543.991] (-542.128) -- 0:00:28
Average standard deviation of split frequencies: 0.010608
530500 -- (-543.735) (-544.828) (-544.029) [-543.099] * [-543.748] (-542.801) (-542.506) (-542.399) -- 0:00:28
531000 -- [-544.971] (-543.713) (-543.767) (-543.013) * [-543.006] (-545.061) (-541.710) (-542.660) -- 0:00:28
531500 -- (-546.130) [-542.373] (-545.995) (-545.135) * (-543.060) (-548.518) [-542.598] (-543.469) -- 0:00:28
532000 -- [-543.824] (-542.310) (-543.756) (-546.825) * [-543.741] (-550.415) (-543.582) (-542.111) -- 0:00:28
532500 -- (-543.854) (-543.030) [-544.857] (-545.225) * (-543.175) (-543.303) (-544.139) [-542.028] -- 0:00:28
533000 -- [-544.393] (-547.826) (-544.807) (-542.847) * (-544.337) (-545.056) (-543.351) [-542.799] -- 0:00:28
533500 -- (-542.458) [-547.938] (-543.565) (-543.803) * (-545.162) [-543.244] (-542.689) (-541.646) -- 0:00:27
534000 -- (-541.991) (-544.144) (-543.328) [-542.894] * (-542.757) [-542.910] (-543.613) (-545.068) -- 0:00:27
534500 -- [-542.018] (-547.246) (-545.062) (-542.184) * (-545.039) [-551.634] (-543.842) (-545.659) -- 0:00:27
535000 -- (-545.213) [-544.446] (-543.422) (-544.922) * (-544.332) (-545.636) (-542.823) [-542.606] -- 0:00:27
Average standard deviation of split frequencies: 0.010968
535500 -- (-542.248) (-544.549) (-544.012) [-543.938] * (-541.936) (-542.740) (-542.948) [-543.721] -- 0:00:27
536000 -- [-542.617] (-545.662) (-543.833) (-545.210) * (-545.800) (-547.139) (-542.472) [-544.802] -- 0:00:27
536500 -- [-547.166] (-546.950) (-543.840) (-543.366) * (-545.059) (-543.535) [-548.570] (-544.274) -- 0:00:27
537000 -- (-544.498) [-542.442] (-543.797) (-543.067) * (-549.846) [-543.717] (-543.328) (-542.135) -- 0:00:27
537500 -- (-544.282) (-546.050) [-545.317] (-542.926) * [-546.844] (-543.509) (-543.063) (-546.387) -- 0:00:27
538000 -- (-546.642) (-544.952) (-544.492) [-543.103] * [-544.090] (-543.391) (-544.001) (-546.263) -- 0:00:27
538500 -- (-544.861) (-542.793) [-545.310] (-543.429) * (-543.322) [-542.857] (-543.994) (-542.338) -- 0:00:27
539000 -- (-543.692) [-543.775] (-542.946) (-543.413) * (-543.678) (-542.133) (-544.662) [-543.968] -- 0:00:27
539500 -- (-542.805) [-544.358] (-544.248) (-544.339) * (-545.034) (-543.222) [-543.768] (-543.954) -- 0:00:27
540000 -- (-542.306) (-543.721) (-542.864) [-541.807] * (-544.776) [-542.364] (-547.476) (-542.838) -- 0:00:27
Average standard deviation of split frequencies: 0.011129
540500 -- (-542.898) (-542.847) [-542.959] (-544.720) * (-543.857) (-542.338) [-547.012] (-545.573) -- 0:00:28
541000 -- (-543.721) [-543.605] (-544.133) (-542.059) * [-541.957] (-543.728) (-550.801) (-543.259) -- 0:00:27
541500 -- [-544.261] (-545.246) (-543.538) (-543.939) * [-543.496] (-543.413) (-543.894) (-545.601) -- 0:00:27
542000 -- (-544.035) (-542.860) [-544.726] (-545.790) * (-546.251) (-550.175) (-543.525) [-543.709] -- 0:00:27
542500 -- (-544.556) (-542.514) [-546.443] (-544.759) * (-545.319) [-545.251] (-543.449) (-546.221) -- 0:00:27
543000 -- [-544.713] (-547.839) (-544.016) (-544.636) * [-543.948] (-544.168) (-542.672) (-544.809) -- 0:00:27
543500 -- (-543.644) [-543.384] (-543.998) (-544.059) * [-541.664] (-546.975) (-541.694) (-543.774) -- 0:00:27
544000 -- [-544.905] (-543.795) (-546.771) (-541.901) * [-542.739] (-545.226) (-546.715) (-543.402) -- 0:00:27
544500 -- (-543.787) (-545.461) [-542.774] (-543.244) * (-543.739) [-544.702] (-543.077) (-547.039) -- 0:00:27
545000 -- (-543.801) (-543.476) [-541.741] (-543.221) * (-541.774) [-545.792] (-543.258) (-544.950) -- 0:00:27
Average standard deviation of split frequencies: 0.010716
545500 -- (-543.197) [-542.591] (-543.180) (-543.133) * [-544.256] (-542.380) (-546.838) (-543.228) -- 0:00:27
546000 -- (-544.520) (-545.246) [-542.104] (-543.369) * (-543.618) [-547.108] (-544.964) (-544.027) -- 0:00:27
546500 -- (-544.143) [-543.749] (-545.078) (-545.559) * [-543.569] (-543.037) (-544.251) (-545.807) -- 0:00:27
547000 -- (-546.613) (-542.844) [-543.787] (-548.794) * (-543.548) [-544.580] (-543.249) (-546.665) -- 0:00:27
547500 -- (-543.639) (-543.549) (-544.070) [-542.081] * (-546.764) [-542.440] (-550.356) (-547.192) -- 0:00:27
548000 -- [-542.879] (-548.559) (-546.588) (-543.792) * (-545.184) [-543.749] (-546.086) (-543.005) -- 0:00:27
548500 -- (-542.725) (-545.232) (-542.582) [-544.262] * (-546.584) (-547.021) (-545.909) [-545.382] -- 0:00:27
549000 -- (-544.103) (-543.142) (-544.816) [-545.743] * (-547.715) (-547.425) [-544.157] (-541.966) -- 0:00:27
549500 -- [-544.346] (-543.876) (-544.202) (-545.274) * (-542.463) (-543.395) [-544.701] (-543.922) -- 0:00:27
550000 -- (-543.034) (-542.485) [-547.021] (-545.748) * (-542.107) (-542.920) [-544.379] (-543.249) -- 0:00:27
Average standard deviation of split frequencies: 0.010225
550500 -- (-542.206) (-545.558) [-546.730] (-545.664) * (-547.427) (-543.107) [-542.157] (-545.499) -- 0:00:26
551000 -- (-542.412) [-543.401] (-547.196) (-548.951) * (-544.510) (-542.594) [-542.002] (-543.991) -- 0:00:26
551500 -- (-542.248) (-546.336) [-545.187] (-542.897) * (-543.373) (-542.528) (-544.109) [-543.630] -- 0:00:26
552000 -- (-548.564) (-544.498) [-544.825] (-543.303) * [-542.168] (-542.697) (-543.358) (-543.600) -- 0:00:26
552500 -- (-545.416) [-542.889] (-542.539) (-542.774) * (-544.478) [-546.018] (-543.219) (-546.207) -- 0:00:26
553000 -- (-544.121) (-543.544) (-542.909) [-546.459] * (-549.353) (-542.162) [-543.712] (-546.243) -- 0:00:26
553500 -- [-545.400] (-543.289) (-545.217) (-545.294) * [-543.375] (-544.128) (-544.047) (-546.530) -- 0:00:26
554000 -- (-542.833) [-541.841] (-545.576) (-542.684) * (-542.292) (-544.531) [-541.984] (-542.221) -- 0:00:26
554500 -- (-550.925) [-543.073] (-544.677) (-546.600) * (-543.277) (-544.697) (-542.013) [-542.579] -- 0:00:26
555000 -- (-548.003) (-542.534) (-543.060) [-543.113] * (-542.361) (-547.522) (-546.479) [-542.309] -- 0:00:26
Average standard deviation of split frequencies: 0.010823
555500 -- (-545.829) (-543.132) [-541.953] (-547.444) * (-544.667) (-541.856) [-546.111] (-542.288) -- 0:00:26
556000 -- [-544.136] (-543.815) (-542.629) (-545.335) * (-552.762) [-545.137] (-548.044) (-543.744) -- 0:00:26
556500 -- (-543.033) (-544.907) (-543.109) [-544.124] * (-545.120) [-545.814] (-544.122) (-544.722) -- 0:00:26
557000 -- [-542.872] (-545.801) (-545.121) (-543.776) * [-544.207] (-542.836) (-541.784) (-544.548) -- 0:00:26
557500 -- (-542.836) (-545.260) [-541.924] (-544.951) * (-545.258) (-543.513) (-542.827) [-542.410] -- 0:00:26
558000 -- (-545.432) (-542.027) (-548.805) [-545.189] * (-543.842) (-544.396) (-549.790) [-541.549] -- 0:00:26
558500 -- (-548.936) (-544.380) (-551.281) [-544.705] * (-543.772) [-545.014] (-542.536) (-542.881) -- 0:00:26
559000 -- (-544.468) (-543.470) (-545.042) [-542.816] * (-543.355) (-541.847) [-544.191] (-542.649) -- 0:00:26
559500 -- (-544.475) (-543.431) (-547.800) [-542.959] * (-543.844) (-544.506) [-542.072] (-543.292) -- 0:00:26
560000 -- [-542.610] (-545.165) (-547.674) (-543.321) * [-542.934] (-543.483) (-543.864) (-542.756) -- 0:00:26
Average standard deviation of split frequencies: 0.011029
560500 -- (-545.373) (-543.241) (-545.333) [-544.789] * [-543.434] (-542.394) (-545.431) (-544.535) -- 0:00:26
561000 -- (-547.287) [-542.731] (-542.976) (-543.555) * (-546.387) (-545.271) [-542.370] (-547.346) -- 0:00:26
561500 -- (-542.960) (-543.212) (-544.379) [-542.763] * (-543.148) (-543.900) [-542.477] (-544.324) -- 0:00:26
562000 -- (-545.927) (-543.254) (-544.216) [-543.811] * (-547.963) [-542.913] (-544.562) (-546.267) -- 0:00:26
562500 -- [-546.717] (-545.033) (-543.492) (-543.863) * (-544.435) (-543.278) [-543.809] (-544.103) -- 0:00:26
563000 -- (-545.498) (-543.640) [-542.769] (-544.207) * [-542.264] (-545.109) (-546.940) (-542.424) -- 0:00:26
563500 -- (-542.655) (-544.621) (-545.281) [-544.038] * (-543.005) (-542.237) (-545.098) [-546.452] -- 0:00:26
564000 -- (-545.226) (-544.771) [-544.467] (-545.499) * [-543.267] (-546.321) (-543.900) (-550.931) -- 0:00:26
564500 -- (-544.147) [-544.191] (-543.631) (-542.508) * (-542.610) [-544.494] (-544.419) (-543.533) -- 0:00:26
565000 -- (-542.190) (-541.925) (-552.454) [-541.629] * (-545.683) [-544.623] (-545.622) (-546.535) -- 0:00:26
Average standard deviation of split frequencies: 0.011660
565500 -- (-543.699) [-544.490] (-541.938) (-544.041) * [-543.656] (-545.552) (-543.189) (-545.562) -- 0:00:26
566000 -- (-544.258) [-542.780] (-543.164) (-543.420) * [-542.794] (-545.549) (-542.142) (-545.707) -- 0:00:26
566500 -- (-543.191) (-543.432) [-545.079] (-542.700) * [-544.844] (-545.450) (-542.887) (-542.941) -- 0:00:26
567000 -- (-542.532) [-543.385] (-543.243) (-542.281) * (-544.670) [-542.047] (-542.060) (-544.245) -- 0:00:25
567500 -- (-542.851) (-544.941) [-544.420] (-545.513) * (-545.635) (-547.399) [-545.570] (-545.222) -- 0:00:25
568000 -- (-542.467) [-542.699] (-542.200) (-543.237) * (-544.776) [-545.519] (-544.733) (-543.358) -- 0:00:25
568500 -- (-542.271) (-544.168) (-542.249) [-542.478] * (-542.664) [-544.139] (-542.667) (-542.460) -- 0:00:25
569000 -- (-543.226) [-545.567] (-544.090) (-546.171) * [-543.259] (-544.759) (-542.130) (-542.939) -- 0:00:25
569500 -- (-542.902) (-542.872) [-543.525] (-542.931) * (-543.523) (-544.303) (-543.292) [-546.544] -- 0:00:25
570000 -- (-542.281) [-543.773] (-543.406) (-542.459) * (-542.891) (-544.575) (-543.524) [-546.106] -- 0:00:25
Average standard deviation of split frequencies: 0.011613
570500 -- (-542.464) [-542.631] (-542.978) (-545.176) * (-546.150) (-548.515) (-543.645) [-545.024] -- 0:00:25
571000 -- [-544.244] (-544.863) (-544.656) (-543.994) * [-543.516] (-545.541) (-542.702) (-547.072) -- 0:00:25
571500 -- (-542.445) [-545.681] (-542.181) (-545.447) * (-543.198) (-542.863) [-544.497] (-542.964) -- 0:00:25
572000 -- (-543.680) (-546.987) [-542.653] (-550.422) * (-547.759) [-542.631] (-541.735) (-544.472) -- 0:00:25
572500 -- (-547.785) (-545.767) [-543.675] (-543.007) * (-545.793) [-542.008] (-545.306) (-543.567) -- 0:00:25
573000 -- (-547.773) (-549.507) [-546.037] (-543.431) * (-542.358) (-545.150) [-544.164] (-542.365) -- 0:00:25
573500 -- (-545.588) [-544.215] (-546.572) (-542.358) * (-546.701) (-543.421) (-545.158) [-542.624] -- 0:00:25
574000 -- (-542.478) (-546.752) [-547.277] (-544.762) * (-543.647) [-544.019] (-543.563) (-545.066) -- 0:00:25
574500 -- (-543.114) (-546.192) [-544.810] (-545.845) * (-544.041) (-543.541) (-543.777) [-545.213] -- 0:00:25
575000 -- (-544.709) (-543.595) [-543.838] (-544.693) * (-544.758) [-542.314] (-543.986) (-543.120) -- 0:00:25
Average standard deviation of split frequencies: 0.011891
575500 -- (-544.446) (-549.713) (-545.943) [-543.162] * [-547.823] (-543.439) (-546.059) (-543.464) -- 0:00:25
576000 -- (-545.884) [-542.054] (-547.412) (-542.708) * [-543.640] (-542.000) (-542.622) (-543.550) -- 0:00:25
576500 -- [-543.369] (-542.893) (-547.232) (-547.205) * [-542.884] (-542.206) (-546.828) (-543.169) -- 0:00:25
577000 -- (-542.829) [-545.130] (-545.989) (-543.645) * (-544.414) (-543.144) [-543.036] (-546.782) -- 0:00:25
577500 -- [-543.341] (-547.903) (-543.190) (-543.352) * (-544.737) [-542.710] (-547.499) (-542.227) -- 0:00:25
578000 -- (-543.228) (-547.734) [-545.787] (-545.564) * [-547.165] (-544.060) (-550.029) (-544.626) -- 0:00:25
578500 -- [-542.211] (-546.228) (-542.177) (-543.977) * (-543.645) (-545.772) (-543.179) [-544.161] -- 0:00:25
579000 -- (-541.965) (-543.848) (-544.397) [-543.562] * (-544.854) (-543.693) [-542.955] (-542.757) -- 0:00:25
579500 -- (-542.484) (-542.727) (-544.799) [-542.553] * (-542.957) [-543.926] (-542.817) (-543.389) -- 0:00:25
580000 -- [-541.919] (-542.368) (-541.734) (-543.826) * (-544.555) (-547.712) [-543.793] (-543.410) -- 0:00:25
Average standard deviation of split frequencies: 0.012786
580500 -- (-546.722) (-545.673) [-544.200] (-546.694) * (-543.997) [-546.383] (-543.565) (-548.180) -- 0:00:25
581000 -- (-544.176) (-542.671) (-545.082) [-543.460] * (-545.767) (-546.065) (-545.209) [-542.764] -- 0:00:25
581500 -- (-543.553) (-545.925) [-543.862] (-545.751) * (-543.651) (-545.743) [-546.649] (-542.876) -- 0:00:25
582000 -- (-541.815) [-545.679] (-546.733) (-543.561) * (-550.363) [-543.242] (-544.801) (-544.181) -- 0:00:25
582500 -- (-542.631) [-542.527] (-545.827) (-545.339) * (-545.074) (-546.223) [-544.050] (-543.763) -- 0:00:25
583000 -- (-542.349) (-542.623) (-544.595) [-545.539] * (-543.768) (-541.920) [-542.305] (-547.518) -- 0:00:25
583500 -- (-544.205) (-543.316) (-546.448) [-543.472] * [-542.296] (-543.047) (-544.035) (-545.294) -- 0:00:24
584000 -- [-542.993] (-545.663) (-543.789) (-543.560) * (-546.162) (-544.600) (-544.188) [-544.594] -- 0:00:24
584500 -- (-543.370) (-544.427) (-544.568) [-542.368] * (-543.506) [-546.341] (-543.502) (-543.884) -- 0:00:24
585000 -- (-542.891) [-543.930] (-543.906) (-542.074) * [-546.675] (-550.688) (-544.255) (-544.356) -- 0:00:24
Average standard deviation of split frequencies: 0.012972
585500 -- (-544.718) [-544.279] (-544.785) (-546.373) * (-543.848) (-546.228) (-542.150) [-542.401] -- 0:00:24
586000 -- (-543.868) [-542.813] (-546.692) (-542.283) * (-543.034) (-542.618) [-542.598] (-542.996) -- 0:00:24
586500 -- (-544.316) (-543.224) (-541.993) [-542.505] * (-545.956) [-543.457] (-546.521) (-546.941) -- 0:00:24
587000 -- [-543.544] (-542.026) (-542.116) (-545.505) * (-542.885) [-543.430] (-544.312) (-547.760) -- 0:00:24
587500 -- (-542.558) (-542.587) [-544.876] (-550.531) * (-544.157) (-548.448) (-547.368) [-542.332] -- 0:00:24
588000 -- (-545.571) (-543.068) (-543.876) [-546.198] * (-544.741) (-544.101) (-543.788) [-543.429] -- 0:00:24
588500 -- (-544.507) (-543.654) (-542.115) [-543.776] * (-547.123) [-543.973] (-543.199) (-543.962) -- 0:00:24
589000 -- (-545.145) (-542.427) (-543.671) [-544.301] * (-548.685) (-544.997) (-542.328) [-543.507] -- 0:00:24
589500 -- [-543.407] (-544.388) (-547.477) (-542.602) * [-542.065] (-544.611) (-543.394) (-545.419) -- 0:00:24
590000 -- [-542.738] (-548.008) (-546.119) (-541.829) * [-544.789] (-544.064) (-543.823) (-550.477) -- 0:00:24
Average standard deviation of split frequencies: 0.012420
590500 -- (-545.986) [-543.936] (-542.381) (-542.975) * (-542.317) (-545.827) [-544.583] (-544.041) -- 0:00:24
591000 -- (-546.017) (-544.682) (-543.501) [-542.928] * [-543.291] (-544.507) (-544.638) (-545.688) -- 0:00:24
591500 -- (-544.529) [-544.494] (-544.855) (-548.169) * (-544.965) [-544.464] (-545.605) (-544.000) -- 0:00:24
592000 -- [-544.675] (-542.519) (-545.514) (-543.375) * (-545.634) (-544.755) (-543.846) [-544.279] -- 0:00:24
592500 -- (-546.514) [-544.474] (-541.924) (-543.923) * [-543.345] (-544.750) (-544.550) (-545.864) -- 0:00:24
593000 -- (-546.701) (-542.652) (-548.308) [-543.046] * (-544.074) [-545.175] (-547.670) (-543.068) -- 0:00:24
593500 -- (-544.114) (-543.005) [-544.841] (-546.653) * (-547.641) (-546.618) (-544.085) [-542.477] -- 0:00:24
594000 -- (-541.719) (-546.546) [-545.009] (-545.665) * (-543.686) (-543.705) (-544.067) [-544.743] -- 0:00:24
594500 -- (-544.021) (-548.504) (-543.285) [-544.583] * (-542.238) (-544.398) [-546.146] (-544.865) -- 0:00:24
595000 -- (-543.595) (-547.434) (-542.813) [-545.217] * (-543.234) [-543.510] (-543.757) (-543.948) -- 0:00:24
Average standard deviation of split frequencies: 0.012013
595500 -- (-543.796) (-548.368) [-542.775] (-548.156) * (-543.432) [-542.472] (-546.511) (-542.335) -- 0:00:24
596000 -- (-545.662) (-543.809) [-541.972] (-543.910) * (-545.155) [-542.435] (-546.778) (-545.180) -- 0:00:24
596500 -- (-547.793) (-544.704) (-546.669) [-543.649] * (-545.626) (-544.329) [-542.700] (-544.503) -- 0:00:24
597000 -- (-544.403) (-546.909) [-546.641] (-543.999) * (-544.238) (-549.141) [-545.228] (-542.915) -- 0:00:24
597500 -- [-542.474] (-542.092) (-543.845) (-547.005) * (-545.278) (-544.941) [-543.307] (-543.665) -- 0:00:24
598000 -- [-541.839] (-546.026) (-541.646) (-542.606) * (-546.013) (-547.158) (-544.456) [-542.331] -- 0:00:24
598500 -- [-544.746] (-549.150) (-545.287) (-544.231) * (-546.078) (-544.908) (-542.673) [-544.098] -- 0:00:24
599000 -- (-545.894) (-548.025) [-543.301] (-545.374) * (-544.226) (-544.891) (-543.606) [-542.841] -- 0:00:24
599500 -- (-547.132) (-545.197) [-542.421] (-542.430) * [-544.161] (-544.095) (-545.607) (-545.058) -- 0:00:24
600000 -- (-545.753) [-541.846] (-543.811) (-546.508) * (-544.019) (-545.461) (-542.596) [-541.789] -- 0:00:24
Average standard deviation of split frequencies: 0.011674
600500 -- [-542.660] (-542.390) (-546.885) (-546.832) * (-545.548) (-544.686) [-544.491] (-543.314) -- 0:00:23
601000 -- (-545.147) (-549.130) [-542.474] (-549.032) * [-545.901] (-546.173) (-544.785) (-542.384) -- 0:00:23
601500 -- (-542.575) (-542.328) (-541.710) [-543.933] * (-545.187) (-545.401) (-543.940) [-542.239] -- 0:00:23
602000 -- (-544.936) (-541.738) (-544.840) [-545.352] * (-546.507) (-544.030) [-543.668] (-546.314) -- 0:00:23
602500 -- [-542.640] (-547.695) (-542.929) (-544.134) * (-544.399) (-544.679) [-542.930] (-546.777) -- 0:00:23
603000 -- (-544.107) (-545.524) (-548.081) [-542.700] * (-547.788) [-544.518] (-543.554) (-545.542) -- 0:00:23
603500 -- (-544.780) (-543.736) (-547.376) [-543.884] * (-542.500) (-542.197) [-544.801] (-543.435) -- 0:00:23
604000 -- (-543.708) [-543.255] (-543.273) (-544.178) * (-543.111) [-542.953] (-541.830) (-543.621) -- 0:00:23
604500 -- (-543.629) [-542.118] (-544.457) (-545.609) * (-543.714) (-544.427) (-542.705) [-544.140] -- 0:00:23
605000 -- (-542.562) (-544.483) (-544.280) [-548.897] * (-549.147) [-545.582] (-543.383) (-542.228) -- 0:00:23
Average standard deviation of split frequencies: 0.010988
605500 -- (-546.483) (-545.649) [-543.484] (-544.677) * (-542.687) (-543.184) (-544.970) [-542.402] -- 0:00:23
606000 -- (-543.069) (-544.333) (-543.738) [-543.021] * (-543.859) (-543.587) [-544.075] (-544.692) -- 0:00:23
606500 -- (-542.254) (-547.073) [-543.893] (-542.696) * [-542.976] (-543.811) (-542.917) (-543.169) -- 0:00:23
607000 -- (-544.989) (-547.295) [-543.458] (-544.172) * (-543.563) (-543.028) [-542.139] (-543.847) -- 0:00:23
607500 -- (-546.291) [-546.817] (-544.771) (-544.911) * (-546.973) [-543.040] (-543.218) (-544.811) -- 0:00:23
608000 -- (-544.020) (-543.350) (-543.554) [-542.487] * (-543.005) (-542.834) [-542.573] (-544.163) -- 0:00:23
608500 -- [-545.431] (-542.696) (-544.280) (-542.590) * (-549.873) [-543.309] (-547.597) (-544.609) -- 0:00:23
609000 -- [-541.719] (-544.733) (-543.591) (-542.036) * [-550.801] (-547.836) (-543.529) (-544.706) -- 0:00:23
609500 -- (-542.130) (-544.454) [-543.173] (-542.393) * (-547.394) (-542.581) [-542.666] (-545.186) -- 0:00:23
610000 -- (-548.191) [-544.378] (-542.161) (-542.838) * (-551.604) [-542.386] (-545.244) (-544.651) -- 0:00:23
Average standard deviation of split frequencies: 0.010566
610500 -- (-546.552) (-543.250) (-546.291) [-545.488] * (-542.464) (-544.726) [-550.236] (-543.734) -- 0:00:23
611000 -- (-543.598) (-546.087) (-543.965) [-542.482] * (-543.410) (-548.300) (-542.872) [-544.070] -- 0:00:23
611500 -- (-541.649) [-544.197] (-543.527) (-543.631) * (-542.092) (-545.952) [-543.055] (-543.119) -- 0:00:23
612000 -- (-542.610) (-545.430) (-549.215) [-545.446] * (-543.587) [-544.520] (-545.356) (-542.259) -- 0:00:23
612500 -- [-541.686] (-545.245) (-547.187) (-543.540) * (-542.519) (-544.261) (-546.023) [-541.966] -- 0:00:23
613000 -- [-543.120] (-543.556) (-544.810) (-542.147) * (-545.781) [-543.491] (-542.143) (-542.528) -- 0:00:23
613500 -- (-545.125) (-545.479) [-543.411] (-542.669) * (-543.307) (-545.472) [-543.874] (-544.496) -- 0:00:23
614000 -- (-548.082) (-546.189) [-542.518] (-545.364) * (-544.841) [-545.779] (-550.673) (-545.264) -- 0:00:23
614500 -- (-543.536) (-544.002) (-545.059) [-543.174] * (-545.585) (-543.243) (-546.432) [-542.058] -- 0:00:23
615000 -- [-543.376] (-545.123) (-543.238) (-546.541) * (-546.681) (-541.994) [-544.178] (-541.971) -- 0:00:23
Average standard deviation of split frequencies: 0.010666
615500 -- (-541.820) [-545.616] (-544.404) (-543.335) * (-544.579) (-542.344) (-547.097) [-542.349] -- 0:00:23
616000 -- [-542.900] (-543.780) (-542.670) (-547.660) * [-543.709] (-546.776) (-544.814) (-545.140) -- 0:00:23
616500 -- (-543.683) (-545.890) (-542.582) [-543.140] * (-546.426) (-543.990) (-542.325) [-542.798] -- 0:00:23
617000 -- (-542.778) (-543.783) (-542.509) [-544.972] * [-542.202] (-545.577) (-546.313) (-544.560) -- 0:00:22
617500 -- [-547.360] (-544.011) (-544.639) (-545.617) * [-543.180] (-542.540) (-546.172) (-543.759) -- 0:00:22
618000 -- (-543.162) (-542.826) [-544.111] (-543.413) * [-543.955] (-543.001) (-544.180) (-543.333) -- 0:00:22
618500 -- [-545.988] (-545.532) (-545.778) (-543.404) * [-542.175] (-543.565) (-542.847) (-543.207) -- 0:00:22
619000 -- (-543.359) (-542.630) (-545.048) [-542.461] * (-542.398) (-542.113) (-543.525) [-544.186] -- 0:00:22
619500 -- (-545.603) (-543.146) [-543.316] (-543.953) * (-542.179) (-548.506) (-545.994) [-543.557] -- 0:00:22
620000 -- (-544.363) (-543.831) [-543.430] (-545.607) * (-542.314) (-543.554) (-546.629) [-545.145] -- 0:00:22
Average standard deviation of split frequencies: 0.010158
620500 -- [-541.785] (-541.845) (-543.976) (-542.911) * [-548.281] (-542.712) (-543.888) (-543.418) -- 0:00:22
621000 -- (-543.215) [-543.479] (-543.283) (-550.308) * (-543.416) (-542.408) [-544.183] (-546.952) -- 0:00:22
621500 -- (-542.482) (-543.341) (-542.989) [-543.628] * (-545.365) [-544.339] (-544.280) (-543.817) -- 0:00:22
622000 -- (-544.598) (-547.540) (-542.839) [-543.554] * [-545.933] (-550.802) (-545.007) (-544.289) -- 0:00:22
622500 -- (-547.655) (-543.101) [-545.195] (-543.305) * (-546.275) (-543.883) [-542.377] (-544.200) -- 0:00:22
623000 -- (-545.973) (-546.315) [-549.653] (-546.272) * (-544.130) (-548.019) (-542.395) [-544.554] -- 0:00:22
623500 -- [-544.047] (-545.250) (-543.610) (-548.422) * (-542.667) [-544.447] (-545.386) (-543.310) -- 0:00:22
624000 -- (-545.492) (-544.058) (-543.690) [-545.759] * (-544.065) [-544.256] (-542.970) (-542.301) -- 0:00:22
624500 -- [-550.197] (-546.004) (-546.758) (-542.906) * [-544.223] (-545.696) (-545.191) (-542.144) -- 0:00:22
625000 -- (-543.807) (-543.019) [-546.425] (-542.659) * [-544.251] (-544.761) (-548.397) (-548.849) -- 0:00:22
Average standard deviation of split frequencies: 0.010543
625500 -- (-551.894) (-549.067) [-543.114] (-542.400) * (-544.042) [-542.198] (-543.540) (-544.710) -- 0:00:22
626000 -- (-543.024) (-544.379) (-543.614) [-544.538] * (-542.642) (-542.163) (-545.042) [-543.713] -- 0:00:22
626500 -- [-542.832] (-545.846) (-546.403) (-546.305) * (-545.808) (-544.717) (-546.061) [-543.232] -- 0:00:22
627000 -- (-542.701) [-543.235] (-542.217) (-544.139) * (-543.452) (-544.910) [-545.358] (-543.702) -- 0:00:22
627500 -- [-542.768] (-543.213) (-544.173) (-542.777) * (-545.337) [-543.654] (-542.605) (-543.590) -- 0:00:22
628000 -- (-544.358) (-543.598) [-546.645] (-542.024) * (-542.092) [-545.892] (-545.412) (-543.940) -- 0:00:22
628500 -- (-544.142) [-544.576] (-547.941) (-543.514) * [-543.673] (-544.516) (-543.385) (-545.243) -- 0:00:22
629000 -- (-544.327) (-547.465) [-550.298] (-542.471) * (-544.375) (-542.348) [-545.687] (-546.289) -- 0:00:22
629500 -- [-542.393] (-545.387) (-549.226) (-542.511) * (-545.633) (-543.950) [-544.311] (-545.790) -- 0:00:22
630000 -- (-543.603) (-542.170) [-544.352] (-547.126) * (-545.921) (-543.700) (-543.713) [-547.453] -- 0:00:22
Average standard deviation of split frequencies: 0.010465
630500 -- [-545.003] (-542.155) (-544.983) (-548.231) * (-543.660) (-546.686) [-543.248] (-542.524) -- 0:00:22
631000 -- (-545.885) (-545.121) (-542.277) [-544.143] * (-543.157) (-543.594) (-541.925) [-543.441] -- 0:00:22
631500 -- (-547.102) [-542.755] (-543.161) (-549.511) * (-544.142) (-544.567) (-542.208) [-544.861] -- 0:00:22
632000 -- (-545.006) (-545.922) [-544.523] (-543.912) * (-548.689) [-544.260] (-542.804) (-543.783) -- 0:00:22
632500 -- (-542.538) (-545.543) [-546.268] (-544.584) * (-544.394) (-542.541) [-542.746] (-544.804) -- 0:00:22
633000 -- [-542.564] (-544.847) (-546.727) (-543.156) * (-544.111) (-541.897) [-542.697] (-543.841) -- 0:00:22
633500 -- (-541.866) (-543.610) [-543.448] (-542.330) * (-547.013) [-543.810] (-544.297) (-548.026) -- 0:00:21
634000 -- (-544.438) [-543.724] (-550.172) (-542.349) * [-543.262] (-542.297) (-543.715) (-542.492) -- 0:00:21
634500 -- [-543.734] (-543.925) (-546.183) (-544.191) * [-543.401] (-543.392) (-542.742) (-543.769) -- 0:00:21
635000 -- (-544.560) (-543.662) [-542.130] (-544.091) * (-544.225) (-542.918) [-543.101] (-542.893) -- 0:00:21
Average standard deviation of split frequencies: 0.010469
635500 -- [-542.389] (-546.922) (-542.224) (-544.671) * [-547.236] (-546.815) (-542.893) (-543.085) -- 0:00:21
636000 -- (-541.786) (-542.379) [-541.663] (-543.592) * (-548.440) (-545.372) [-541.829] (-549.045) -- 0:00:21
636500 -- [-543.627] (-545.528) (-545.117) (-544.254) * (-543.348) (-547.227) [-542.909] (-547.874) -- 0:00:21
637000 -- (-545.802) (-542.530) (-544.176) [-542.815] * (-546.283) (-547.893) (-541.850) [-542.781] -- 0:00:21
637500 -- (-545.079) (-543.981) [-548.139] (-543.219) * (-542.136) [-542.128] (-542.644) (-542.844) -- 0:00:21
638000 -- [-543.429] (-543.926) (-550.867) (-544.520) * (-545.308) (-549.561) [-542.097] (-542.384) -- 0:00:21
638500 -- (-544.547) (-542.174) (-548.508) [-545.637] * [-546.190] (-543.128) (-542.532) (-543.369) -- 0:00:21
639000 -- (-542.964) (-544.054) (-545.195) [-543.661] * (-544.616) [-544.913] (-543.927) (-543.903) -- 0:00:21
639500 -- (-541.845) [-541.800] (-543.523) (-544.259) * (-543.386) (-543.417) (-544.325) [-543.657] -- 0:00:21
640000 -- [-543.755] (-542.945) (-547.204) (-548.229) * (-543.444) (-549.613) [-544.369] (-543.667) -- 0:00:21
Average standard deviation of split frequencies: 0.010301
640500 -- (-545.180) (-542.822) [-545.875] (-548.094) * (-543.713) (-550.429) [-542.469] (-544.330) -- 0:00:21
641000 -- (-542.803) [-542.264] (-545.270) (-544.918) * (-547.403) (-543.674) [-544.117] (-543.856) -- 0:00:21
641500 -- [-541.835] (-544.373) (-544.538) (-543.047) * (-546.053) (-545.999) [-543.628] (-543.571) -- 0:00:21
642000 -- (-544.512) (-547.017) [-546.128] (-543.665) * (-542.868) (-545.154) (-544.727) [-545.712] -- 0:00:21
642500 -- (-543.940) (-542.790) [-543.410] (-542.916) * (-547.509) [-543.633] (-544.251) (-544.995) -- 0:00:21
643000 -- (-543.942) (-547.379) [-542.368] (-547.758) * (-543.735) (-543.370) [-544.458] (-542.705) -- 0:00:21
643500 -- (-542.626) [-543.448] (-545.421) (-546.476) * [-542.136] (-545.931) (-542.790) (-543.216) -- 0:00:21
644000 -- [-545.198] (-544.362) (-548.724) (-548.280) * [-542.847] (-544.784) (-542.251) (-542.150) -- 0:00:21
644500 -- (-545.215) (-544.706) (-544.437) [-543.769] * (-545.388) (-543.714) (-543.065) [-542.597] -- 0:00:21
645000 -- (-543.485) [-546.528] (-543.403) (-542.414) * (-542.194) (-547.424) (-544.426) [-542.363] -- 0:00:21
Average standard deviation of split frequencies: 0.010490
645500 -- (-545.740) (-547.528) (-541.713) [-545.310] * [-542.662] (-543.453) (-543.430) (-543.116) -- 0:00:21
646000 -- (-547.970) (-542.553) (-542.437) [-541.881] * (-542.662) (-547.680) (-543.878) [-547.094] -- 0:00:21
646500 -- (-546.269) [-543.981] (-543.983) (-543.101) * [-542.594] (-543.471) (-542.458) (-549.659) -- 0:00:21
647000 -- (-547.785) (-543.151) [-545.020] (-546.029) * (-542.562) (-548.927) (-543.277) [-542.625] -- 0:00:21
647500 -- (-544.854) (-546.279) (-543.098) [-543.438] * (-544.472) (-545.867) [-550.666] (-550.810) -- 0:00:21
648000 -- (-544.890) (-542.761) [-546.871] (-542.128) * (-545.318) (-542.389) [-544.179] (-544.753) -- 0:00:21
648500 -- (-544.054) (-543.384) (-545.074) [-542.370] * [-545.774] (-546.393) (-542.392) (-543.475) -- 0:00:21
649000 -- (-545.337) (-544.828) [-542.312] (-544.259) * [-542.251] (-543.856) (-549.077) (-543.834) -- 0:00:21
649500 -- (-547.461) [-542.631] (-544.057) (-542.386) * (-544.715) [-543.470] (-541.938) (-548.459) -- 0:00:21
650000 -- (-544.650) (-546.099) (-543.197) [-543.493] * [-543.628] (-548.750) (-542.113) (-542.919) -- 0:00:21
Average standard deviation of split frequencies: 0.010143
650500 -- [-543.003] (-543.453) (-545.952) (-542.198) * (-545.021) (-547.990) (-543.328) [-543.010] -- 0:00:20
651000 -- (-550.095) (-544.371) [-548.649] (-543.851) * [-542.216] (-544.863) (-544.281) (-546.058) -- 0:00:20
651500 -- (-542.907) [-542.946] (-546.692) (-543.201) * (-547.135) [-543.813] (-546.116) (-542.854) -- 0:00:20
652000 -- (-544.810) [-545.394] (-542.877) (-545.387) * (-544.801) (-542.769) (-544.540) [-542.908] -- 0:00:20
652500 -- (-544.331) (-542.040) [-547.582] (-543.694) * (-546.265) (-542.681) (-543.528) [-542.702] -- 0:00:20
653000 -- [-546.051] (-544.023) (-545.240) (-548.826) * (-542.995) [-542.556] (-542.184) (-542.243) -- 0:00:20
653500 -- (-543.659) (-545.671) [-544.434] (-548.805) * [-543.210] (-544.115) (-542.561) (-545.305) -- 0:00:20
654000 -- (-544.199) (-544.173) [-545.558] (-541.823) * [-544.603] (-545.643) (-546.144) (-543.940) -- 0:00:20
654500 -- (-542.621) [-543.858] (-543.599) (-542.736) * [-543.327] (-544.623) (-544.171) (-543.246) -- 0:00:20
655000 -- (-544.147) (-542.599) (-543.768) [-543.551] * (-542.175) [-545.295] (-542.294) (-544.218) -- 0:00:20
Average standard deviation of split frequencies: 0.009477
655500 -- (-543.274) (-544.504) [-544.108] (-545.364) * (-542.590) (-546.893) [-542.726] (-545.326) -- 0:00:20
656000 -- (-543.832) [-544.439] (-543.006) (-544.582) * (-544.469) (-542.888) [-542.656] (-544.722) -- 0:00:20
656500 -- [-544.962] (-545.673) (-542.058) (-542.466) * (-544.773) (-542.710) [-542.615] (-542.083) -- 0:00:20
657000 -- (-542.582) (-542.647) (-545.269) [-544.700] * (-544.213) (-542.934) (-542.547) [-542.072] -- 0:00:20
657500 -- (-541.856) [-542.123] (-544.611) (-545.743) * [-546.987] (-543.112) (-542.541) (-542.320) -- 0:00:20
658000 -- (-542.772) (-543.671) [-543.492] (-547.001) * [-545.203] (-544.268) (-543.144) (-544.649) -- 0:00:20
658500 -- [-541.716] (-546.403) (-545.493) (-547.406) * (-544.967) [-544.018] (-541.693) (-541.669) -- 0:00:20
659000 -- (-545.785) (-545.120) [-542.109] (-544.041) * (-544.649) (-541.697) (-543.300) [-543.515] -- 0:00:20
659500 -- (-544.998) [-545.955] (-543.876) (-544.678) * (-543.086) (-549.011) (-544.946) [-545.150] -- 0:00:20
660000 -- (-548.384) (-545.460) (-545.370) [-544.289] * (-544.361) (-545.256) [-545.059] (-544.754) -- 0:00:20
Average standard deviation of split frequencies: 0.009499
660500 -- (-548.424) [-541.542] (-543.806) (-543.212) * [-544.479] (-544.078) (-548.283) (-544.218) -- 0:00:20
661000 -- (-544.660) [-541.876] (-543.003) (-547.306) * [-545.912] (-543.235) (-542.169) (-542.477) -- 0:00:20
661500 -- (-546.604) (-543.119) (-544.390) [-546.404] * [-541.990] (-544.660) (-542.145) (-543.295) -- 0:00:20
662000 -- [-542.455] (-543.236) (-545.502) (-543.600) * (-543.078) (-542.810) (-546.581) [-543.525] -- 0:00:20
662500 -- (-546.335) (-542.610) [-546.167] (-543.329) * (-542.919) [-544.293] (-548.725) (-543.510) -- 0:00:20
663000 -- (-544.212) (-543.730) [-544.939] (-543.866) * [-541.930] (-544.583) (-544.783) (-543.283) -- 0:00:20
663500 -- [-542.515] (-543.112) (-543.018) (-543.163) * (-543.032) (-542.732) (-544.784) [-543.245] -- 0:00:20
664000 -- (-543.059) [-541.960] (-545.002) (-546.441) * (-544.175) (-551.231) [-545.893] (-543.931) -- 0:00:20
664500 -- (-542.711) [-542.242] (-543.012) (-544.482) * [-543.512] (-544.189) (-543.186) (-548.110) -- 0:00:20
665000 -- (-542.719) (-542.248) [-542.794] (-543.126) * (-545.844) (-543.341) (-545.313) [-550.660] -- 0:00:20
Average standard deviation of split frequencies: 0.008980
665500 -- (-542.113) (-549.920) [-542.869] (-543.502) * [-542.238] (-543.339) (-542.291) (-546.155) -- 0:00:20
666000 -- (-542.088) (-545.411) (-546.824) [-542.028] * (-544.698) (-543.029) [-542.043] (-543.394) -- 0:00:20
666500 -- (-543.710) (-545.497) [-543.581] (-541.714) * [-544.759] (-543.911) (-542.683) (-545.822) -- 0:00:20
667000 -- (-545.351) [-542.653] (-544.284) (-543.481) * (-546.528) (-542.558) (-545.691) [-543.450] -- 0:00:19
667500 -- (-544.976) (-542.978) [-542.809] (-544.023) * (-542.484) [-542.376] (-544.770) (-543.193) -- 0:00:19
668000 -- (-543.671) (-544.935) [-543.918] (-542.724) * [-542.788] (-543.877) (-543.438) (-545.249) -- 0:00:19
668500 -- (-544.351) (-542.629) (-543.163) [-543.968] * [-544.310] (-542.992) (-543.958) (-545.098) -- 0:00:19
669000 -- (-544.989) [-543.934] (-543.577) (-543.303) * [-544.940] (-543.416) (-543.320) (-546.838) -- 0:00:19
669500 -- (-542.599) (-543.471) (-546.513) [-545.430] * (-543.276) (-543.513) [-543.793] (-545.720) -- 0:00:19
670000 -- [-545.555] (-543.367) (-544.125) (-542.038) * (-543.010) [-541.772] (-545.250) (-543.809) -- 0:00:19
Average standard deviation of split frequencies: 0.009621
670500 -- (-542.795) [-544.012] (-545.036) (-541.920) * (-545.586) (-543.523) [-543.543] (-545.316) -- 0:00:19
671000 -- [-543.626] (-543.550) (-548.033) (-544.863) * (-542.317) (-543.274) (-545.372) [-544.236] -- 0:00:19
671500 -- (-545.376) (-543.337) [-542.414] (-544.673) * [-543.559] (-544.161) (-543.225) (-543.563) -- 0:00:19
672000 -- (-542.939) (-543.223) [-543.046] (-546.291) * (-544.062) (-544.099) (-546.920) [-543.349] -- 0:00:19
672500 -- (-543.738) (-542.664) [-543.308] (-546.016) * (-544.034) (-543.482) [-543.427] (-544.180) -- 0:00:19
673000 -- [-543.181] (-546.565) (-543.546) (-545.606) * (-543.304) [-543.897] (-542.668) (-544.256) -- 0:00:19
673500 -- [-543.299] (-545.187) (-544.512) (-544.958) * (-545.891) (-544.055) [-543.808] (-544.109) -- 0:00:19
674000 -- (-543.767) (-543.570) [-543.529] (-543.254) * (-544.462) (-544.691) [-543.201] (-543.861) -- 0:00:19
674500 -- (-543.062) (-544.504) (-542.478) [-543.150] * [-544.697] (-543.242) (-541.981) (-544.776) -- 0:00:19
675000 -- (-543.546) [-542.204] (-543.101) (-542.801) * (-543.742) (-547.702) (-550.416) [-546.321] -- 0:00:19
Average standard deviation of split frequencies: 0.009414
675500 -- [-543.538] (-546.871) (-544.084) (-544.004) * (-543.953) (-543.908) (-547.760) [-541.958] -- 0:00:19
676000 -- (-544.199) (-544.713) (-541.864) [-543.757] * (-544.938) (-543.193) (-544.939) [-542.210] -- 0:00:19
676500 -- (-544.105) [-543.836] (-544.147) (-543.584) * (-545.665) [-542.987] (-543.653) (-542.410) -- 0:00:19
677000 -- [-543.354] (-546.355) (-547.601) (-544.767) * [-544.797] (-544.023) (-544.948) (-543.957) -- 0:00:19
677500 -- (-544.248) [-543.353] (-547.880) (-544.266) * (-545.020) [-544.663] (-544.082) (-547.473) -- 0:00:19
678000 -- (-545.069) (-543.218) [-544.305] (-544.266) * (-542.207) (-543.384) [-547.685] (-545.444) -- 0:00:19
678500 -- (-543.369) (-542.281) (-546.151) [-542.240] * [-542.850] (-543.656) (-546.544) (-545.316) -- 0:00:19
679000 -- [-543.602] (-543.292) (-542.670) (-541.548) * (-545.069) (-542.223) [-543.609] (-546.975) -- 0:00:19
679500 -- (-547.370) (-543.094) [-544.546] (-541.947) * (-545.996) (-541.788) [-542.311] (-545.810) -- 0:00:19
680000 -- (-543.918) (-544.996) [-543.979] (-542.181) * (-544.613) (-545.252) [-543.223] (-544.277) -- 0:00:19
Average standard deviation of split frequencies: 0.009350
680500 -- (-545.234) (-544.008) [-542.800] (-544.109) * [-546.652] (-545.830) (-542.647) (-547.018) -- 0:00:19
681000 -- (-545.830) (-544.256) [-544.251] (-547.125) * (-547.224) (-543.463) (-542.919) [-548.831] -- 0:00:19
681500 -- (-542.574) [-543.254] (-548.807) (-544.574) * (-543.925) (-544.173) (-543.845) [-543.915] -- 0:00:19
682000 -- (-547.098) (-544.285) (-543.175) [-544.771] * (-543.939) (-547.092) (-542.965) [-544.012] -- 0:00:19
682500 -- (-542.902) (-544.866) [-544.444] (-544.194) * (-544.880) (-542.526) [-543.661] (-544.561) -- 0:00:19
683000 -- [-543.495] (-544.278) (-545.203) (-544.712) * [-543.946] (-542.293) (-542.706) (-544.778) -- 0:00:19
683500 -- (-543.651) (-548.314) [-544.129] (-543.276) * (-543.322) (-543.217) [-545.455] (-543.584) -- 0:00:18
684000 -- (-545.476) (-542.258) (-543.972) [-543.431] * (-542.004) (-543.944) (-550.277) [-542.626] -- 0:00:18
684500 -- [-544.782] (-543.674) (-543.763) (-545.602) * (-542.957) [-542.343] (-543.393) (-542.645) -- 0:00:18
685000 -- [-543.009] (-543.358) (-543.146) (-544.171) * (-543.835) (-549.200) [-543.739] (-542.956) -- 0:00:18
Average standard deviation of split frequencies: 0.008847
685500 -- [-544.298] (-542.085) (-544.274) (-546.787) * [-543.444] (-542.675) (-542.843) (-545.140) -- 0:00:18
686000 -- (-541.823) [-542.232] (-547.155) (-550.246) * (-542.871) (-543.598) (-544.754) [-542.936] -- 0:00:18
686500 -- (-543.323) (-546.203) [-545.921] (-548.638) * (-543.760) (-542.196) (-542.396) [-545.139] -- 0:00:18
687000 -- (-543.414) [-543.371] (-542.789) (-548.946) * (-542.822) [-543.481] (-543.260) (-543.178) -- 0:00:18
687500 -- [-545.977] (-546.362) (-543.011) (-542.799) * [-543.166] (-543.446) (-548.374) (-543.169) -- 0:00:18
688000 -- (-542.425) (-549.788) (-545.496) [-542.653] * (-545.027) (-546.656) (-542.451) [-543.389] -- 0:00:18
688500 -- (-544.436) [-544.296] (-543.390) (-541.963) * (-545.431) [-544.927] (-543.403) (-544.336) -- 0:00:18
689000 -- (-543.816) (-544.698) [-544.863] (-542.967) * [-542.766] (-545.306) (-543.789) (-546.447) -- 0:00:18
689500 -- (-543.626) (-545.959) [-543.394] (-542.719) * (-542.545) [-542.830] (-543.597) (-543.907) -- 0:00:18
690000 -- (-543.065) [-548.017] (-546.295) (-546.376) * [-542.482] (-541.853) (-542.415) (-544.966) -- 0:00:18
Average standard deviation of split frequencies: 0.009683
690500 -- (-545.010) [-544.936] (-543.131) (-547.262) * (-542.246) [-541.800] (-543.280) (-545.330) -- 0:00:18
691000 -- (-547.317) (-550.940) (-542.424) [-544.820] * (-542.486) [-544.627] (-543.203) (-545.225) -- 0:00:18
691500 -- [-543.978] (-546.787) (-542.557) (-544.878) * (-543.765) (-545.544) [-542.252] (-543.168) -- 0:00:18
692000 -- (-544.330) [-543.497] (-543.319) (-543.954) * (-545.266) [-542.745] (-543.355) (-541.942) -- 0:00:18
692500 -- (-542.874) [-545.491] (-542.034) (-543.526) * [-543.319] (-544.652) (-542.316) (-547.806) -- 0:00:18
693000 -- (-542.221) (-544.880) [-542.602] (-542.812) * (-545.202) [-544.118] (-542.387) (-543.428) -- 0:00:18
693500 -- (-543.475) (-545.632) (-543.209) [-544.945] * [-547.367] (-542.729) (-542.407) (-548.015) -- 0:00:18
694000 -- (-544.480) [-542.421] (-550.777) (-544.004) * (-545.225) [-542.059] (-543.737) (-545.368) -- 0:00:18
694500 -- (-544.411) (-544.035) [-545.136] (-546.190) * [-544.889] (-541.689) (-544.997) (-543.540) -- 0:00:18
695000 -- (-543.939) (-543.944) [-542.239] (-542.846) * (-542.995) (-541.851) [-542.448] (-543.812) -- 0:00:18
Average standard deviation of split frequencies: 0.009482
695500 -- (-543.591) (-544.548) (-543.538) [-544.631] * (-543.083) [-543.995] (-545.512) (-545.561) -- 0:00:18
696000 -- [-543.555] (-544.804) (-542.043) (-544.493) * (-543.952) [-544.952] (-543.407) (-541.937) -- 0:00:18
696500 -- (-543.654) [-544.165] (-545.403) (-553.590) * (-541.850) (-553.741) (-544.262) [-543.833] -- 0:00:18
697000 -- (-544.056) (-542.791) [-543.402] (-547.106) * (-545.307) (-542.799) [-544.888] (-543.762) -- 0:00:18
697500 -- [-545.208] (-545.621) (-542.244) (-544.312) * (-543.597) [-542.762] (-545.757) (-543.871) -- 0:00:18
698000 -- [-544.011] (-543.827) (-544.703) (-543.554) * (-542.116) (-545.360) (-544.156) [-542.438] -- 0:00:18
698500 -- [-542.595] (-542.573) (-545.459) (-544.825) * [-542.542] (-544.704) (-543.662) (-542.625) -- 0:00:18
699000 -- [-542.341] (-542.409) (-544.271) (-544.376) * [-545.720] (-543.164) (-543.086) (-544.077) -- 0:00:18
699500 -- (-543.391) (-547.903) [-543.163] (-541.789) * [-545.645] (-546.502) (-541.658) (-546.642) -- 0:00:18
700000 -- (-543.846) (-543.167) (-542.691) [-542.141] * (-543.208) [-544.829] (-542.326) (-547.609) -- 0:00:18
Average standard deviation of split frequencies: 0.009503
700500 -- (-544.611) (-546.608) [-543.904] (-545.127) * (-542.717) (-542.999) [-544.305] (-541.735) -- 0:00:17
701000 -- (-545.804) (-542.887) [-542.320] (-544.908) * (-545.023) (-543.282) [-542.423] (-544.389) -- 0:00:17
701500 -- (-543.558) (-542.712) (-541.680) [-545.514] * (-548.675) (-542.682) (-544.155) [-543.672] -- 0:00:17
702000 -- (-549.451) (-543.037) (-543.325) [-543.835] * (-548.563) (-545.063) [-545.054] (-543.009) -- 0:00:17
702500 -- (-545.422) (-543.814) (-544.958) [-545.152] * (-544.398) (-543.706) (-542.239) [-542.920] -- 0:00:17
703000 -- (-545.174) (-544.172) (-544.812) [-545.653] * (-542.277) [-542.768] (-542.608) (-543.243) -- 0:00:17
703500 -- (-543.477) (-543.483) (-546.172) [-543.433] * (-542.189) (-543.315) (-544.285) [-543.502] -- 0:00:17
704000 -- (-543.463) (-544.488) (-543.298) [-544.778] * [-543.827] (-541.640) (-544.415) (-542.942) -- 0:00:17
704500 -- (-544.446) (-542.326) [-542.917] (-546.557) * (-547.803) (-543.265) [-542.355] (-543.434) -- 0:00:17
705000 -- (-543.125) [-542.609] (-545.059) (-542.248) * [-542.726] (-544.635) (-542.649) (-542.858) -- 0:00:17
Average standard deviation of split frequencies: 0.009473
705500 -- (-545.179) [-543.944] (-544.057) (-545.855) * (-545.300) (-543.182) [-542.741] (-545.209) -- 0:00:17
706000 -- [-544.198] (-542.471) (-545.291) (-545.754) * [-542.894] (-543.565) (-545.209) (-543.756) -- 0:00:17
706500 -- (-544.503) (-541.928) (-543.422) [-543.955] * (-547.433) [-542.450] (-546.174) (-543.681) -- 0:00:17
707000 -- (-543.801) (-543.361) (-543.747) [-545.930] * (-543.801) (-542.827) (-544.674) [-541.844] -- 0:00:17
707500 -- [-543.780] (-546.243) (-546.774) (-542.596) * (-545.000) (-545.094) [-545.548] (-541.899) -- 0:00:17
708000 -- (-542.751) (-543.819) [-548.109] (-548.644) * (-546.128) (-545.219) (-542.085) [-545.367] -- 0:00:17
708500 -- (-545.015) (-542.491) [-544.164] (-546.099) * (-543.669) (-542.613) [-542.595] (-543.782) -- 0:00:17
709000 -- (-549.402) (-548.777) [-547.187] (-544.162) * [-544.464] (-542.127) (-544.174) (-544.756) -- 0:00:17
709500 -- (-546.792) (-548.201) (-545.591) [-543.714] * (-545.704) [-542.794] (-545.013) (-545.013) -- 0:00:17
710000 -- (-542.777) (-554.647) [-548.160] (-541.876) * (-544.519) (-543.792) [-544.836] (-542.022) -- 0:00:17
Average standard deviation of split frequencies: 0.009743
710500 -- (-545.778) [-542.443] (-548.570) (-545.188) * (-542.809) (-545.928) [-544.539] (-544.068) -- 0:00:17
711000 -- [-542.007] (-548.193) (-544.217) (-546.336) * (-544.622) [-545.376] (-542.353) (-544.657) -- 0:00:17
711500 -- (-541.986) [-544.224] (-545.435) (-542.558) * (-547.952) (-542.781) [-543.187] (-547.803) -- 0:00:17
712000 -- [-545.063] (-544.301) (-545.533) (-542.738) * [-546.261] (-544.804) (-547.244) (-546.812) -- 0:00:17
712500 -- (-543.843) [-546.885] (-546.175) (-545.993) * (-543.354) (-543.454) [-542.284] (-545.945) -- 0:00:17
713000 -- [-546.476] (-546.155) (-543.435) (-544.995) * (-551.614) (-547.746) [-542.920] (-543.864) -- 0:00:17
713500 -- (-546.318) (-544.975) (-542.186) [-545.170] * [-542.470] (-544.932) (-543.838) (-544.043) -- 0:00:17
714000 -- (-544.238) (-543.701) (-542.715) [-542.677] * [-544.234] (-543.313) (-545.197) (-544.306) -- 0:00:17
714500 -- (-543.599) [-547.084] (-542.320) (-541.825) * (-543.196) [-545.742] (-544.528) (-544.766) -- 0:00:17
715000 -- (-543.646) [-543.661] (-542.524) (-543.791) * (-542.361) (-543.348) (-542.760) [-543.661] -- 0:00:17
Average standard deviation of split frequencies: 0.009505
715500 -- (-542.948) [-542.679] (-542.932) (-544.326) * [-544.239] (-542.946) (-542.720) (-543.406) -- 0:00:17
716000 -- (-542.636) (-544.286) (-542.238) [-544.127] * [-542.863] (-542.177) (-542.735) (-543.212) -- 0:00:17
716500 -- [-542.862] (-547.007) (-544.283) (-541.938) * (-543.505) (-543.265) (-543.635) [-542.890] -- 0:00:17
717000 -- [-546.526] (-544.513) (-546.798) (-546.302) * (-546.141) (-546.672) (-544.200) [-543.233] -- 0:00:16
717500 -- (-544.124) (-543.296) (-546.644) [-544.993] * (-548.475) (-545.316) (-545.365) [-542.772] -- 0:00:16
718000 -- [-548.264] (-542.421) (-550.850) (-548.237) * (-546.956) (-541.845) [-545.798] (-544.348) -- 0:00:16
718500 -- (-542.274) [-542.434] (-547.754) (-544.939) * (-547.552) [-543.066] (-543.499) (-548.439) -- 0:00:16
719000 -- (-543.825) [-543.059] (-543.830) (-542.425) * [-546.833] (-541.881) (-544.049) (-543.341) -- 0:00:16
719500 -- [-543.849] (-542.653) (-544.444) (-544.412) * (-543.469) [-543.569] (-543.183) (-542.772) -- 0:00:16
720000 -- (-543.327) [-542.677] (-542.763) (-542.078) * (-545.375) (-543.759) [-544.192] (-543.693) -- 0:00:16
Average standard deviation of split frequencies: 0.008994
720500 -- (-544.820) (-547.478) (-544.750) [-543.116] * (-546.274) (-541.702) (-542.059) [-542.867] -- 0:00:16
721000 -- (-544.434) (-547.348) (-546.703) [-546.391] * (-544.774) [-544.153] (-542.416) (-545.322) -- 0:00:16
721500 -- (-543.898) (-546.170) [-543.316] (-543.053) * (-544.308) (-542.479) (-542.116) [-545.270] -- 0:00:16
722000 -- [-543.305] (-543.682) (-548.082) (-546.275) * (-547.537) [-545.724] (-545.012) (-547.710) -- 0:00:16
722500 -- (-542.912) (-543.014) (-543.365) [-543.251] * [-543.764] (-545.700) (-544.971) (-546.012) -- 0:00:16
723000 -- (-546.186) (-543.185) [-542.186] (-544.318) * [-542.920] (-544.472) (-543.752) (-545.921) -- 0:00:16
723500 -- (-546.336) (-543.815) (-542.506) [-543.554] * (-542.492) (-543.981) [-553.074] (-546.831) -- 0:00:16
724000 -- (-547.219) [-544.206] (-546.767) (-541.830) * (-545.980) [-543.131] (-551.266) (-543.995) -- 0:00:16
724500 -- (-542.758) (-544.116) [-543.074] (-542.585) * (-544.300) [-542.778] (-543.978) (-543.178) -- 0:00:16
725000 -- (-546.031) (-542.141) [-546.378] (-543.896) * (-544.368) (-544.948) (-547.786) [-542.972] -- 0:00:16
Average standard deviation of split frequencies: 0.009415
725500 -- (-544.093) [-542.057] (-546.598) (-545.280) * [-543.392] (-542.246) (-544.097) (-543.259) -- 0:00:16
726000 -- (-544.898) (-548.096) [-545.310] (-543.824) * (-542.346) (-544.444) [-546.269] (-542.190) -- 0:00:16
726500 -- (-542.928) (-543.638) [-543.902] (-543.759) * (-546.996) (-549.551) (-548.143) [-543.223] -- 0:00:16
727000 -- (-543.405) (-546.088) (-547.574) [-543.728] * (-543.240) (-544.984) [-545.300] (-544.038) -- 0:00:16
727500 -- (-542.102) (-545.025) (-543.912) [-543.537] * (-544.327) (-541.767) (-541.805) [-545.801] -- 0:00:16
728000 -- (-543.052) [-546.969] (-544.985) (-550.551) * (-544.070) [-548.885] (-544.367) (-544.027) -- 0:00:16
728500 -- (-546.689) [-546.156] (-543.518) (-553.837) * (-543.856) [-548.385] (-542.606) (-543.112) -- 0:00:16
729000 -- (-544.668) (-545.684) (-544.994) [-542.358] * (-542.790) (-543.530) [-542.608] (-545.443) -- 0:00:16
729500 -- (-542.304) [-543.247] (-543.153) (-542.987) * [-542.837] (-543.633) (-542.718) (-542.989) -- 0:00:16
730000 -- [-542.390] (-546.196) (-545.035) (-545.143) * (-546.104) (-546.211) (-543.323) [-545.372] -- 0:00:16
Average standard deviation of split frequencies: 0.009436
730500 -- (-543.145) (-545.352) [-542.185] (-545.227) * [-542.916] (-544.329) (-544.419) (-549.958) -- 0:00:16
731000 -- [-545.262] (-546.671) (-542.615) (-546.406) * (-543.710) (-543.350) [-542.620] (-543.468) -- 0:00:16
731500 -- (-544.806) (-545.033) (-545.311) [-546.536] * [-541.981] (-544.027) (-542.328) (-545.112) -- 0:00:16
732000 -- [-543.124] (-545.635) (-544.601) (-542.115) * (-541.810) (-545.583) [-542.914] (-544.006) -- 0:00:16
732500 -- (-546.502) [-543.972] (-546.106) (-542.980) * (-545.359) (-552.176) (-542.897) [-542.759] -- 0:00:16
733000 -- (-544.173) (-545.285) (-547.537) [-542.508] * [-545.679] (-542.922) (-543.267) (-542.069) -- 0:00:16
733500 -- [-543.268] (-546.663) (-548.519) (-546.711) * (-546.845) (-542.955) (-549.167) [-544.831] -- 0:00:15
734000 -- [-544.134] (-547.717) (-543.483) (-544.336) * (-546.474) (-542.962) [-541.583] (-543.641) -- 0:00:15
734500 -- [-543.222] (-541.840) (-543.957) (-542.833) * (-543.803) [-547.005] (-541.858) (-543.505) -- 0:00:15
735000 -- (-543.636) (-542.359) [-542.894] (-543.235) * (-543.947) [-546.623] (-543.585) (-542.077) -- 0:00:15
Average standard deviation of split frequencies: 0.009687
735500 -- (-544.543) (-544.323) (-543.535) [-543.982] * (-544.695) (-542.454) [-545.455] (-542.396) -- 0:00:15
736000 -- (-544.482) [-545.548] (-543.281) (-544.038) * (-543.708) (-545.010) [-543.474] (-541.678) -- 0:00:15
736500 -- (-543.776) [-547.134] (-542.346) (-546.242) * (-543.162) (-550.029) [-542.667] (-548.184) -- 0:00:15
737000 -- (-544.646) (-544.603) [-542.931] (-544.574) * (-545.108) (-547.580) (-542.030) [-543.233] -- 0:00:15
737500 -- (-544.697) (-542.968) [-542.468] (-543.966) * (-543.447) [-543.867] (-544.565) (-542.693) -- 0:00:15
738000 -- (-547.175) (-541.952) [-543.613] (-543.147) * (-543.310) (-546.733) (-545.511) [-543.068] -- 0:00:15
738500 -- [-545.373] (-542.226) (-545.377) (-544.033) * (-542.930) [-542.489] (-543.398) (-546.919) -- 0:00:15
739000 -- [-544.979] (-544.478) (-542.287) (-542.258) * (-543.088) (-550.557) [-543.536] (-546.437) -- 0:00:15
739500 -- [-543.551] (-544.202) (-543.067) (-545.143) * (-547.621) (-545.908) [-546.988] (-543.608) -- 0:00:15
740000 -- (-544.851) (-542.719) [-544.562] (-553.016) * (-547.898) (-545.347) [-547.144] (-543.943) -- 0:00:15
Average standard deviation of split frequencies: 0.009746
740500 -- (-545.737) [-541.554] (-541.934) (-547.946) * (-546.768) [-544.045] (-547.063) (-543.334) -- 0:00:15
741000 -- (-542.541) (-541.801) (-541.862) [-544.035] * (-542.233) (-545.090) [-547.782] (-548.182) -- 0:00:15
741500 -- (-544.716) [-542.760] (-542.692) (-542.106) * (-544.650) (-545.323) (-542.205) [-543.306] -- 0:00:15
742000 -- (-547.820) (-542.314) [-546.918] (-544.522) * (-545.370) (-543.255) (-542.201) [-548.056] -- 0:00:15
742500 -- [-542.770] (-544.493) (-543.290) (-542.320) * (-545.925) (-544.509) [-545.478] (-543.029) -- 0:00:15
743000 -- (-546.581) [-545.044] (-541.925) (-544.131) * (-543.289) (-544.719) (-545.801) [-543.932] -- 0:00:15
743500 -- [-544.310] (-548.128) (-542.144) (-543.433) * (-544.518) (-543.655) (-547.307) [-542.890] -- 0:00:15
744000 -- (-543.763) [-544.136] (-548.320) (-544.874) * [-543.113] (-548.968) (-545.144) (-543.859) -- 0:00:15
744500 -- [-542.728] (-542.355) (-545.904) (-542.591) * (-542.792) (-548.501) (-542.567) [-541.890] -- 0:00:15
745000 -- (-547.150) [-542.247] (-544.731) (-543.740) * (-542.853) [-543.564] (-547.136) (-543.979) -- 0:00:15
Average standard deviation of split frequencies: 0.009676
745500 -- [-543.817] (-548.797) (-544.553) (-544.181) * [-542.915] (-550.512) (-547.399) (-544.427) -- 0:00:15
746000 -- (-545.555) (-545.277) [-542.799] (-544.154) * (-544.626) (-550.348) (-551.618) [-545.932] -- 0:00:15
746500 -- (-541.940) (-544.198) (-543.956) [-545.534] * (-545.264) (-545.920) (-542.384) [-546.895] -- 0:00:15
747000 -- (-544.414) (-542.673) (-542.676) [-543.006] * [-544.249] (-544.264) (-546.912) (-542.801) -- 0:00:15
747500 -- (-542.181) [-544.742] (-543.684) (-543.667) * (-546.517) (-546.091) (-545.809) [-548.858] -- 0:00:15
748000 -- [-544.724] (-545.711) (-547.384) (-541.874) * [-542.414] (-544.290) (-548.151) (-543.265) -- 0:00:15
748500 -- (-542.975) (-542.854) [-547.701] (-542.986) * (-543.152) [-545.046] (-543.956) (-543.613) -- 0:00:15
749000 -- (-543.543) [-545.748] (-542.603) (-544.933) * [-546.479] (-545.070) (-548.337) (-543.808) -- 0:00:15
749500 -- (-545.343) (-542.828) (-542.258) [-543.633] * (-542.641) [-544.217] (-545.626) (-543.956) -- 0:00:15
750000 -- (-546.147) (-543.583) [-542.715] (-546.454) * (-542.545) (-546.319) [-546.081] (-543.357) -- 0:00:15
Average standard deviation of split frequencies: 0.008988
750500 -- (-542.721) [-542.635] (-544.132) (-550.789) * (-546.356) (-546.169) [-543.534] (-542.586) -- 0:00:14
751000 -- (-544.896) (-543.312) [-544.060] (-545.639) * (-543.687) (-549.064) [-542.823] (-546.557) -- 0:00:14
751500 -- (-547.285) (-542.953) (-545.537) [-542.861] * [-544.854] (-546.703) (-542.326) (-545.336) -- 0:00:14
752000 -- (-544.396) (-543.372) (-545.855) [-544.758] * (-544.224) (-546.110) [-545.262] (-542.803) -- 0:00:14
752500 -- (-543.942) [-543.391] (-544.397) (-545.121) * (-543.873) (-548.287) (-542.849) [-546.038] -- 0:00:14
753000 -- (-542.237) (-542.542) [-544.722] (-543.687) * (-544.399) (-545.301) [-543.767] (-541.783) -- 0:00:14
753500 -- (-541.576) (-544.585) [-542.717] (-544.153) * [-544.309] (-544.313) (-544.221) (-542.374) -- 0:00:14
754000 -- (-542.736) [-545.434] (-553.606) (-542.875) * [-546.702] (-542.936) (-550.253) (-542.640) -- 0:00:14
754500 -- [-542.567] (-543.742) (-545.720) (-544.870) * (-542.825) (-546.092) (-548.989) [-544.634] -- 0:00:14
755000 -- (-546.986) (-549.306) [-545.022] (-544.107) * (-542.035) (-543.949) [-543.527] (-542.875) -- 0:00:14
Average standard deviation of split frequencies: 0.008613
755500 -- [-543.286] (-549.068) (-544.378) (-543.243) * (-541.872) (-543.008) (-543.992) [-543.035] -- 0:00:14
756000 -- [-542.948] (-543.545) (-545.266) (-544.955) * (-545.139) (-542.699) [-543.262] (-543.053) -- 0:00:14
756500 -- (-544.398) (-543.248) (-543.718) [-543.763] * (-543.027) (-543.078) [-544.537] (-543.807) -- 0:00:14
757000 -- (-547.179) [-542.711] (-545.259) (-542.208) * [-542.762] (-543.136) (-547.778) (-546.528) -- 0:00:14
757500 -- (-543.441) (-543.658) [-543.952] (-546.042) * (-542.917) (-543.313) (-546.631) [-544.055] -- 0:00:14
758000 -- (-546.930) [-543.996] (-542.872) (-544.117) * [-542.345] (-546.309) (-545.867) (-544.250) -- 0:00:14
758500 -- [-544.991] (-545.315) (-542.488) (-548.549) * (-543.455) (-544.991) [-541.815] (-544.064) -- 0:00:14
759000 -- (-542.593) (-543.451) [-543.978] (-545.118) * [-545.122] (-542.649) (-543.211) (-541.948) -- 0:00:14
759500 -- (-543.951) [-543.201] (-544.807) (-542.206) * (-543.865) [-542.486] (-545.112) (-543.448) -- 0:00:14
760000 -- (-544.450) (-544.193) (-543.633) [-542.048] * (-545.934) [-542.503] (-544.386) (-545.599) -- 0:00:14
Average standard deviation of split frequencies: 0.008831
760500 -- (-542.232) [-543.670] (-548.670) (-546.549) * (-544.600) (-544.820) [-542.536] (-547.278) -- 0:00:14
761000 -- (-541.932) (-547.077) (-545.133) [-542.764] * (-549.019) (-542.938) [-544.245] (-543.775) -- 0:00:14
761500 -- [-544.756] (-544.222) (-547.395) (-543.185) * (-547.127) (-544.853) (-542.843) [-541.777] -- 0:00:14
762000 -- (-545.872) (-543.893) (-547.348) [-543.933] * (-543.829) (-545.132) (-541.537) [-543.286] -- 0:00:14
762500 -- [-547.784] (-543.346) (-544.783) (-542.423) * (-543.122) [-544.406] (-542.718) (-543.550) -- 0:00:14
763000 -- (-544.446) (-542.799) [-543.903] (-542.758) * (-543.715) (-543.839) [-548.444] (-541.970) -- 0:00:14
763500 -- (-542.750) (-544.201) [-544.813] (-542.222) * (-548.419) (-545.950) (-542.016) [-543.925] -- 0:00:14
764000 -- [-543.068] (-545.660) (-542.577) (-544.152) * [-544.490] (-544.753) (-546.229) (-549.114) -- 0:00:14
764500 -- [-544.011] (-545.500) (-544.921) (-546.364) * (-544.040) (-550.718) (-545.983) [-543.845] -- 0:00:14
765000 -- (-546.732) (-544.894) (-542.459) [-549.362] * (-545.965) [-544.651] (-544.055) (-544.352) -- 0:00:14
Average standard deviation of split frequencies: 0.008808
765500 -- [-543.345] (-543.115) (-547.514) (-542.614) * [-544.989] (-544.514) (-543.758) (-544.529) -- 0:00:14
766000 -- (-543.440) (-546.550) (-545.323) [-544.535] * [-543.024] (-545.197) (-550.613) (-545.475) -- 0:00:14
766500 -- (-543.632) [-547.558] (-543.904) (-544.476) * [-541.983] (-544.588) (-546.501) (-545.050) -- 0:00:14
767000 -- (-543.410) (-542.528) [-543.399] (-543.873) * (-542.768) [-542.789] (-545.044) (-542.625) -- 0:00:13
767500 -- (-542.863) (-544.606) (-545.800) [-542.046] * (-542.387) (-541.611) [-544.592] (-545.363) -- 0:00:13
768000 -- (-543.108) (-542.540) (-544.713) [-542.555] * (-545.396) (-541.775) [-542.407] (-544.091) -- 0:00:13
768500 -- (-542.823) (-543.750) [-544.190] (-542.205) * [-545.596] (-542.684) (-543.258) (-546.360) -- 0:00:13
769000 -- [-541.803] (-544.812) (-543.133) (-542.568) * (-543.151) (-542.684) [-548.526] (-542.767) -- 0:00:13
769500 -- [-543.804] (-547.008) (-543.003) (-545.658) * (-543.778) (-547.963) (-546.399) [-544.802] -- 0:00:13
770000 -- (-547.028) [-542.203] (-544.650) (-544.291) * (-544.848) (-545.946) (-542.175) [-545.742] -- 0:00:13
Average standard deviation of split frequencies: 0.008869
770500 -- (-545.274) (-543.607) (-548.047) [-542.456] * (-544.803) [-543.852] (-543.574) (-543.614) -- 0:00:13
771000 -- (-544.859) [-542.154] (-542.795) (-543.006) * (-544.242) [-544.405] (-542.768) (-542.909) -- 0:00:13
771500 -- [-544.059] (-543.216) (-544.861) (-543.124) * [-543.741] (-542.656) (-543.512) (-542.423) -- 0:00:13
772000 -- [-542.613] (-542.342) (-544.773) (-544.048) * (-547.729) [-543.785] (-544.811) (-542.281) -- 0:00:13
772500 -- [-543.318] (-542.847) (-544.683) (-543.211) * (-547.303) (-543.738) (-542.906) [-541.876] -- 0:00:13
773000 -- (-543.387) (-542.030) (-546.439) [-542.991] * (-543.368) (-544.721) [-545.612] (-545.297) -- 0:00:13
773500 -- [-543.962] (-543.075) (-545.141) (-543.891) * (-545.943) (-545.285) [-545.510] (-545.215) -- 0:00:13
774000 -- (-541.859) (-544.901) (-542.839) [-543.272] * [-542.222] (-545.717) (-545.294) (-550.820) -- 0:00:13
774500 -- [-543.078] (-544.247) (-544.713) (-541.735) * (-544.910) (-543.385) [-542.637] (-542.163) -- 0:00:13
775000 -- [-543.458] (-543.188) (-547.578) (-541.724) * (-545.459) (-543.739) [-543.654] (-543.516) -- 0:00:13
Average standard deviation of split frequencies: 0.008657
775500 -- (-545.502) [-542.513] (-546.440) (-544.698) * (-543.624) [-547.872] (-542.758) (-545.310) -- 0:00:13
776000 -- (-544.999) [-543.947] (-542.860) (-546.144) * [-545.723] (-544.002) (-545.849) (-546.864) -- 0:00:13
776500 -- (-546.608) (-544.247) [-541.814] (-544.490) * (-542.501) (-549.146) (-541.961) [-544.630] -- 0:00:13
777000 -- [-543.981] (-544.061) (-545.924) (-542.097) * (-543.319) (-543.564) (-543.662) [-542.738] -- 0:00:13
777500 -- (-547.435) [-543.075] (-545.558) (-544.336) * [-544.300] (-543.972) (-544.079) (-544.591) -- 0:00:13
778000 -- (-546.053) [-543.885] (-542.224) (-545.450) * [-544.379] (-546.198) (-541.944) (-543.528) -- 0:00:13
778500 -- [-543.424] (-543.983) (-542.477) (-543.912) * (-544.028) (-544.317) (-542.557) [-543.442] -- 0:00:13
779000 -- (-544.412) (-544.145) (-542.749) [-543.238] * [-544.726] (-545.256) (-542.262) (-542.714) -- 0:00:13
779500 -- [-542.230] (-546.081) (-542.844) (-543.054) * (-547.498) (-541.539) (-546.786) [-541.770] -- 0:00:13
780000 -- (-545.419) [-546.649] (-544.185) (-544.139) * (-546.105) (-544.889) [-542.009] (-542.466) -- 0:00:13
Average standard deviation of split frequencies: 0.008567
780500 -- (-549.357) (-544.542) (-542.676) [-545.864] * (-545.054) (-544.768) [-542.920] (-544.550) -- 0:00:13
781000 -- [-546.023] (-542.500) (-548.715) (-544.295) * (-542.365) [-544.492] (-544.670) (-543.937) -- 0:00:13
781500 -- [-545.467] (-544.489) (-548.517) (-545.388) * (-541.911) (-544.691) (-544.208) [-544.664] -- 0:00:13
782000 -- (-543.303) (-544.024) [-543.052] (-547.708) * [-542.322] (-548.727) (-542.613) (-543.781) -- 0:00:13
782500 -- (-545.350) (-544.739) [-542.738] (-544.675) * (-543.462) (-551.441) [-542.322] (-542.946) -- 0:00:13
783000 -- [-547.480] (-544.871) (-543.411) (-546.455) * [-544.556] (-543.817) (-547.191) (-544.322) -- 0:00:13
783500 -- (-542.696) [-544.958] (-543.151) (-545.676) * (-546.173) [-544.515] (-546.238) (-543.936) -- 0:00:12
784000 -- [-543.467] (-546.559) (-542.978) (-546.831) * [-542.895] (-543.607) (-548.638) (-543.313) -- 0:00:12
784500 -- [-543.592] (-545.757) (-542.498) (-545.473) * (-542.747) (-542.226) [-544.811] (-544.103) -- 0:00:12
785000 -- (-542.971) (-544.404) [-545.261] (-545.802) * [-544.050] (-541.717) (-542.809) (-544.038) -- 0:00:12
Average standard deviation of split frequencies: 0.009034
785500 -- [-545.031] (-548.741) (-543.663) (-543.260) * [-542.848] (-542.708) (-544.748) (-549.492) -- 0:00:12
786000 -- [-542.422] (-546.214) (-542.395) (-545.597) * (-543.974) [-544.581] (-546.619) (-548.774) -- 0:00:12
786500 -- [-544.216] (-542.978) (-543.604) (-543.186) * (-543.340) [-544.541] (-545.184) (-542.571) -- 0:00:12
787000 -- (-546.512) [-542.123] (-546.348) (-549.128) * (-542.248) (-543.275) [-544.058] (-549.311) -- 0:00:12
787500 -- (-545.990) (-542.772) (-543.999) [-542.864] * [-545.831] (-543.854) (-543.629) (-544.886) -- 0:00:12
788000 -- (-546.767) [-542.701] (-548.147) (-544.040) * (-544.093) [-543.301] (-541.841) (-543.262) -- 0:00:12
788500 -- (-545.027) (-544.085) (-544.269) [-543.595] * [-542.568] (-542.987) (-542.474) (-542.449) -- 0:00:12
789000 -- (-542.702) (-545.632) (-542.163) [-543.118] * (-542.402) (-544.306) (-542.773) [-542.364] -- 0:00:12
789500 -- (-545.916) (-543.507) (-543.139) [-541.989] * (-543.801) (-544.295) (-544.029) [-543.784] -- 0:00:12
790000 -- [-541.971] (-541.836) (-544.824) (-542.675) * [-544.372] (-542.588) (-544.700) (-543.064) -- 0:00:12
Average standard deviation of split frequencies: 0.009390
790500 -- (-542.350) [-543.042] (-544.446) (-545.414) * (-544.645) (-544.507) (-547.905) [-541.607] -- 0:00:12
791000 -- [-542.805] (-543.232) (-545.306) (-546.666) * (-544.525) (-544.792) (-545.351) [-542.178] -- 0:00:12
791500 -- [-543.975] (-543.387) (-544.512) (-548.929) * (-543.021) [-544.166] (-546.184) (-543.097) -- 0:00:12
792000 -- (-544.399) (-543.842) (-547.204) [-544.735] * (-542.763) [-544.601] (-544.971) (-545.698) -- 0:00:12
792500 -- (-544.636) [-545.425] (-544.852) (-545.872) * [-543.569] (-543.991) (-546.452) (-544.772) -- 0:00:12
793000 -- (-542.862) (-543.752) [-543.838] (-544.387) * (-543.843) (-543.916) (-547.216) [-544.584] -- 0:00:12
793500 -- (-542.460) (-544.173) [-545.105] (-543.037) * [-544.666] (-552.395) (-544.195) (-543.414) -- 0:00:12
794000 -- (-544.536) (-543.536) [-543.855] (-544.166) * (-542.117) (-551.369) (-545.986) [-544.490] -- 0:00:12
794500 -- [-544.132] (-543.617) (-544.834) (-545.108) * (-545.492) (-545.238) [-548.088] (-546.116) -- 0:00:12
795000 -- (-548.854) [-551.083] (-542.661) (-544.746) * (-544.000) [-544.374] (-549.808) (-545.243) -- 0:00:12
Average standard deviation of split frequencies: 0.009587
795500 -- (-542.506) [-545.151] (-543.874) (-543.959) * (-544.809) [-543.954] (-545.798) (-541.895) -- 0:00:12
796000 -- (-542.087) (-544.730) (-544.715) [-544.025] * (-550.047) [-541.942] (-545.334) (-545.706) -- 0:00:12
796500 -- (-542.380) (-543.777) [-542.105] (-542.768) * (-544.319) (-546.122) [-543.018] (-544.037) -- 0:00:12
797000 -- (-543.186) [-545.504] (-544.957) (-543.159) * [-547.785] (-542.491) (-543.927) (-545.281) -- 0:00:12
797500 -- [-542.372] (-544.068) (-548.850) (-543.128) * (-545.844) (-549.077) (-542.881) [-542.458] -- 0:00:12
798000 -- (-542.052) (-548.243) [-543.912] (-543.626) * (-550.243) (-543.636) (-544.567) [-544.756] -- 0:00:12
798500 -- (-543.876) [-542.662] (-548.301) (-542.593) * (-545.086) (-542.496) [-542.671] (-544.022) -- 0:00:12
799000 -- (-543.018) [-546.620] (-544.388) (-541.849) * [-543.548] (-542.253) (-543.457) (-546.736) -- 0:00:12
799500 -- [-547.678] (-543.370) (-543.112) (-542.631) * (-543.027) [-544.889] (-543.216) (-546.328) -- 0:00:12
800000 -- (-544.051) (-542.435) (-542.839) [-541.832] * (-542.734) [-544.019] (-542.286) (-543.933) -- 0:00:12
Average standard deviation of split frequencies: 0.009567
800500 -- [-544.483] (-548.469) (-542.364) (-542.920) * (-544.130) (-543.943) [-543.283] (-543.353) -- 0:00:11
801000 -- (-543.576) [-542.462] (-548.537) (-542.533) * (-541.962) (-544.482) [-543.899] (-545.191) -- 0:00:11
801500 -- (-543.400) (-542.436) (-543.312) [-544.590] * (-544.220) (-544.476) (-545.467) [-543.478] -- 0:00:11
802000 -- (-548.863) [-543.971] (-546.712) (-543.885) * [-544.094] (-543.337) (-546.079) (-544.605) -- 0:00:11
802500 -- [-543.142] (-543.669) (-549.508) (-543.591) * (-546.000) (-543.285) (-542.861) [-544.687] -- 0:00:11
803000 -- [-543.078] (-544.091) (-551.321) (-546.046) * (-542.546) (-542.957) (-541.782) [-547.424] -- 0:00:11
803500 -- (-543.779) (-543.920) (-544.065) [-547.802] * [-544.802] (-545.676) (-543.428) (-547.011) -- 0:00:11
804000 -- (-541.949) (-543.049) [-544.629] (-546.875) * [-543.852] (-543.479) (-543.607) (-546.533) -- 0:00:11
804500 -- [-544.590] (-543.662) (-543.549) (-547.374) * (-542.669) (-544.097) [-546.194] (-546.803) -- 0:00:11
805000 -- (-543.190) (-542.809) (-542.383) [-543.545] * (-543.781) [-548.382] (-544.492) (-543.832) -- 0:00:11
Average standard deviation of split frequencies: 0.009468
805500 -- (-542.923) (-544.116) (-546.183) [-545.669] * (-541.651) (-544.688) (-548.757) [-544.819] -- 0:00:11
806000 -- [-544.181] (-545.815) (-542.546) (-544.208) * (-542.247) (-543.907) [-543.570] (-542.484) -- 0:00:11
806500 -- (-546.464) [-546.208] (-542.404) (-546.366) * (-543.617) [-542.601] (-545.353) (-544.350) -- 0:00:11
807000 -- [-542.860] (-545.579) (-545.115) (-544.249) * [-543.570] (-542.353) (-543.226) (-544.810) -- 0:00:11
807500 -- [-543.840] (-542.936) (-542.398) (-543.070) * (-547.016) (-544.808) [-542.617] (-544.509) -- 0:00:11
808000 -- [-546.235] (-543.235) (-543.392) (-544.525) * (-548.211) (-543.696) (-547.316) [-543.343] -- 0:00:11
808500 -- (-542.452) (-543.010) [-543.229] (-545.201) * (-543.789) (-546.446) [-543.578] (-542.152) -- 0:00:11
809000 -- (-542.561) (-543.741) [-546.103] (-542.312) * (-546.638) (-545.226) [-542.030] (-542.431) -- 0:00:11
809500 -- (-543.430) (-551.631) [-544.421] (-543.015) * (-545.593) (-547.587) [-542.362] (-543.563) -- 0:00:11
810000 -- (-542.107) [-544.121] (-543.606) (-543.092) * (-544.968) [-544.842] (-544.753) (-543.105) -- 0:00:11
Average standard deviation of split frequencies: 0.009413
810500 -- [-542.402] (-545.143) (-546.006) (-545.324) * (-542.272) (-550.753) (-545.490) [-544.645] -- 0:00:11
811000 -- (-544.289) (-547.091) (-545.818) [-542.506] * (-542.550) (-546.378) (-548.306) [-545.666] -- 0:00:11
811500 -- [-543.367] (-542.956) (-545.205) (-543.504) * (-542.638) (-547.732) [-544.514] (-543.283) -- 0:00:11
812000 -- (-545.339) [-545.637] (-546.240) (-544.109) * (-542.849) (-544.604) [-541.985] (-547.304) -- 0:00:11
812500 -- (-541.857) (-546.698) (-542.729) [-546.128] * (-543.184) [-542.089] (-543.713) (-547.316) -- 0:00:11
813000 -- (-541.739) [-542.877] (-543.736) (-544.749) * (-543.612) (-545.198) [-542.381] (-543.188) -- 0:00:11
813500 -- [-543.158] (-543.940) (-543.494) (-541.770) * (-544.143) [-544.638] (-542.109) (-547.842) -- 0:00:11
814000 -- (-545.196) [-545.251] (-544.062) (-542.559) * (-543.378) [-547.485] (-544.328) (-546.099) -- 0:00:11
814500 -- [-543.492] (-545.938) (-543.007) (-543.429) * [-543.608] (-542.626) (-548.406) (-544.102) -- 0:00:11
815000 -- [-542.813] (-545.609) (-542.525) (-542.136) * (-544.177) (-542.624) [-544.961] (-543.319) -- 0:00:11
Average standard deviation of split frequencies: 0.008990
815500 -- (-544.681) [-544.633] (-542.584) (-543.377) * (-544.545) [-546.734] (-541.976) (-542.888) -- 0:00:11
816000 -- (-542.090) [-543.372] (-545.412) (-543.593) * [-542.989] (-541.830) (-541.832) (-544.817) -- 0:00:11
816500 -- (-548.445) (-542.546) [-545.685] (-542.738) * [-542.360] (-544.421) (-542.751) (-541.999) -- 0:00:11
817000 -- (-546.248) [-543.841] (-544.292) (-549.958) * (-542.295) (-545.916) (-542.926) [-543.125] -- 0:00:10
817500 -- (-542.157) [-546.027] (-542.630) (-543.772) * (-542.441) (-545.683) (-543.122) [-544.537] -- 0:00:10
818000 -- (-542.718) [-542.727] (-542.632) (-545.149) * [-542.056] (-548.436) (-543.378) (-542.472) -- 0:00:10
818500 -- (-544.731) (-543.104) [-544.716] (-543.199) * [-544.138] (-546.089) (-542.807) (-542.752) -- 0:00:10
819000 -- (-547.852) [-544.207] (-542.250) (-542.972) * [-544.350] (-541.802) (-545.204) (-542.739) -- 0:00:10
819500 -- (-542.449) (-546.571) (-541.970) [-543.661] * [-545.370] (-545.791) (-546.578) (-544.801) -- 0:00:10
820000 -- (-542.612) [-546.431] (-542.496) (-543.634) * [-543.437] (-548.844) (-542.114) (-546.048) -- 0:00:10
Average standard deviation of split frequencies: 0.008544
820500 -- [-544.780] (-543.078) (-544.826) (-546.855) * (-545.898) (-556.259) (-543.761) [-544.858] -- 0:00:10
821000 -- (-543.774) (-545.780) (-541.667) [-546.720] * (-545.953) (-546.859) (-549.261) [-545.344] -- 0:00:10
821500 -- (-543.788) [-544.650] (-544.980) (-548.556) * (-545.767) (-543.519) (-545.993) [-545.208] -- 0:00:10
822000 -- (-546.222) (-542.367) [-544.482] (-542.740) * (-543.138) [-543.483] (-546.128) (-546.186) -- 0:00:10
822500 -- (-542.719) (-542.359) [-547.509] (-542.942) * [-544.521] (-542.222) (-543.567) (-547.239) -- 0:00:10
823000 -- (-544.163) (-541.858) (-542.481) [-543.697] * (-542.712) [-544.508] (-542.324) (-545.880) -- 0:00:10
823500 -- [-544.318] (-541.751) (-543.608) (-542.412) * (-542.652) (-544.982) [-547.589] (-543.038) -- 0:00:10
824000 -- (-545.173) [-544.841] (-545.107) (-541.889) * [-542.054] (-543.230) (-542.724) (-543.739) -- 0:00:10
824500 -- (-544.837) [-543.188] (-543.174) (-542.414) * (-545.234) (-542.676) [-542.267] (-542.968) -- 0:00:10
825000 -- (-547.163) (-547.669) (-545.716) [-542.613] * (-542.495) (-542.468) [-544.969] (-546.038) -- 0:00:10
Average standard deviation of split frequencies: 0.008418
825500 -- (-549.024) [-543.775] (-545.441) (-542.874) * [-544.575] (-543.831) (-542.177) (-545.275) -- 0:00:10
826000 -- (-549.234) (-548.413) [-546.445] (-542.665) * [-546.055] (-542.930) (-545.862) (-547.986) -- 0:00:10
826500 -- (-545.009) (-545.921) (-544.306) [-542.927] * [-544.373] (-542.646) (-542.924) (-546.632) -- 0:00:10
827000 -- [-545.264] (-544.123) (-543.420) (-545.070) * (-543.203) [-545.296] (-546.032) (-547.841) -- 0:00:10
827500 -- (-551.825) (-541.986) (-543.264) [-545.562] * (-542.931) (-548.905) [-543.478] (-543.857) -- 0:00:10
828000 -- [-546.596] (-541.986) (-545.666) (-543.334) * (-544.142) (-550.382) (-543.492) [-546.026] -- 0:00:10
828500 -- (-541.933) [-542.357] (-543.118) (-542.599) * (-549.516) (-543.648) [-543.833] (-544.253) -- 0:00:10
829000 -- [-543.449] (-543.445) (-543.805) (-547.025) * (-547.789) (-543.421) [-544.260] (-546.797) -- 0:00:10
829500 -- (-545.513) (-546.995) (-544.260) [-548.585] * (-546.664) (-545.476) (-546.298) [-541.767] -- 0:00:10
830000 -- (-544.868) (-545.653) [-545.148] (-544.587) * (-547.865) [-542.749] (-544.912) (-544.841) -- 0:00:10
Average standard deviation of split frequencies: 0.008619
830500 -- (-544.149) [-543.339] (-546.178) (-544.056) * (-543.737) (-546.426) [-546.239] (-550.281) -- 0:00:10
831000 -- (-542.325) (-545.408) (-545.879) [-544.965] * (-546.172) (-550.868) [-546.962] (-547.232) -- 0:00:10
831500 -- (-543.662) (-546.592) (-545.814) [-542.708] * [-543.281] (-544.356) (-546.981) (-545.803) -- 0:00:10
832000 -- (-542.994) [-543.767] (-542.072) (-541.992) * (-546.255) [-543.009] (-543.730) (-542.955) -- 0:00:10
832500 -- (-543.667) (-541.934) [-542.523] (-542.694) * (-543.846) (-543.038) [-544.729] (-548.161) -- 0:00:10
833000 -- (-541.929) (-542.666) (-548.898) [-544.201] * (-545.698) (-542.273) (-543.535) [-543.744] -- 0:00:10
833500 -- (-542.081) (-542.996) [-543.346] (-546.487) * (-543.478) [-542.632] (-544.921) (-542.260) -- 0:00:09
834000 -- (-541.877) (-542.131) [-543.013] (-544.067) * [-544.075] (-544.436) (-547.859) (-541.945) -- 0:00:09
834500 -- (-543.918) (-543.197) [-544.601] (-547.162) * (-544.738) (-544.790) (-545.102) [-543.033] -- 0:00:09
835000 -- (-544.119) (-544.776) [-544.036] (-550.460) * (-546.027) [-542.579] (-543.159) (-543.830) -- 0:00:09
Average standard deviation of split frequencies: 0.008670
835500 -- (-543.252) (-542.221) (-542.518) [-544.851] * (-544.735) (-544.160) (-544.702) [-545.719] -- 0:00:09
836000 -- (-544.427) [-543.702] (-543.511) (-543.227) * (-542.487) [-544.566] (-547.256) (-543.492) -- 0:00:09
836500 -- (-542.755) [-544.377] (-544.222) (-543.207) * [-543.506] (-545.864) (-542.501) (-542.400) -- 0:00:09
837000 -- (-545.404) [-544.558] (-551.412) (-546.766) * (-543.503) (-546.840) [-543.543] (-542.579) -- 0:00:09
837500 -- [-543.531] (-542.139) (-543.097) (-542.036) * (-543.724) [-548.646] (-544.360) (-542.926) -- 0:00:09
838000 -- (-543.974) [-544.632] (-548.006) (-543.653) * (-542.239) (-544.259) [-542.797] (-549.194) -- 0:00:09
838500 -- (-546.097) (-544.507) (-544.651) [-542.759] * (-542.281) (-548.652) (-543.916) [-545.508] -- 0:00:09
839000 -- (-546.845) [-543.528] (-542.929) (-545.103) * (-542.498) (-542.529) (-545.397) [-542.234] -- 0:00:09
839500 -- (-546.675) (-543.138) (-543.035) [-543.493] * (-543.466) (-542.898) (-546.036) [-541.909] -- 0:00:09
840000 -- (-546.381) (-545.926) [-543.653] (-544.646) * [-542.821] (-542.427) (-546.032) (-544.261) -- 0:00:09
Average standard deviation of split frequencies: 0.008446
840500 -- (-544.538) [-543.458] (-543.759) (-546.648) * (-545.414) (-543.564) [-543.503] (-543.453) -- 0:00:09
841000 -- (-542.434) [-544.636] (-543.738) (-543.696) * (-541.970) (-545.036) [-543.660] (-544.757) -- 0:00:09
841500 -- [-547.184] (-543.191) (-543.298) (-541.843) * (-542.685) (-547.983) [-543.625] (-546.693) -- 0:00:09
842000 -- (-545.778) (-542.867) (-544.247) [-544.694] * [-543.617] (-543.516) (-542.053) (-547.699) -- 0:00:09
842500 -- [-546.082] (-544.910) (-543.293) (-544.518) * [-542.420] (-542.104) (-542.844) (-545.157) -- 0:00:09
843000 -- (-548.609) (-542.765) [-543.089] (-545.062) * (-543.471) (-542.969) [-542.984] (-545.767) -- 0:00:09
843500 -- (-547.747) (-542.784) [-542.807] (-548.173) * (-545.048) [-543.411] (-545.254) (-544.655) -- 0:00:09
844000 -- (-544.716) (-542.405) [-543.284] (-547.737) * [-542.584] (-542.096) (-554.997) (-545.398) -- 0:00:09
844500 -- (-543.409) [-546.948] (-543.708) (-543.502) * (-544.220) (-543.140) (-548.256) [-544.267] -- 0:00:09
845000 -- [-543.037] (-543.484) (-543.880) (-543.569) * [-542.476] (-543.490) (-543.620) (-548.352) -- 0:00:09
Average standard deviation of split frequencies: 0.008289
845500 -- (-543.844) [-544.059] (-543.427) (-544.859) * (-542.312) [-544.983] (-542.929) (-549.307) -- 0:00:09
846000 -- [-543.152] (-544.375) (-543.548) (-544.778) * (-543.260) [-541.947] (-543.237) (-550.312) -- 0:00:09
846500 -- (-542.091) (-547.466) (-543.051) [-544.601] * (-545.512) (-543.815) (-547.116) [-543.431] -- 0:00:09
847000 -- (-544.100) (-543.215) [-542.400] (-541.942) * (-546.016) (-544.502) (-543.918) [-542.754] -- 0:00:09
847500 -- (-545.750) [-543.354] (-547.414) (-542.870) * (-544.013) [-543.185] (-544.121) (-543.904) -- 0:00:09
848000 -- (-547.864) (-544.872) (-543.522) [-548.368] * [-544.717] (-542.712) (-549.342) (-544.198) -- 0:00:09
848500 -- (-544.229) (-541.941) [-543.647] (-548.596) * [-543.651] (-545.949) (-542.816) (-545.509) -- 0:00:09
849000 -- [-546.249] (-543.400) (-543.665) (-550.746) * [-543.397] (-545.426) (-545.441) (-542.360) -- 0:00:09
849500 -- (-545.969) (-545.118) (-547.818) [-544.732] * (-545.101) (-544.303) (-545.430) [-543.798] -- 0:00:09
850000 -- [-542.806] (-543.164) (-547.597) (-546.051) * (-544.552) [-543.447] (-543.570) (-543.721) -- 0:00:09
Average standard deviation of split frequencies: 0.008278
850500 -- [-544.588] (-544.402) (-542.787) (-547.749) * (-542.994) (-544.934) (-545.739) [-543.959] -- 0:00:08
851000 -- (-543.923) [-543.569] (-544.668) (-546.982) * (-542.300) (-541.965) [-541.906] (-544.309) -- 0:00:08
851500 -- (-543.454) [-542.533] (-543.043) (-543.839) * [-543.017] (-542.513) (-544.995) (-544.106) -- 0:00:08
852000 -- (-548.551) (-543.519) (-546.034) [-543.212] * (-544.064) (-545.488) [-544.503] (-544.212) -- 0:00:08
852500 -- [-543.983] (-543.752) (-545.664) (-542.923) * (-544.155) (-546.184) (-543.434) [-543.716] -- 0:00:08
853000 -- (-543.921) (-543.160) (-544.383) [-542.166] * (-546.194) (-544.115) [-544.168] (-547.632) -- 0:00:08
853500 -- (-544.936) (-545.637) (-542.585) [-543.048] * [-544.351] (-544.035) (-545.465) (-548.501) -- 0:00:08
854000 -- (-545.960) (-543.236) (-543.618) [-542.363] * (-542.907) (-544.740) (-545.358) [-545.731] -- 0:00:08
854500 -- (-544.745) [-542.789] (-543.363) (-542.063) * (-548.071) [-544.192] (-544.279) (-546.001) -- 0:00:08
855000 -- [-545.072] (-545.910) (-543.185) (-544.333) * (-546.320) (-542.598) [-542.833] (-545.111) -- 0:00:08
Average standard deviation of split frequencies: 0.007951
855500 -- (-543.155) (-547.717) [-543.036] (-545.588) * (-548.835) (-542.833) [-542.282] (-543.783) -- 0:00:08
856000 -- (-542.740) (-543.898) (-545.610) [-543.202] * (-545.159) (-543.277) (-544.422) [-544.626] -- 0:00:08
856500 -- (-544.386) (-543.428) (-546.461) [-542.656] * (-543.216) [-543.189] (-543.395) (-545.930) -- 0:00:08
857000 -- (-544.876) (-544.823) (-543.326) [-543.584] * (-545.407) (-543.718) (-544.883) [-544.872] -- 0:00:08
857500 -- [-543.259] (-546.025) (-546.260) (-542.302) * [-544.487] (-544.008) (-541.960) (-543.944) -- 0:00:08
858000 -- [-542.970] (-548.704) (-544.431) (-543.054) * [-544.586] (-543.017) (-545.972) (-543.187) -- 0:00:08
858500 -- (-547.737) (-547.335) [-548.829] (-541.944) * [-542.759] (-544.263) (-543.034) (-543.137) -- 0:00:08
859000 -- (-543.820) (-543.749) (-542.702) [-544.180] * [-542.868] (-543.152) (-543.958) (-546.059) -- 0:00:08
859500 -- (-545.702) [-542.674] (-544.143) (-543.597) * [-542.644] (-542.597) (-543.567) (-543.721) -- 0:00:08
860000 -- (-545.121) [-544.306] (-543.511) (-541.875) * (-545.595) [-542.653] (-543.684) (-545.762) -- 0:00:08
Average standard deviation of split frequencies: 0.008250
860500 -- (-544.045) (-547.665) [-544.088] (-543.669) * (-542.811) (-542.921) [-547.849] (-545.158) -- 0:00:08
861000 -- [-545.735] (-543.526) (-547.007) (-547.980) * [-542.010] (-544.292) (-546.737) (-544.490) -- 0:00:08
861500 -- [-544.878] (-543.354) (-545.488) (-544.556) * (-542.107) [-545.957] (-542.829) (-543.854) -- 0:00:08
862000 -- (-547.805) [-544.221] (-543.531) (-544.641) * (-542.086) [-545.705] (-544.678) (-547.291) -- 0:00:08
862500 -- (-543.425) (-546.360) (-544.938) [-543.230] * (-543.974) (-544.729) (-542.562) [-548.587] -- 0:00:08
863000 -- (-545.813) (-542.049) [-543.271] (-543.632) * [-542.076] (-545.783) (-542.499) (-544.438) -- 0:00:08
863500 -- [-543.896] (-543.264) (-542.925) (-543.733) * (-542.002) (-546.701) [-544.033] (-544.906) -- 0:00:08
864000 -- [-548.746] (-543.951) (-543.092) (-544.369) * [-543.684] (-541.891) (-542.960) (-544.307) -- 0:00:08
864500 -- (-543.815) (-544.088) [-545.772] (-544.037) * (-543.617) (-542.040) [-544.952] (-545.270) -- 0:00:08
865000 -- (-544.581) (-545.322) [-546.888] (-543.672) * (-547.956) (-541.944) [-544.521] (-546.374) -- 0:00:08
Average standard deviation of split frequencies: 0.007961
865500 -- (-543.243) (-548.978) (-543.378) [-544.568] * (-543.547) [-546.090] (-545.234) (-542.916) -- 0:00:08
866000 -- (-542.777) (-543.435) (-544.732) [-544.679] * [-547.183] (-544.378) (-543.100) (-545.399) -- 0:00:08
866500 -- (-543.178) (-544.187) [-547.613] (-544.064) * (-545.282) (-543.699) [-543.677] (-545.725) -- 0:00:08
867000 -- [-544.663] (-546.170) (-545.726) (-545.103) * (-543.929) [-541.681] (-545.830) (-544.553) -- 0:00:07
867500 -- (-542.024) [-542.556] (-545.929) (-548.349) * [-543.586] (-543.465) (-547.583) (-545.965) -- 0:00:07
868000 -- (-542.009) (-541.913) [-542.728] (-545.181) * (-544.935) (-543.979) [-544.062] (-544.977) -- 0:00:07
868500 -- (-544.604) (-544.772) [-544.861] (-544.430) * (-546.036) (-545.808) (-544.020) [-543.125] -- 0:00:07
869000 -- [-544.212] (-544.151) (-544.384) (-544.163) * (-541.878) (-543.600) [-543.213] (-543.534) -- 0:00:07
869500 -- (-544.507) (-541.992) [-545.139] (-544.623) * (-543.785) (-547.276) (-543.385) [-544.119] -- 0:00:07
870000 -- (-543.502) (-544.074) (-542.269) [-543.942] * (-544.148) (-545.452) (-542.810) [-544.228] -- 0:00:07
Average standard deviation of split frequencies: 0.008223
870500 -- (-544.231) (-543.316) (-543.007) [-542.280] * (-544.552) [-545.314] (-542.735) (-542.224) -- 0:00:07
871000 -- (-545.241) (-543.113) (-543.850) [-542.344] * (-544.584) [-544.928] (-542.438) (-543.281) -- 0:00:07
871500 -- (-546.228) (-544.124) (-543.931) [-542.529] * (-545.765) (-544.026) [-542.650] (-544.162) -- 0:00:07
872000 -- [-544.944] (-543.146) (-542.340) (-548.555) * (-544.963) (-541.962) [-545.866] (-546.816) -- 0:00:07
872500 -- (-546.564) [-542.948] (-548.440) (-545.890) * (-542.926) (-542.374) [-542.684] (-546.562) -- 0:00:07
873000 -- (-543.256) (-542.203) [-545.365] (-547.236) * (-545.850) (-543.017) [-541.800] (-546.263) -- 0:00:07
873500 -- (-543.440) (-541.859) (-547.341) [-543.640] * [-543.413] (-542.983) (-543.312) (-542.582) -- 0:00:07
874000 -- (-544.294) (-541.637) [-543.551] (-546.330) * (-542.660) [-543.062] (-544.510) (-543.965) -- 0:00:07
874500 -- (-545.475) (-544.464) [-544.413] (-546.071) * (-542.885) [-543.517] (-543.611) (-543.789) -- 0:00:07
875000 -- (-543.155) (-545.647) (-545.682) [-545.491] * [-543.059] (-545.396) (-547.434) (-542.928) -- 0:00:07
Average standard deviation of split frequencies: 0.007803
875500 -- (-543.870) [-542.882] (-543.062) (-543.006) * (-543.242) (-547.185) (-541.742) [-542.625] -- 0:00:07
876000 -- (-545.191) (-545.513) (-542.975) [-543.122] * (-544.769) (-546.450) (-542.596) [-543.028] -- 0:00:07
876500 -- (-543.527) (-543.852) [-542.615] (-543.169) * (-543.442) (-542.290) [-542.548] (-544.779) -- 0:00:07
877000 -- [-544.215] (-544.510) (-541.943) (-545.522) * (-543.620) [-542.281] (-544.555) (-548.348) -- 0:00:07
877500 -- (-542.607) (-542.975) (-542.574) [-545.299] * (-547.549) (-545.565) (-548.822) [-542.157] -- 0:00:07
878000 -- (-543.772) (-544.833) (-543.031) [-543.359] * (-542.758) (-542.465) (-545.639) [-544.870] -- 0:00:07
878500 -- (-543.530) (-545.323) (-543.892) [-543.124] * (-544.409) (-547.162) [-543.171] (-542.315) -- 0:00:07
879000 -- (-548.546) [-543.085] (-544.120) (-543.525) * (-542.644) (-542.467) [-547.211] (-542.577) -- 0:00:07
879500 -- (-544.153) (-543.385) [-547.112] (-543.928) * [-545.570] (-542.589) (-542.302) (-542.222) -- 0:00:07
880000 -- (-544.114) [-541.699] (-549.247) (-543.293) * (-544.295) (-546.815) (-544.886) [-543.729] -- 0:00:07
Average standard deviation of split frequencies: 0.007594
880500 -- (-542.967) (-544.553) [-543.627] (-544.107) * [-543.275] (-546.003) (-548.532) (-550.410) -- 0:00:07
881000 -- [-545.473] (-543.490) (-543.109) (-543.411) * (-547.976) [-546.013] (-544.167) (-549.204) -- 0:00:07
881500 -- (-542.966) (-543.167) [-542.861] (-543.012) * (-543.241) (-545.117) (-543.398) [-542.752] -- 0:00:07
882000 -- (-543.771) (-545.769) (-542.646) [-542.435] * (-546.944) [-544.352] (-543.242) (-541.801) -- 0:00:07
882500 -- (-542.555) (-546.176) [-545.098] (-543.932) * (-545.206) [-546.406] (-544.175) (-545.407) -- 0:00:07
883000 -- (-544.230) (-547.278) (-544.183) [-542.100] * (-544.871) (-548.398) (-546.014) [-544.899] -- 0:00:07
883500 -- (-547.373) (-547.141) [-542.528] (-542.602) * (-546.309) [-546.010] (-544.650) (-542.801) -- 0:00:06
884000 -- (-545.832) (-548.126) [-542.822] (-543.453) * (-546.172) (-547.629) (-545.169) [-542.698] -- 0:00:06
884500 -- [-544.631] (-546.702) (-542.962) (-542.624) * [-544.977] (-544.159) (-542.899) (-543.363) -- 0:00:06
885000 -- [-542.099] (-543.402) (-542.308) (-545.599) * (-545.041) (-542.128) [-541.785] (-547.109) -- 0:00:06
Average standard deviation of split frequencies: 0.007515
885500 -- (-547.052) (-544.477) [-545.300] (-548.031) * (-542.349) (-544.327) (-542.451) [-543.891] -- 0:00:06
886000 -- (-546.399) [-545.147] (-542.006) (-544.300) * (-544.376) (-545.455) [-543.434] (-543.815) -- 0:00:06
886500 -- (-550.443) (-541.785) [-542.073] (-546.849) * (-546.130) (-548.140) (-544.274) [-546.810] -- 0:00:06
887000 -- (-545.357) (-544.514) [-544.018] (-544.902) * (-543.826) (-549.087) (-542.432) [-542.062] -- 0:00:06
887500 -- (-548.236) (-547.304) [-542.768] (-542.989) * (-545.863) (-542.940) [-543.181] (-543.980) -- 0:00:06
888000 -- (-544.137) (-545.454) [-542.769] (-542.022) * [-546.053] (-545.694) (-542.709) (-544.564) -- 0:00:06
888500 -- (-545.804) [-542.081] (-543.123) (-542.108) * (-543.616) (-544.169) [-542.756] (-550.246) -- 0:00:06
889000 -- (-542.711) (-543.501) [-544.144] (-545.187) * (-544.608) (-545.860) [-543.059] (-542.892) -- 0:00:06
889500 -- (-542.367) (-542.827) [-544.249] (-543.625) * (-542.843) (-544.304) [-543.542] (-543.723) -- 0:00:06
890000 -- (-543.536) (-544.836) (-543.684) [-544.110] * [-542.120] (-541.965) (-543.125) (-543.443) -- 0:00:06
Average standard deviation of split frequencies: 0.007476
890500 -- [-545.893] (-542.991) (-543.355) (-544.417) * (-541.857) (-544.463) (-542.866) [-541.967] -- 0:00:06
891000 -- (-543.008) [-544.061] (-544.028) (-545.650) * (-542.276) (-545.568) [-542.598] (-542.387) -- 0:00:06
891500 -- (-543.420) (-542.566) [-545.731] (-546.280) * (-542.340) [-545.220] (-543.395) (-545.554) -- 0:00:06
892000 -- (-543.590) (-547.899) [-546.918] (-552.868) * (-544.446) (-544.995) [-542.176] (-542.493) -- 0:00:06
892500 -- [-542.370] (-544.354) (-544.577) (-545.276) * [-543.494] (-548.342) (-545.821) (-542.867) -- 0:00:06
893000 -- (-543.547) [-543.751] (-544.107) (-546.483) * (-543.274) (-546.408) [-544.086] (-543.940) -- 0:00:06
893500 -- (-543.162) (-545.598) [-543.455] (-543.799) * [-545.014] (-543.071) (-544.112) (-546.549) -- 0:00:06
894000 -- (-545.623) (-546.983) [-543.269] (-545.649) * (-544.602) (-543.144) [-543.372] (-543.783) -- 0:00:06
894500 -- (-545.322) [-543.141] (-544.594) (-546.280) * (-546.420) (-545.625) [-542.098] (-544.953) -- 0:00:06
895000 -- (-547.062) (-544.659) (-549.841) [-542.719] * (-543.707) (-547.097) [-543.300] (-543.728) -- 0:00:06
Average standard deviation of split frequencies: 0.007399
895500 -- (-546.902) (-542.475) [-542.413] (-542.521) * (-542.968) (-545.596) (-542.417) [-543.207] -- 0:00:06
896000 -- (-543.432) (-543.902) (-542.413) [-547.464] * (-546.464) (-542.077) (-545.680) [-541.778] -- 0:00:06
896500 -- (-543.110) (-545.082) [-543.099] (-543.869) * (-544.826) (-542.607) [-542.590] (-543.399) -- 0:00:06
897000 -- [-543.723] (-542.840) (-544.720) (-543.623) * (-543.836) (-542.607) [-545.796] (-543.216) -- 0:00:06
897500 -- (-550.105) [-544.582] (-546.165) (-543.422) * (-543.127) (-546.706) [-543.455] (-546.049) -- 0:00:06
898000 -- (-553.268) (-543.587) [-543.545] (-546.079) * (-542.929) (-547.145) [-543.326] (-544.167) -- 0:00:06
898500 -- [-542.861] (-541.694) (-543.639) (-546.444) * (-542.839) (-545.117) [-544.088] (-545.589) -- 0:00:06
899000 -- (-548.481) (-542.588) [-542.745] (-544.465) * (-543.127) (-544.448) (-547.687) [-545.337] -- 0:00:06
899500 -- (-545.359) [-543.295] (-543.992) (-544.081) * (-548.786) (-547.106) (-546.211) [-543.564] -- 0:00:06
900000 -- (-541.835) (-542.787) (-544.351) [-544.968] * (-543.632) (-545.490) (-551.444) [-543.246] -- 0:00:06
Average standard deviation of split frequencies: 0.007360
900500 -- (-542.865) (-543.005) [-545.156] (-546.278) * [-544.130] (-542.558) (-546.939) (-542.775) -- 0:00:05
901000 -- (-543.358) [-544.195] (-543.742) (-546.859) * (-542.418) (-547.253) [-544.976] (-542.356) -- 0:00:05
901500 -- (-543.640) [-545.394] (-545.670) (-543.678) * [-544.628] (-542.714) (-546.524) (-542.487) -- 0:00:05
902000 -- (-543.459) (-546.869) (-546.524) [-541.791] * (-541.666) (-544.965) [-543.144] (-542.726) -- 0:00:05
902500 -- (-542.880) (-547.482) (-544.964) [-542.182] * (-541.652) [-542.320] (-541.778) (-542.197) -- 0:00:05
903000 -- (-545.933) [-544.869] (-544.294) (-546.052) * (-541.794) (-543.093) [-543.719] (-543.961) -- 0:00:05
903500 -- [-545.139] (-549.568) (-542.450) (-543.448) * (-542.223) (-543.879) (-542.603) [-543.383] -- 0:00:05
904000 -- [-544.887] (-545.697) (-542.234) (-542.957) * [-541.962] (-544.850) (-544.141) (-544.920) -- 0:00:05
904500 -- (-545.192) [-548.404] (-542.191) (-544.366) * [-543.248] (-544.781) (-545.288) (-542.187) -- 0:00:05
905000 -- (-544.358) (-548.203) [-542.095] (-543.845) * (-543.765) [-542.005] (-544.401) (-544.695) -- 0:00:05
Average standard deviation of split frequencies: 0.007447
905500 -- (-543.477) (-542.239) (-542.303) [-543.219] * (-545.884) (-543.712) [-541.677] (-544.561) -- 0:00:05
906000 -- (-545.886) [-543.274] (-542.207) (-548.411) * (-545.987) [-544.057] (-545.379) (-545.637) -- 0:00:05
906500 -- (-544.156) [-542.835] (-542.508) (-542.796) * (-542.067) (-544.802) [-542.409] (-543.498) -- 0:00:05
907000 -- [-544.100] (-541.928) (-543.151) (-544.427) * (-542.022) [-542.888] (-544.363) (-546.071) -- 0:00:05
907500 -- (-546.367) (-545.460) [-543.908] (-543.740) * [-542.437] (-544.141) (-543.086) (-542.492) -- 0:00:05
908000 -- [-543.184] (-545.420) (-541.984) (-542.023) * (-544.873) [-543.138] (-544.995) (-544.767) -- 0:00:05
908500 -- [-542.499] (-544.401) (-545.755) (-544.753) * (-542.807) (-542.438) [-543.782] (-543.626) -- 0:00:05
909000 -- (-544.123) (-545.241) (-547.634) [-546.296] * (-542.079) (-543.446) [-543.046] (-544.163) -- 0:00:05
909500 -- (-544.411) [-543.275] (-544.427) (-560.210) * [-542.829] (-542.488) (-548.872) (-545.089) -- 0:00:05
910000 -- (-543.736) [-545.542] (-542.506) (-543.945) * (-541.841) (-545.540) [-542.853] (-549.276) -- 0:00:05
Average standard deviation of split frequencies: 0.007571
910500 -- [-542.241] (-545.674) (-542.626) (-549.319) * (-543.336) (-544.665) (-545.405) [-546.054] -- 0:00:05
911000 -- (-545.366) (-542.341) (-545.156) [-546.101] * [-542.278] (-543.153) (-544.654) (-547.006) -- 0:00:05
911500 -- (-543.204) [-541.589] (-546.161) (-542.293) * (-552.334) (-542.340) [-544.574] (-542.822) -- 0:00:05
912000 -- [-542.962] (-541.561) (-543.837) (-542.550) * [-546.157] (-542.079) (-543.736) (-545.630) -- 0:00:05
912500 -- [-544.020] (-543.713) (-544.948) (-545.627) * (-545.128) (-544.105) (-542.835) [-543.630] -- 0:00:05
913000 -- [-542.253] (-549.973) (-544.285) (-543.213) * (-544.671) (-547.684) (-541.574) [-543.643] -- 0:00:05
913500 -- [-543.113] (-546.183) (-545.329) (-543.347) * (-542.177) (-543.981) (-547.370) [-545.504] -- 0:00:05
914000 -- [-546.869] (-543.507) (-545.135) (-542.874) * (-544.368) (-543.361) [-548.427] (-547.983) -- 0:00:05
914500 -- [-543.527] (-548.209) (-542.515) (-546.185) * (-545.356) (-544.396) [-547.483] (-548.517) -- 0:00:05
915000 -- (-543.769) (-545.716) (-542.462) [-542.667] * (-542.383) (-542.467) [-545.899] (-544.625) -- 0:00:05
Average standard deviation of split frequencies: 0.007623
915500 -- (-543.322) [-543.965] (-542.312) (-541.818) * (-542.325) (-544.026) [-544.550] (-546.539) -- 0:00:05
916000 -- (-544.171) (-545.818) [-546.655] (-543.718) * (-545.997) (-544.018) (-546.344) [-543.003] -- 0:00:05
916500 -- (-543.877) [-543.068] (-544.649) (-545.762) * (-542.327) (-543.798) (-544.256) [-544.364] -- 0:00:05
917000 -- (-548.152) (-545.492) (-546.278) [-542.896] * (-543.681) (-542.811) (-544.428) [-543.239] -- 0:00:04
917500 -- (-549.421) [-544.184] (-544.843) (-542.575) * (-542.100) (-543.875) (-542.055) [-542.722] -- 0:00:04
918000 -- (-542.540) [-544.200] (-545.944) (-543.349) * (-545.959) (-542.505) (-543.424) [-545.747] -- 0:00:04
918500 -- [-546.527] (-544.650) (-545.825) (-545.293) * (-543.403) [-544.766] (-545.540) (-545.532) -- 0:00:04
919000 -- (-541.787) (-543.887) (-545.036) [-543.406] * (-542.974) (-547.251) (-542.017) [-548.105] -- 0:00:04
919500 -- (-542.153) (-545.372) [-543.002] (-544.289) * [-543.463] (-545.101) (-544.546) (-545.064) -- 0:00:04
920000 -- [-542.405] (-544.327) (-541.801) (-543.358) * [-545.144] (-543.221) (-542.949) (-542.361) -- 0:00:04
Average standard deviation of split frequencies: 0.007968
920500 -- [-545.129] (-543.785) (-545.083) (-543.698) * (-544.281) (-544.822) (-543.603) [-543.174] -- 0:00:04
921000 -- (-544.442) (-544.947) [-542.298] (-542.393) * [-545.233] (-544.776) (-542.994) (-543.721) -- 0:00:04
921500 -- (-542.938) [-546.259] (-544.813) (-542.530) * (-543.476) (-547.217) [-543.851] (-543.840) -- 0:00:04
922000 -- [-543.265] (-549.384) (-543.219) (-543.804) * (-543.081) [-546.824] (-543.918) (-548.065) -- 0:00:04
922500 -- (-543.473) (-545.397) (-542.726) [-544.164] * (-545.112) (-542.684) [-542.413] (-544.357) -- 0:00:04
923000 -- [-544.183] (-542.964) (-544.014) (-543.044) * (-546.782) (-542.738) [-542.925] (-543.766) -- 0:00:04
923500 -- (-542.503) (-544.562) [-543.888] (-543.351) * [-543.614] (-542.017) (-543.852) (-542.556) -- 0:00:04
924000 -- (-544.350) [-543.027] (-542.404) (-545.128) * (-547.440) (-545.169) (-542.739) [-544.435] -- 0:00:04
924500 -- (-548.266) (-548.420) [-543.862] (-547.385) * [-544.159] (-545.371) (-545.954) (-546.672) -- 0:00:04
925000 -- (-549.358) [-544.927] (-543.184) (-545.162) * (-547.731) [-543.659] (-543.410) (-549.406) -- 0:00:04
Average standard deviation of split frequencies: 0.007891
925500 -- (-545.875) (-548.132) (-544.015) [-543.824] * (-546.296) (-547.599) (-542.111) [-544.697] -- 0:00:04
926000 -- (-545.080) (-547.110) [-547.548] (-543.848) * (-543.457) [-548.043] (-542.111) (-543.906) -- 0:00:04
926500 -- (-543.860) (-548.698) (-549.460) [-543.390] * (-543.945) (-550.417) (-550.415) [-543.954] -- 0:00:04
927000 -- (-545.632) [-543.047] (-547.166) (-545.044) * (-542.245) [-543.934] (-543.159) (-543.090) -- 0:00:04
927500 -- (-544.369) (-542.980) (-541.968) [-544.013] * (-544.940) [-544.693] (-548.517) (-542.246) -- 0:00:04
928000 -- [-542.675] (-544.839) (-546.954) (-543.331) * (-544.723) (-542.051) (-545.509) [-546.766] -- 0:00:04
928500 -- (-546.596) (-544.308) (-547.940) [-543.137] * (-544.651) (-545.157) (-545.288) [-542.564] -- 0:00:04
929000 -- (-541.586) [-542.494] (-545.282) (-547.208) * [-545.727] (-544.125) (-545.401) (-542.680) -- 0:00:04
929500 -- (-543.063) (-543.440) [-543.529] (-545.712) * (-542.628) (-546.668) [-544.170] (-544.196) -- 0:00:04
930000 -- [-543.630] (-543.505) (-543.264) (-541.849) * [-543.467] (-547.538) (-546.334) (-543.121) -- 0:00:04
Average standard deviation of split frequencies: 0.007946
930500 -- (-542.163) [-544.180] (-544.503) (-545.892) * (-544.045) (-544.456) (-546.605) [-541.916] -- 0:00:04
931000 -- (-543.388) (-544.825) [-542.584] (-543.832) * (-547.116) (-546.750) (-547.906) [-542.984] -- 0:00:04
931500 -- (-543.161) (-543.942) [-543.434] (-542.391) * (-543.010) (-543.747) (-543.772) [-544.602] -- 0:00:04
932000 -- (-544.711) (-544.978) (-545.927) [-541.915] * [-542.290] (-542.663) (-545.102) (-545.736) -- 0:00:04
932500 -- (-543.166) (-541.835) (-546.905) [-542.932] * (-543.808) (-543.880) (-543.828) [-544.170] -- 0:00:04
933000 -- (-546.758) (-541.908) (-547.028) [-542.031] * [-544.761] (-543.069) (-543.378) (-543.023) -- 0:00:04
933500 -- (-543.694) (-544.789) (-545.382) [-544.586] * (-542.556) (-544.718) (-543.688) [-543.008] -- 0:00:03
934000 -- [-542.384] (-543.703) (-541.702) (-542.635) * [-545.570] (-542.859) (-544.456) (-542.055) -- 0:00:03
934500 -- (-542.824) (-547.412) [-544.618] (-545.824) * (-543.257) (-545.824) [-542.692] (-542.548) -- 0:00:03
935000 -- (-542.153) (-544.065) [-542.220] (-546.223) * [-544.542] (-542.927) (-551.377) (-543.145) -- 0:00:03
Average standard deviation of split frequencies: 0.007303
935500 -- (-542.201) (-542.868) [-543.472] (-544.432) * (-545.991) (-544.212) [-548.509] (-542.097) -- 0:00:03
936000 -- (-543.279) (-541.940) [-544.176] (-545.014) * (-542.814) [-543.636] (-546.112) (-542.930) -- 0:00:03
936500 -- [-543.147] (-544.001) (-543.084) (-542.839) * (-548.266) [-542.451] (-546.695) (-543.944) -- 0:00:03
937000 -- (-541.836) (-542.660) [-544.700] (-546.227) * (-545.379) (-546.513) [-543.165] (-544.865) -- 0:00:03
937500 -- (-542.768) (-542.966) (-543.608) [-544.830] * [-544.002] (-546.799) (-542.605) (-542.688) -- 0:00:03
938000 -- (-543.783) (-543.161) (-543.001) [-543.487] * (-542.661) (-548.101) (-544.194) [-544.029] -- 0:00:03
938500 -- (-544.616) (-542.150) (-543.003) [-542.364] * (-541.998) (-544.229) [-545.417] (-543.467) -- 0:00:03
939000 -- [-542.495] (-543.837) (-545.548) (-545.764) * (-541.965) [-542.837] (-545.204) (-545.151) -- 0:00:03
939500 -- (-543.921) (-543.940) (-546.693) [-546.771] * (-546.885) [-545.989] (-546.100) (-548.782) -- 0:00:03
940000 -- (-542.600) (-544.310) [-542.219] (-544.994) * (-542.404) (-548.253) [-544.034] (-546.733) -- 0:00:03
Average standard deviation of split frequencies: 0.007016
940500 -- (-545.945) (-545.290) (-543.539) [-543.013] * (-542.719) (-548.989) [-541.818] (-545.188) -- 0:00:03
941000 -- (-545.058) [-546.719] (-543.476) (-543.262) * [-542.781] (-548.507) (-548.492) (-542.507) -- 0:00:03
941500 -- [-543.284] (-543.040) (-543.515) (-546.092) * (-544.023) [-542.445] (-548.492) (-543.491) -- 0:00:03
942000 -- (-542.876) (-543.529) (-545.974) [-543.121] * [-545.522] (-542.313) (-544.752) (-542.817) -- 0:00:03
942500 -- [-544.487] (-543.977) (-544.534) (-545.605) * (-548.194) (-542.902) [-543.328] (-546.888) -- 0:00:03
943000 -- (-544.879) [-543.490] (-544.314) (-543.952) * (-545.358) (-544.222) [-541.903] (-547.226) -- 0:00:03
943500 -- (-543.496) (-544.796) (-546.210) [-542.192] * (-544.228) (-544.019) [-543.581] (-544.603) -- 0:00:03
944000 -- (-549.591) (-543.144) (-542.767) [-541.868] * (-545.122) [-544.412] (-544.135) (-544.565) -- 0:00:03
944500 -- (-543.495) (-544.090) (-544.125) [-545.399] * (-545.215) [-544.140] (-543.358) (-542.567) -- 0:00:03
945000 -- (-543.884) (-546.328) [-543.614] (-545.745) * (-546.146) [-543.265] (-542.176) (-546.562) -- 0:00:03
Average standard deviation of split frequencies: 0.007039
945500 -- (-543.171) (-546.626) (-542.347) [-543.314] * (-544.051) (-545.904) [-543.694] (-545.278) -- 0:00:03
946000 -- (-548.755) (-547.888) [-542.863] (-544.001) * (-543.626) (-542.821) (-543.448) [-542.170] -- 0:00:03
946500 -- (-544.245) (-547.782) [-541.930] (-543.344) * (-542.296) (-545.210) [-543.992] (-544.679) -- 0:00:03
947000 -- (-543.118) (-544.877) (-543.383) [-545.762] * (-542.478) (-542.973) (-542.214) [-543.350] -- 0:00:03
947500 -- (-543.298) (-542.627) [-542.440] (-542.214) * (-544.570) [-542.796] (-543.497) (-545.969) -- 0:00:03
948000 -- (-544.861) [-542.490] (-542.223) (-542.190) * (-544.632) (-542.967) [-542.132] (-542.302) -- 0:00:03
948500 -- [-544.291] (-543.620) (-543.423) (-541.786) * (-546.754) [-543.172] (-543.914) (-544.298) -- 0:00:03
949000 -- [-543.919] (-544.643) (-542.840) (-546.190) * (-544.382) (-541.973) [-543.130] (-542.892) -- 0:00:03
949500 -- (-541.855) [-542.703] (-542.103) (-546.855) * (-544.475) [-541.839] (-544.248) (-545.994) -- 0:00:03
950000 -- (-541.885) [-545.961] (-542.953) (-546.927) * (-549.045) [-541.839] (-544.432) (-548.738) -- 0:00:03
Average standard deviation of split frequencies: 0.006818
950500 -- (-542.286) (-544.301) [-542.917] (-543.863) * [-542.760] (-542.541) (-546.843) (-543.908) -- 0:00:02
951000 -- (-543.734) [-545.852] (-542.422) (-545.132) * (-547.159) (-542.682) [-543.693] (-543.911) -- 0:00:02
951500 -- (-543.097) (-552.499) [-543.702] (-544.202) * (-545.661) (-545.164) [-543.842] (-542.139) -- 0:00:02
952000 -- (-545.054) (-548.712) [-543.466] (-544.223) * [-544.503] (-542.924) (-546.154) (-543.933) -- 0:00:02
952500 -- (-545.410) (-544.961) (-542.387) [-547.644] * (-542.593) (-544.782) (-543.512) [-543.219] -- 0:00:02
953000 -- (-546.401) (-543.234) [-543.337] (-544.993) * (-542.798) [-546.066] (-546.283) (-544.338) -- 0:00:02
953500 -- [-544.445] (-542.843) (-543.745) (-546.230) * (-542.253) [-543.234] (-542.842) (-544.620) -- 0:00:02
954000 -- [-542.911] (-545.725) (-543.975) (-544.633) * (-543.514) (-544.732) [-543.837] (-543.029) -- 0:00:02
954500 -- (-551.003) (-544.267) (-545.701) [-542.359] * (-543.770) (-541.982) (-544.057) [-541.772] -- 0:00:02
955000 -- (-542.038) (-541.881) (-545.193) [-543.069] * (-543.231) [-542.136] (-541.920) (-544.384) -- 0:00:02
Average standard deviation of split frequencies: 0.006441
955500 -- (-545.722) (-545.330) (-550.019) [-545.712] * (-543.518) (-547.516) (-545.805) [-544.388] -- 0:00:02
956000 -- (-547.596) (-544.579) [-542.631] (-546.049) * [-543.623] (-547.012) (-542.930) (-544.147) -- 0:00:02
956500 -- (-543.557) (-543.929) [-543.606] (-543.572) * (-544.960) (-544.319) [-543.683] (-544.041) -- 0:00:02
957000 -- (-543.203) (-543.531) [-543.183] (-542.131) * (-545.331) [-542.957] (-544.598) (-544.122) -- 0:00:02
957500 -- (-547.487) (-543.144) (-543.321) [-545.915] * (-543.343) (-544.966) [-544.270] (-544.347) -- 0:00:02
958000 -- (-543.883) [-544.196] (-542.894) (-548.097) * [-543.443] (-543.949) (-542.559) (-543.712) -- 0:00:02
958500 -- (-542.774) [-547.736] (-544.322) (-547.099) * [-542.412] (-544.044) (-542.612) (-542.813) -- 0:00:02
959000 -- (-542.846) (-548.667) [-545.342] (-547.233) * (-543.491) (-542.630) [-541.975] (-544.151) -- 0:00:02
959500 -- (-545.386) [-545.207] (-547.918) (-543.902) * (-546.442) [-543.987] (-543.323) (-542.662) -- 0:00:02
960000 -- (-544.453) (-543.743) [-544.255] (-543.814) * (-543.175) [-542.177] (-542.462) (-543.024) -- 0:00:02
Average standard deviation of split frequencies: 0.006809
960500 -- (-543.415) (-543.049) (-542.015) [-546.693] * (-545.696) [-541.968] (-542.280) (-543.532) -- 0:00:02
961000 -- [-543.008] (-547.568) (-543.387) (-546.065) * [-544.211] (-544.244) (-542.042) (-542.113) -- 0:00:02
961500 -- [-545.432] (-544.662) (-543.449) (-545.581) * (-543.927) (-544.866) [-544.847] (-543.092) -- 0:00:02
962000 -- [-546.435] (-544.910) (-543.610) (-544.987) * (-547.086) (-544.597) (-543.062) [-543.934] -- 0:00:02
962500 -- (-544.253) [-542.603] (-544.330) (-545.202) * (-545.500) [-543.838] (-546.200) (-543.048) -- 0:00:02
963000 -- (-544.853) (-542.641) [-543.797] (-542.583) * (-545.356) (-543.781) (-545.509) [-542.378] -- 0:00:02
963500 -- (-543.328) (-543.024) (-542.218) [-541.655] * [-546.684] (-547.030) (-546.491) (-544.413) -- 0:00:02
964000 -- (-548.704) [-542.182] (-542.148) (-543.133) * (-544.297) (-542.487) [-544.393] (-544.853) -- 0:00:02
964500 -- (-546.313) [-542.320] (-544.102) (-542.277) * (-541.806) [-544.509] (-547.419) (-543.146) -- 0:00:02
965000 -- (-543.648) [-545.091] (-543.977) (-546.254) * [-542.305] (-542.942) (-545.840) (-542.856) -- 0:00:02
Average standard deviation of split frequencies: 0.006923
965500 -- (-544.121) (-545.860) (-544.152) [-545.643] * (-541.945) (-543.813) (-547.321) [-546.662] -- 0:00:02
966000 -- [-544.207] (-545.199) (-542.342) (-542.764) * (-542.881) (-544.527) (-543.818) [-542.652] -- 0:00:02
966500 -- [-543.650] (-543.544) (-545.242) (-544.907) * [-548.208] (-549.896) (-542.747) (-543.794) -- 0:00:02
967000 -- [-543.048] (-542.574) (-542.731) (-544.259) * (-545.775) (-543.473) (-543.325) [-542.491] -- 0:00:01
967500 -- (-542.703) (-542.360) (-544.955) [-542.656] * (-542.435) (-543.992) [-542.621] (-543.665) -- 0:00:01
968000 -- (-543.981) (-542.565) (-543.852) [-543.179] * (-543.218) (-547.230) (-545.495) [-543.467] -- 0:00:01
968500 -- (-546.062) (-542.038) [-545.004] (-543.179) * (-543.639) [-546.288] (-545.772) (-546.556) -- 0:00:01
969000 -- (-542.139) (-542.398) (-545.125) [-542.059] * (-545.181) (-543.027) [-546.636] (-544.992) -- 0:00:01
969500 -- [-542.424] (-545.654) (-543.347) (-545.829) * (-547.688) [-543.400] (-542.494) (-543.954) -- 0:00:01
970000 -- (-543.028) (-545.006) (-542.818) [-545.912] * (-544.855) (-544.207) (-545.771) [-542.324] -- 0:00:01
Average standard deviation of split frequencies: 0.006890
970500 -- (-543.082) [-544.821] (-542.746) (-544.286) * (-543.023) (-545.548) [-546.610] (-544.526) -- 0:00:01
971000 -- (-546.794) (-547.647) (-543.497) [-542.387] * (-543.556) (-544.926) (-544.990) [-543.632] -- 0:00:01
971500 -- (-544.350) [-544.970] (-543.877) (-544.993) * (-543.730) (-543.364) (-542.890) [-545.903] -- 0:00:01
972000 -- (-544.021) [-546.774] (-544.766) (-543.426) * (-543.120) (-542.320) (-546.143) [-543.160] -- 0:00:01
972500 -- (-544.349) (-545.700) (-542.015) [-543.015] * (-544.665) (-544.699) [-542.328] (-543.096) -- 0:00:01
973000 -- [-545.005] (-545.492) (-541.855) (-545.699) * [-542.525] (-544.052) (-543.226) (-542.759) -- 0:00:01
973500 -- (-544.526) (-547.348) [-544.063] (-544.548) * [-543.495] (-543.445) (-542.480) (-542.618) -- 0:00:01
974000 -- (-542.330) [-543.668] (-544.005) (-542.865) * (-542.147) [-543.043] (-541.775) (-543.278) -- 0:00:01
974500 -- [-544.908] (-544.875) (-546.219) (-543.332) * (-542.605) (-542.973) (-543.049) [-545.797] -- 0:00:01
975000 -- (-544.116) (-545.142) [-541.870] (-544.079) * [-543.285] (-544.655) (-542.630) (-542.044) -- 0:00:01
Average standard deviation of split frequencies: 0.006641
975500 -- (-544.511) [-543.504] (-541.774) (-542.020) * (-545.244) [-542.506] (-546.756) (-542.918) -- 0:00:01
976000 -- (-545.553) (-544.896) (-542.331) [-542.234] * (-542.794) (-544.251) (-546.056) [-543.382] -- 0:00:01
976500 -- (-542.279) [-543.451] (-543.521) (-546.155) * (-547.701) [-544.725] (-545.002) (-545.812) -- 0:00:01
977000 -- (-541.980) (-542.700) (-542.662) [-543.104] * [-542.865] (-546.536) (-543.873) (-544.802) -- 0:00:01
977500 -- (-545.663) [-542.727] (-542.456) (-550.024) * [-542.311] (-542.483) (-544.423) (-542.561) -- 0:00:01
978000 -- (-543.748) (-542.918) (-543.511) [-544.437] * (-544.757) (-544.501) [-542.405] (-543.617) -- 0:00:01
978500 -- (-543.197) (-543.585) [-545.023] (-543.271) * (-545.021) (-547.200) [-542.513] (-545.710) -- 0:00:01
979000 -- (-544.410) (-544.025) [-544.048] (-546.676) * (-542.174) (-542.391) (-542.343) [-543.877] -- 0:00:01
979500 -- (-545.554) (-543.297) (-543.853) [-544.732] * [-542.138] (-543.083) (-543.237) (-543.058) -- 0:00:01
980000 -- (-549.211) (-544.519) (-545.057) [-544.760] * (-543.857) (-545.306) [-543.025] (-543.653) -- 0:00:01
Average standard deviation of split frequencies: 0.006640
980500 -- [-544.193] (-543.424) (-550.031) (-547.313) * (-544.981) (-544.451) [-542.448] (-544.696) -- 0:00:01
981000 -- (-544.492) [-543.201] (-552.688) (-545.482) * (-544.432) (-545.833) [-543.634] (-544.947) -- 0:00:01
981500 -- (-545.403) [-543.018] (-547.361) (-542.270) * (-542.344) (-547.446) (-544.424) [-544.117] -- 0:00:01
982000 -- (-544.218) (-552.287) (-547.210) [-542.505] * (-543.370) (-542.582) [-542.623] (-548.100) -- 0:00:01
982500 -- (-543.832) [-544.749] (-542.518) (-544.967) * (-543.084) (-542.510) (-543.936) [-544.062] -- 0:00:01
983000 -- (-542.353) (-546.162) [-542.775] (-545.395) * [-543.115] (-542.790) (-542.882) (-543.729) -- 0:00:01
983500 -- [-544.082] (-543.258) (-545.186) (-545.344) * (-542.359) (-544.645) (-543.729) [-543.042] -- 0:00:01
984000 -- (-544.511) [-543.468] (-543.974) (-545.525) * (-543.254) (-543.169) [-543.130] (-543.703) -- 0:00:00
984500 -- (-543.525) [-541.779] (-545.839) (-543.518) * (-543.923) (-545.443) [-542.853] (-545.265) -- 0:00:00
985000 -- (-544.999) (-543.787) (-541.969) [-544.011] * (-543.567) (-543.670) [-543.896] (-543.064) -- 0:00:00
Average standard deviation of split frequencies: 0.006514
985500 -- (-549.853) (-549.968) [-542.733] (-544.817) * (-542.740) (-542.837) [-543.496] (-549.574) -- 0:00:00
986000 -- (-544.911) (-547.971) [-542.456] (-544.992) * [-542.948] (-545.393) (-543.318) (-544.782) -- 0:00:00
986500 -- (-542.611) (-542.947) (-544.213) [-543.929] * [-542.034] (-541.589) (-542.082) (-548.534) -- 0:00:00
987000 -- [-543.743] (-546.652) (-544.299) (-544.119) * (-546.074) [-542.802] (-542.082) (-550.792) -- 0:00:00
987500 -- (-545.222) [-543.139] (-543.834) (-547.875) * (-551.059) [-544.129] (-543.767) (-543.487) -- 0:00:00
988000 -- [-543.707] (-543.782) (-544.672) (-542.529) * (-542.635) (-543.756) (-545.524) [-543.144] -- 0:00:00
988500 -- (-544.333) (-545.803) (-542.415) [-544.704] * (-542.157) (-547.582) (-546.046) [-544.052] -- 0:00:00
989000 -- (-543.232) (-543.584) [-543.855] (-544.499) * (-545.073) (-550.517) [-544.603] (-544.651) -- 0:00:00
989500 -- (-548.022) (-542.252) (-544.220) [-542.727] * (-546.477) [-546.612] (-545.247) (-543.208) -- 0:00:00
990000 -- [-542.620] (-545.290) (-544.934) (-542.753) * (-545.882) (-545.164) [-546.115] (-544.397) -- 0:00:00
Average standard deviation of split frequencies: 0.006513
990500 -- [-545.336] (-543.972) (-543.919) (-544.192) * (-549.834) (-544.166) [-544.057] (-544.203) -- 0:00:00
991000 -- (-543.069) (-544.007) [-542.867] (-542.016) * (-544.302) (-543.771) (-546.803) [-543.951] -- 0:00:00
991500 -- (-543.611) (-544.235) (-542.389) [-543.140] * [-542.984] (-543.183) (-544.091) (-546.620) -- 0:00:00
992000 -- (-548.898) [-543.144] (-544.496) (-542.815) * [-542.966] (-542.488) (-543.953) (-548.032) -- 0:00:00
992500 -- (-544.842) [-542.642] (-544.118) (-542.071) * [-543.231] (-548.341) (-543.920) (-544.097) -- 0:00:00
993000 -- [-543.977] (-543.590) (-543.437) (-542.118) * (-542.346) (-542.836) (-541.936) [-547.404] -- 0:00:00
993500 -- (-544.471) (-543.091) (-544.135) [-544.349] * (-542.275) [-541.977] (-543.263) (-543.391) -- 0:00:00
994000 -- (-546.513) [-545.087] (-544.137) (-542.248) * [-543.742] (-542.646) (-546.762) (-545.080) -- 0:00:00
994500 -- (-542.686) [-543.900] (-544.551) (-542.600) * [-542.118] (-542.477) (-545.753) (-543.839) -- 0:00:00
995000 -- [-543.726] (-542.131) (-543.845) (-543.208) * (-544.083) (-544.831) (-546.637) [-543.445] -- 0:00:00
Average standard deviation of split frequencies: 0.006863
995500 -- (-542.681) [-542.642] (-542.401) (-543.239) * (-543.086) [-545.074] (-542.693) (-545.016) -- 0:00:00
996000 -- [-546.489] (-541.942) (-544.105) (-547.688) * [-543.339] (-542.395) (-543.433) (-544.743) -- 0:00:00
996500 -- (-545.757) [-542.238] (-544.748) (-543.732) * (-542.464) (-541.885) [-543.561] (-546.747) -- 0:00:00
997000 -- (-542.415) (-543.666) [-543.269] (-543.851) * [-543.282] (-544.406) (-545.128) (-546.581) -- 0:00:00
997500 -- (-544.219) [-543.857] (-541.690) (-542.318) * (-543.211) (-545.322) (-543.794) [-543.992] -- 0:00:00
998000 -- (-542.216) (-542.410) (-541.544) [-543.093] * [-543.139] (-542.429) (-543.983) (-544.721) -- 0:00:00
998500 -- [-543.791] (-544.368) (-543.734) (-541.838) * (-543.516) [-542.607] (-543.356) (-544.062) -- 0:00:00
999000 -- [-543.285] (-543.079) (-546.910) (-544.331) * (-544.740) [-542.656] (-542.707) (-544.146) -- 0:00:00
999500 -- (-544.061) [-544.582] (-546.778) (-544.780) * (-544.869) (-543.828) [-542.541] (-546.028) -- 0:00:00
1000000 -- (-543.473) (-545.632) (-545.371) [-543.289] * (-542.214) [-545.173] (-545.455) (-543.932) -- 0:00:00
Average standard deviation of split frequencies: 0.006536
Analysis completed in 1 mins 1 seconds
Analysis used 59.15 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -541.47
Likelihood of best state for "cold" chain of run 2 was -541.47
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.9 % ( 75 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
34.1 % ( 28 %) Dirichlet(Pi{all})
35.6 % ( 25 %) Slider(Pi{all})
78.7 % ( 52 %) Multiplier(Alpha{1,2})
77.6 % ( 54 %) Multiplier(Alpha{3})
24.8 % ( 22 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
69.9 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.4 % ( 94 %) Nodeslider(V{all})
30.5 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.6 % ( 76 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
34.8 % ( 28 %) Dirichlet(Pi{all})
34.7 % ( 22 %) Slider(Pi{all})
78.4 % ( 56 %) Multiplier(Alpha{1,2})
77.8 % ( 54 %) Multiplier(Alpha{3})
24.6 % ( 27 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.4 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.6 % ( 32 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166681 0.82 0.67
3 | 166731 166532 0.84
4 | 166405 166656 166995
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166399 0.82 0.67
3 | 166492 166356 0.84
4 | 166726 167553 166474
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -542.98
| 1 2 |
| |
| |
| 1 2 2 22 1 |
| 1 2 1 1 2 2 11 |
|2 1 2 2 2 1 1 1|
| 1 22 *1 1 211 1 221 2 2 1 1 1 |
|1 2 1 111 2 2 1 1 2 2 12 2 1 2|
| 221 2 1 2 1 2 2 *1 12 2 1 |
| 2 2 1 122 * 1 21 211 1*2 2 |
| 22 1 22 1 1 2 *1 2 2 |
| 1 2 1 1 2 1 |
| 1 1 |
| 2 1 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -544.81
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -543.22 -545.99
2 -543.20 -546.98
--------------------------------------
TOTAL -543.21 -546.60
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896963 0.087761 0.358108 1.471668 0.863861 1345.51 1363.50 1.000
r(A<->C){all} 0.167083 0.021533 0.000353 0.462665 0.121481 110.92 204.03 1.000
r(A<->G){all} 0.174322 0.021422 0.000052 0.469065 0.137050 190.76 194.14 1.000
r(A<->T){all} 0.162769 0.019544 0.000051 0.453096 0.127326 149.69 218.47 1.001
r(C<->G){all} 0.170991 0.020093 0.000053 0.444861 0.135778 203.54 244.97 1.003
r(C<->T){all} 0.170012 0.022341 0.000021 0.474244 0.125078 168.91 171.48 1.000
r(G<->T){all} 0.154823 0.017442 0.000019 0.415572 0.116871 256.92 300.97 1.000
pi(A){all} 0.224926 0.000429 0.187594 0.267284 0.224310 1245.93 1306.93 1.000
pi(C){all} 0.315179 0.000522 0.271237 0.359032 0.314578 1199.67 1227.87 1.001
pi(G){all} 0.272052 0.000483 0.231833 0.317176 0.271489 1151.53 1228.64 1.000
pi(T){all} 0.187843 0.000384 0.148385 0.224088 0.187255 1081.46 1265.36 1.000
alpha{1,2} 0.431379 0.249288 0.000254 1.430248 0.251010 1122.33 1205.99 1.000
alpha{3} 0.465726 0.254131 0.000103 1.482369 0.284824 1081.51 1184.30 1.000
pinvar{all} 0.995979 0.000022 0.987186 0.999996 0.997451 1258.10 1287.55 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- .**...
9 -- ...**.
10 -- .****.
11 -- .*.***
12 -- ...*.*
13 -- .*...*
14 -- ....**
15 -- ..*.*.
16 -- .***.*
17 -- .**.**
18 -- ..*..*
19 -- .*.*..
20 -- ..****
21 -- ..**..
22 -- ...***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 465 0.154897 0.009893 0.147901 0.161892 2
8 457 0.152232 0.003298 0.149900 0.154564 2
9 453 0.150899 0.012719 0.141905 0.159893 2
10 445 0.148235 0.008009 0.142572 0.153897 2
11 441 0.146902 0.000471 0.146569 0.147235 2
12 438 0.145903 0.002827 0.143904 0.147901 2
13 435 0.144903 0.004240 0.141905 0.147901 2
14 429 0.142905 0.008951 0.136576 0.149234 2
15 419 0.139574 0.008951 0.133245 0.145903 2
16 416 0.138574 0.014133 0.128581 0.148568 2
17 416 0.138574 0.003769 0.135909 0.141239 2
18 415 0.138241 0.000471 0.137908 0.138574 2
19 411 0.136909 0.002355 0.135243 0.138574 2
20 402 0.133911 0.002827 0.131912 0.135909 2
21 386 0.128581 0.007537 0.123251 0.133911 2
22 284 0.094604 0.014133 0.084610 0.104597 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096853 0.009995 0.000035 0.293599 0.065599 1.000 2
length{all}[2] 0.101846 0.010360 0.000054 0.304818 0.072318 1.000 2
length{all}[3] 0.099780 0.009813 0.000161 0.298222 0.070534 1.000 2
length{all}[4] 0.099353 0.009870 0.000030 0.301771 0.067464 1.000 2
length{all}[5] 0.100478 0.009818 0.000038 0.295640 0.071238 1.000 2
length{all}[6] 0.098180 0.009536 0.000040 0.289952 0.068265 1.000 2
length{all}[7] 0.096682 0.009229 0.000555 0.300771 0.067940 0.999 2
length{all}[8] 0.103934 0.010014 0.000041 0.311345 0.071763 0.998 2
length{all}[9] 0.102068 0.009527 0.000087 0.280685 0.072541 0.999 2
length{all}[10] 0.095489 0.009351 0.000340 0.294759 0.066268 0.999 2
length{all}[11] 0.092974 0.008199 0.000416 0.272292 0.066127 0.999 2
length{all}[12] 0.106295 0.011379 0.000219 0.302244 0.074496 0.998 2
length{all}[13] 0.105050 0.010709 0.000228 0.326113 0.071274 0.998 2
length{all}[14] 0.099622 0.009440 0.000348 0.294262 0.071722 1.015 2
length{all}[15] 0.106137 0.011673 0.000181 0.331405 0.068426 1.001 2
length{all}[16] 0.098308 0.008961 0.000210 0.293338 0.070511 1.004 2
length{all}[17] 0.088927 0.006513 0.000223 0.245382 0.066037 0.999 2
length{all}[18] 0.099655 0.009583 0.000087 0.257717 0.072945 1.001 2
length{all}[19] 0.104197 0.010041 0.000255 0.291567 0.073232 0.998 2
length{all}[20] 0.097676 0.009495 0.000061 0.278673 0.066758 1.003 2
length{all}[21] 0.100358 0.010174 0.000379 0.306633 0.073334 0.997 2
length{all}[22] 0.111289 0.012692 0.000032 0.315458 0.075946 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006536
Maximum standard deviation of split frequencies = 0.014133
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.015
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 396
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 52 patterns at 132 / 132 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 52 patterns at 132 / 132 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
50752 bytes for conP
4576 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.079614 0.010108 0.074299 0.108228 0.018892 0.052485 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -572.773748
Iterating by ming2
Initial: fx= 572.773748
x= 0.07961 0.01011 0.07430 0.10823 0.01889 0.05249 0.30000 1.30000
1 h-m-p 0.0000 0.0001 316.7201 ++ 564.992098 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0139 34.5576 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 289.1537 ++ 559.345784 m 0.0001 44 | 2/8
4 h-m-p 0.0006 0.0166 29.0745 -----------.. | 2/8
5 h-m-p 0.0000 0.0003 258.4792 +++ 541.951350 m 0.0003 76 | 3/8
6 h-m-p 0.0026 0.0252 22.0098 ------------.. | 3/8
7 h-m-p 0.0000 0.0002 224.8182 +++ 533.382368 m 0.0002 109 | 4/8
8 h-m-p 0.0021 0.0618 14.8773 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 184.0515 ++ 531.983748 m 0.0000 141 | 5/8
10 h-m-p 0.0006 0.1359 9.7378 -----------.. | 5/8
11 h-m-p 0.0000 0.0002 129.9386 +++ 528.204156 m 0.0002 173 | 6/8
12 h-m-p 0.9035 8.0000 0.0000 ++ 528.204156 m 8.0000 184 | 6/8
13 h-m-p 0.1851 8.0000 0.0002 +++ 528.204156 m 8.0000 198 | 6/8
14 h-m-p 0.0016 0.2883 1.0738 ---------C 528.204156 0 0.0000 220 | 6/8
15 h-m-p 0.0854 8.0000 0.0000 ------------Y 528.204156 0 0.0000 243 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 +++++ 528.204156 m 8.0000 259 | 6/8
17 h-m-p 0.0013 0.6269 2.0765 --------C 528.204156 0 0.0000 280 | 6/8
18 h-m-p 0.0160 8.0000 0.0001 +++++ 528.204156 m 8.0000 294 | 6/8
19 h-m-p 0.0027 1.3642 0.6043 +++++ 528.204148 m 1.3642 310 | 6/8
20 h-m-p -0.0000 -0.0000 0.5098
h-m-p: -1.18243868e-17 -5.91219338e-17 5.09818505e-01 528.204148
.. | 6/8
21 h-m-p 0.0160 8.0000 0.0000 +++++ 528.204148 m 8.0000 336 | 6/8
22 h-m-p 0.0160 8.0000 0.2582 +++++ 528.204139 m 8.0000 352 | 6/8
23 h-m-p 1.4776 8.0000 1.3982 ++ 528.204127 m 8.0000 365 | 6/8
24 h-m-p 1.6000 8.0000 2.2773 ++ 528.204123 m 8.0000 376 | 6/8
25 h-m-p 1.6000 8.0000 9.4184 ++ 528.204120 m 8.0000 387 | 6/8
26 h-m-p 1.6000 8.0000 4.3650 ++ 528.204119 m 8.0000 398 | 6/8
27 h-m-p 1.6000 8.0000 8.1272 ++ 528.204119 m 8.0000 409 | 6/8
28 h-m-p 0.4069 2.0343 101.6346 ----------Y 528.204119 0 0.0000 430 | 6/8
29 h-m-p 1.6000 8.0000 0.0000 --N 528.204119 0 0.0250 443 | 6/8
30 h-m-p 1.6000 8.0000 0.0000 ---N 528.204119 0 0.0063 459
Out..
lnL = -528.204119
460 lfun, 460 eigenQcodon, 2760 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.020024 0.035879 0.046372 0.083308 0.054579 0.019521 67.092326 0.807577 0.184745
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.482507
np = 9
lnL0 = -561.291556
Iterating by ming2
Initial: fx= 561.291556
x= 0.02002 0.03588 0.04637 0.08331 0.05458 0.01952 67.09233 0.80758 0.18474
1 h-m-p 0.0000 0.0002 303.0814 ++ 546.797694 m 0.0002 14 | 1/9
2 h-m-p 0.0000 0.0000 95.3301 ++ 546.445250 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0001 573.9203 ++ 539.080013 m 0.0001 38 | 3/9
4 h-m-p 0.0000 0.0002 671.6996 ++ 533.748402 m 0.0002 50 | 4/9
5 h-m-p 0.0000 0.0000 2319.3884 ++ 532.992038 m 0.0000 62 | 5/9
6 h-m-p 0.0008 0.0039 12.4821 -----------.. | 5/9
7 h-m-p 0.0000 0.0000 182.1919 ++ 531.659013 m 0.0000 95 | 6/9
8 h-m-p 0.0016 0.2322 3.2046 -----------.. | 6/9
9 h-m-p 0.0000 0.0002 128.5388 +++ 528.204205 m 0.0002 129 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 528.204205 m 8.0000 141 | 6/9
11 h-m-p 0.0000 0.0000 0.0061
h-m-p: 2.81633658e-16 1.40816829e-15 6.10035816e-03 528.204205
.. | 6/9
12 h-m-p 0.0160 8.0000 0.0001 +++++ 528.204205 m 8.0000 170 | 6/9
13 h-m-p 0.0075 3.7522 0.2417 +++++ 528.204162 m 3.7522 188 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 C 528.204162 0 0.4000 203 | 7/9
15 h-m-p 0.0160 8.0000 0.0000 -Y 528.204162 0 0.0010 218
Out..
lnL = -528.204162
219 lfun, 657 eigenQcodon, 2628 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.053907 0.017992 0.031645 0.084465 0.104972 0.102475 67.092325 1.173040 0.338092 0.295992 216.143284
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.009912
np = 11
lnL0 = -549.694259
Iterating by ming2
Initial: fx= 549.694259
x= 0.05391 0.01799 0.03164 0.08446 0.10497 0.10247 67.09233 1.17304 0.33809 0.29599 216.14328
1 h-m-p 0.0000 0.0008 52.7616 ++++ 547.180308 m 0.0008 18 | 1/11
2 h-m-p 0.0025 0.0643 14.4981 +++ 535.565338 m 0.0643 33 | 2/11
3 h-m-p 0.0000 0.0000 12442.8730 ++ 535.434771 m 0.0000 47 | 3/11
4 h-m-p 0.0000 0.0000 13915.2893 ++ 534.748524 m 0.0000 61 | 4/11
5 h-m-p 0.0002 0.0011 1069.4605 ++ 531.931245 m 0.0011 75 | 5/11
6 h-m-p 0.0001 0.0007 1006.4897 +CYC 531.717823 2 0.0005 93 | 5/11
7 h-m-p 0.0011 0.0053 5.3284 ++ 531.673283 m 0.0053 107 | 6/11
8 h-m-p 0.0329 5.4652 0.6711 ++++ 528.204200 m 5.4652 123 | 7/11
9 h-m-p 1.6000 8.0000 0.0002 ++ 528.204200 m 8.0000 142 | 7/11
10 h-m-p 0.0160 8.0000 6.3810 -------------.. | 7/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 528.204200 m 8.0000 188 | 6/11
12 h-m-p 0.0160 8.0000 0.2255 +++++ 528.204145 m 8.0000 209 | 6/11
13 h-m-p 0.5584 8.0000 3.2301 ++ 528.204119 m 8.0000 228 | 6/11
14 h-m-p 1.6000 8.0000 0.0001 N 528.204119 0 1.6000 242 | 6/11
15 h-m-p 1.6000 8.0000 0.0000 -C 528.204119 0 0.1000 262 | 6/11
16 h-m-p 0.0160 8.0000 0.0003 N 528.204119 0 0.0040 281
Out..
lnL = -528.204119
282 lfun, 1128 eigenQcodon, 5076 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -528.201082 S = -528.201033 -0.000019
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:02
did 20 / 52 patterns 0:02
did 30 / 52 patterns 0:03
did 40 / 52 patterns 0:03
did 50 / 52 patterns 0:03
did 52 / 52 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.062054 0.103266 0.085789 0.073127 0.045623 0.041553 67.097461 0.438007 1.933960
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.601970
np = 9
lnL0 = -580.386581
Iterating by ming2
Initial: fx= 580.386581
x= 0.06205 0.10327 0.08579 0.07313 0.04562 0.04155 67.09746 0.43801 1.93396
1 h-m-p 0.0000 0.0003 297.6967 +++ 549.880843 m 0.0003 15 | 1/9
2 h-m-p 0.0111 0.2544 8.1732 -------------.. | 1/9
3 h-m-p 0.0000 0.0000 285.5194 ++ 547.251988 m 0.0000 50 | 2/9
4 h-m-p 0.0014 0.4296 6.0124 -----------.. | 2/9
5 h-m-p 0.0000 0.0001 255.2967 ++ 538.620620 m 0.0001 83 | 3/9
6 h-m-p 0.0063 0.6250 4.5972 ------------.. | 3/9
7 h-m-p 0.0000 0.0001 224.2758 ++ 534.141725 m 0.0001 117 | 4/9
8 h-m-p 0.0041 1.0237 3.9388 ------------.. | 4/9
9 h-m-p 0.0000 0.0001 184.3106 ++ 530.662061 m 0.0001 151 | 5/9
10 h-m-p 0.0042 1.7490 3.1208 ------------.. | 5/9
11 h-m-p 0.0000 0.0001 131.0716 ++ 528.204216 m 0.0001 185 | 6/9
12 h-m-p 1.6000 8.0000 0.0000 ++ 528.204216 m 8.0000 197 | 6/9
13 h-m-p 0.1269 8.0000 0.0001 ---Y 528.204216 0 0.0005 215
Out..
lnL = -528.204216
216 lfun, 2376 eigenQcodon, 12960 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.075566 0.016358 0.075670 0.103368 0.056961 0.081421 67.097461 0.900000 1.038780 1.693238 197.634807
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.018912
np = 11
lnL0 = -543.098126
Iterating by ming2
Initial: fx= 543.098126
x= 0.07557 0.01636 0.07567 0.10337 0.05696 0.08142 67.09746 0.90000 1.03878 1.69324 197.63481
1 h-m-p 0.0000 0.0011 96.0817 +++YYYCYCCCCC 538.041389 9 0.0007 33 | 0/11
2 h-m-p 0.0001 0.0004 41.8309 ++ 537.352600 m 0.0004 47 | 1/11
3 h-m-p 0.0057 0.2267 2.9570 +++ 536.967214 m 0.2267 62 | 2/11
4 h-m-p 0.0001 0.0004 2244.2761 ++ 535.409580 m 0.0004 76 | 3/11
5 h-m-p 0.0128 0.0640 1.5132 ++ 533.241913 m 0.0640 90 | 4/11
6 h-m-p 0.0006 0.0029 27.2410 ++ 532.082726 m 0.0029 104 | 4/11
7 h-m-p 0.0000 0.0000 269.7296
h-m-p: 0.00000000e+00 0.00000000e+00 2.69729593e+02 532.082726
.. | 4/11
8 h-m-p 0.0000 0.0001 727.3867 ++ 528.475730 m 0.0001 129 | 5/11
9 h-m-p 0.0000 0.0000 127.5499 ++ 528.204122 m 0.0000 143 | 6/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 528.204122 m 8.0000 157 | 6/11
11 h-m-p 0.3895 8.0000 0.0000 +++ 528.204122 m 8.0000 177 | 6/11
12 h-m-p 0.0160 8.0000 0.0493 -----C 528.204122 0 0.0000 201 | 6/11
13 h-m-p 0.0160 8.0000 0.0001 ---Y 528.204122 0 0.0001 223 | 6/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 528.204122 m 8.0000 245 | 6/11
15 h-m-p 0.0160 8.0000 0.1523 --------Y 528.204122 0 0.0000 272 | 6/11
16 h-m-p 0.0160 8.0000 0.0000 ---C 528.204122 0 0.0001 294 | 6/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 528.204122 m 8.0000 316 | 6/11
18 h-m-p 0.0079 3.9725 0.3121 +++++ 528.204121 m 3.9725 338 | 6/11
19 h-m-p -0.0000 -0.0000 0.6514
h-m-p: -3.31114837e-17 -1.65557418e-16 6.51427588e-01 528.204121
.. | 6/11
20 h-m-p 0.0160 8.0000 0.0000 +++++ 528.204121 m 8.0000 376 | 6/11
21 h-m-p 0.0160 8.0000 0.0694 +++++ 528.204119 m 8.0000 398 | 6/11
22 h-m-p 1.6000 8.0000 0.0218 ++ 528.204119 m 8.0000 417 | 6/11
23 h-m-p 0.0921 0.4606 0.3020 ++ 528.204119 m 0.4606 436 | 7/11
24 h-m-p 0.0648 8.0000 0.0019 ++++ 528.204119 m 8.0000 457 | 7/11
25 h-m-p 0.0376 8.0000 0.4099 ++++ 528.204119 m 8.0000 477 | 7/11
26 h-m-p 0.0476 8.0000 68.8532 ++++ 528.204118 m 8.0000 497 | 7/11
27 h-m-p 0.0172 0.0862 6427.3125 -------Y 528.204118 0 0.0000 518 | 7/11
28 h-m-p 1.6000 8.0000 0.0004 ++ 528.204118 m 8.0000 532 | 7/11
29 h-m-p 1.6000 8.0000 0.0005 --------Y 528.204118 0 0.0000 558
Out..
lnL = -528.204118
559 lfun, 6708 eigenQcodon, 36894 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -528.201039 S = -528.201024 -0.000006
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:16
did 20 / 52 patterns 0:17
did 30 / 52 patterns 0:17
did 40 / 52 patterns 0:17
did 50 / 52 patterns 0:17
did 52 / 52 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=132
NC_011896_1_WP_010908408_1_1664_MLBR_RS07895 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
NC_002677_1_NP_302087_1_959_ML1572 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
NZ_LVXE01000006_1_WP_010908408_1_2288_A3216_RS03625 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
NZ_LYPH01000002_1_WP_010908408_1_256_A8144_RS01215 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
NZ_CP029543_1_WP_010908408_1_1695_DIJ64_RS08625 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
NZ_AP014567_1_WP_010908408_1_1738_JK2ML_RS08840 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF
**************************************************
NC_011896_1_WP_010908408_1_1664_MLBR_RS07895 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NC_002677_1_NP_302087_1_959_ML1572 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NZ_LVXE01000006_1_WP_010908408_1_2288_A3216_RS03625 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NZ_LYPH01000002_1_WP_010908408_1_256_A8144_RS01215 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NZ_CP029543_1_WP_010908408_1_1695_DIJ64_RS08625 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
NZ_AP014567_1_WP_010908408_1_1738_JK2ML_RS08840 GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV
**************************************************
NC_011896_1_WP_010908408_1_1664_MLBR_RS07895 NADPTSARRNTGGRRRAANALPTHSTPAPQST
NC_002677_1_NP_302087_1_959_ML1572 NADPTSARRNTGGRRRAANALPTHSTPAPQST
NZ_LVXE01000006_1_WP_010908408_1_2288_A3216_RS03625 NADPTSARRNTGGRRRAANALPTHSTPAPQST
NZ_LYPH01000002_1_WP_010908408_1_256_A8144_RS01215 NADPTSARRNTGGRRRAANALPTHSTPAPQST
NZ_CP029543_1_WP_010908408_1_1695_DIJ64_RS08625 NADPTSARRNTGGRRRAANALPTHSTPAPQST
NZ_AP014567_1_WP_010908408_1_1738_JK2ML_RS08840 NADPTSARRNTGGRRRAANALPTHSTPAPQST
********************************
>NC_011896_1_WP_010908408_1_1664_MLBR_RS07895 TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG >NC_002677_1_NP_302087_1_959_ML1572 TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG >NZ_LVXE01000006_1_WP_010908408_1_2288_A3216_RS03625 TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG >NZ_LYPH01000002_1_WP_010908408_1_256_A8144_RS01215 TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG >NZ_CP029543_1_WP_010908408_1_1695_DIJ64_RS08625 TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG >NZ_AP014567_1_WP_010908408_1_1738_JK2ML_RS08840 TTGACCTACGCAGCATATCGCGATGTGCGGTTTGTTCTCACAAACATGAC CGAGGACTACACCCAGCAGTTGGCCGACGAGGTTTCGCGCAGGGACGGGT CTGGTCTATGGCTATATATTACCGAACTAGACACCGCAGCTCATGCGTTC GGTATCGGTTCTTACCAATGGCACGACGCAGCGGCCCACGTCAATGGATT GCTGACCCACCTGACTGAGGTGCTGCCCCGGAATGCAGTGCTGCTGGTGA CCGCCAACCATGGCGTCCTTAACGTCCCCAACGACTCAAGCATCGACGTC AACGCCGACCCGACTAGTGCACGAAGGAATACGGGTGGTCGCCGGAGAGC CGCGAATGCGCTACCTACACACTCAACCCCAGCGCCGCAGTCGACG
>NC_011896_1_WP_010908408_1_1664_MLBR_RS07895 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV NADPTSARRNTGGRRRAANALPTHSTPAPQST >NC_002677_1_NP_302087_1_959_ML1572 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV NADPTSARRNTGGRRRAANALPTHSTPAPQST >NZ_LVXE01000006_1_WP_010908408_1_2288_A3216_RS03625 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV NADPTSARRNTGGRRRAANALPTHSTPAPQST >NZ_LYPH01000002_1_WP_010908408_1_256_A8144_RS01215 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV NADPTSARRNTGGRRRAANALPTHSTPAPQST >NZ_CP029543_1_WP_010908408_1_1695_DIJ64_RS08625 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV NADPTSARRNTGGRRRAANALPTHSTPAPQST >NZ_AP014567_1_WP_010908408_1_1738_JK2ML_RS08840 LTYAAYRDVRFVLTNMTEDYTQQLADEVSRRDGSGLWLYITELDTAAHAF GIGSYQWHDAAAHVNGLLTHLTEVLPRNAVLLVTANHGVLNVPNDSSIDV NADPTSARRNTGGRRRAANALPTHSTPAPQST
#NEXUS
[ID: 5616366484]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908408_1_1664_MLBR_RS07895
NC_002677_1_NP_302087_1_959_ML1572
NZ_LVXE01000006_1_WP_010908408_1_2288_A3216_RS03625
NZ_LYPH01000002_1_WP_010908408_1_256_A8144_RS01215
NZ_CP029543_1_WP_010908408_1_1695_DIJ64_RS08625
NZ_AP014567_1_WP_010908408_1_1738_JK2ML_RS08840
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908408_1_1664_MLBR_RS07895,
2 NC_002677_1_NP_302087_1_959_ML1572,
3 NZ_LVXE01000006_1_WP_010908408_1_2288_A3216_RS03625,
4 NZ_LYPH01000002_1_WP_010908408_1_256_A8144_RS01215,
5 NZ_CP029543_1_WP_010908408_1_1695_DIJ64_RS08625,
6 NZ_AP014567_1_WP_010908408_1_1738_JK2ML_RS08840
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06559917,2:0.07231824,3:0.07053424,4:0.06746424,5:0.07123755,6:0.06826454);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06559917,2:0.07231824,3:0.07053424,4:0.06746424,5:0.07123755,6:0.06826454);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -543.22 -545.99
2 -543.20 -546.98
--------------------------------------
TOTAL -543.21 -546.60
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1572/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896963 0.087761 0.358108 1.471668 0.863861 1345.51 1363.50 1.000
r(A<->C){all} 0.167083 0.021533 0.000353 0.462665 0.121481 110.92 204.03 1.000
r(A<->G){all} 0.174322 0.021422 0.000052 0.469065 0.137050 190.76 194.14 1.000
r(A<->T){all} 0.162769 0.019544 0.000051 0.453096 0.127326 149.69 218.47 1.001
r(C<->G){all} 0.170991 0.020093 0.000053 0.444861 0.135778 203.54 244.97 1.003
r(C<->T){all} 0.170012 0.022341 0.000021 0.474244 0.125078 168.91 171.48 1.000
r(G<->T){all} 0.154823 0.017442 0.000019 0.415572 0.116871 256.92 300.97 1.000
pi(A){all} 0.224926 0.000429 0.187594 0.267284 0.224310 1245.93 1306.93 1.000
pi(C){all} 0.315179 0.000522 0.271237 0.359032 0.314578 1199.67 1227.87 1.001
pi(G){all} 0.272052 0.000483 0.231833 0.317176 0.271489 1151.53 1228.64 1.000
pi(T){all} 0.187843 0.000384 0.148385 0.224088 0.187255 1081.46 1265.36 1.000
alpha{1,2} 0.431379 0.249288 0.000254 1.430248 0.251010 1122.33 1205.99 1.000
alpha{3} 0.465726 0.254131 0.000103 1.482369 0.284824 1081.51 1184.30 1.000
pinvar{all} 0.995979 0.000022 0.987186 0.999996 0.997451 1258.10 1287.55 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1572/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 132
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 0 0 0 0 0 0 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 0 0 0 0 0 0
CTC 1 1 1 1 1 1 | CCC 2 2 2 2 2 2 | CAC 4 4 4 4 4 4 | CGC 3 3 3 3 3 3
CTA 4 4 4 4 4 4 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1
CTG 5 5 5 5 5 5 | CCG 2 2 2 2 2 2 | CAG 3 3 3 3 3 3 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 4 4 4 4 4 4 | Ser AGT 1 1 1 1 1 1
ATC 2 2 2 2 2 2 | ACC 8 8 8 8 8 8 | AAC 5 5 5 5 5 5 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 0 0 0 0 0 0 | Arg AGA 1 1 1 1 1 1
Met ATG 1 1 1 1 1 1 | ACG 2 2 2 2 2 2 | AAG 0 0 0 0 0 0 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 1 1 1 1 1 1 | Asp GAT 1 1 1 1 1 1 | Gly GGT 5 5 5 5 5 5
GTC 4 4 4 4 4 4 | GCC 5 5 5 5 5 5 | GAC 8 8 8 8 8 8 | GGC 1 1 1 1 1 1
GTA 0 0 0 0 0 0 | GCA 6 6 6 6 6 6 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1
GTG 4 4 4 4 4 4 | GCG 5 5 5 5 5 5 | GAG 3 3 3 3 3 3 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908408_1_1664_MLBR_RS07895
position 1: T:0.13636 C:0.25758 A:0.24242 G:0.36364
position 2: T:0.22727 C:0.32576 A:0.28030 G:0.16667
position 3: T:0.19697 C:0.36364 A:0.15152 G:0.28788
Average T:0.18687 C:0.31566 A:0.22475 G:0.27273
#2: NC_002677_1_NP_302087_1_959_ML1572
position 1: T:0.13636 C:0.25758 A:0.24242 G:0.36364
position 2: T:0.22727 C:0.32576 A:0.28030 G:0.16667
position 3: T:0.19697 C:0.36364 A:0.15152 G:0.28788
Average T:0.18687 C:0.31566 A:0.22475 G:0.27273
#3: NZ_LVXE01000006_1_WP_010908408_1_2288_A3216_RS03625
position 1: T:0.13636 C:0.25758 A:0.24242 G:0.36364
position 2: T:0.22727 C:0.32576 A:0.28030 G:0.16667
position 3: T:0.19697 C:0.36364 A:0.15152 G:0.28788
Average T:0.18687 C:0.31566 A:0.22475 G:0.27273
#4: NZ_LYPH01000002_1_WP_010908408_1_256_A8144_RS01215
position 1: T:0.13636 C:0.25758 A:0.24242 G:0.36364
position 2: T:0.22727 C:0.32576 A:0.28030 G:0.16667
position 3: T:0.19697 C:0.36364 A:0.15152 G:0.28788
Average T:0.18687 C:0.31566 A:0.22475 G:0.27273
#5: NZ_CP029543_1_WP_010908408_1_1695_DIJ64_RS08625
position 1: T:0.13636 C:0.25758 A:0.24242 G:0.36364
position 2: T:0.22727 C:0.32576 A:0.28030 G:0.16667
position 3: T:0.19697 C:0.36364 A:0.15152 G:0.28788
Average T:0.18687 C:0.31566 A:0.22475 G:0.27273
#6: NZ_AP014567_1_WP_010908408_1_1738_JK2ML_RS08840
position 1: T:0.13636 C:0.25758 A:0.24242 G:0.36364
position 2: T:0.22727 C:0.32576 A:0.28030 G:0.16667
position 3: T:0.19697 C:0.36364 A:0.15152 G:0.28788
Average T:0.18687 C:0.31566 A:0.22475 G:0.27273
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 12 | Tyr Y TAT 12 | Cys C TGT 0
TTC 6 | TCC 0 | TAC 18 | TGC 0
Leu L TTA 0 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 12 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 0
CTC 6 | CCC 12 | CAC 24 | CGC 18
CTA 24 | CCA 6 | Gln Q CAA 6 | CGA 6
CTG 30 | CCG 12 | CAG 18 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 24 | Ser S AGT 6
ATC 12 | ACC 48 | AAC 30 | AGC 6
ATA 0 | ACA 12 | Lys K AAA 0 | Arg R AGA 6
Met M ATG 6 | ACG 12 | AAG 0 | AGG 12
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 6 | Asp D GAT 6 | Gly G GGT 30
GTC 24 | GCC 30 | GAC 48 | GGC 6
GTA 0 | GCA 36 | Glu E GAA 6 | GGA 6
GTG 24 | GCG 30 | GAG 18 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13636 C:0.25758 A:0.24242 G:0.36364
position 2: T:0.22727 C:0.32576 A:0.28030 G:0.16667
position 3: T:0.19697 C:0.36364 A:0.15152 G:0.28788
Average T:0.18687 C:0.31566 A:0.22475 G:0.27273
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -528.204119 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 67.092326 197.634807
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908408_1_1664_MLBR_RS07895: 0.000004, NC_002677_1_NP_302087_1_959_ML1572: 0.000004, NZ_LVXE01000006_1_WP_010908408_1_2288_A3216_RS03625: 0.000004, NZ_LYPH01000002_1_WP_010908408_1_256_A8144_RS01215: 0.000004, NZ_CP029543_1_WP_010908408_1_1695_DIJ64_RS08625: 0.000004, NZ_AP014567_1_WP_010908408_1_1738_JK2ML_RS08840: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 67.09233
omega (dN/dS) = 197.63481
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 270.4 125.6 197.6348 0.0000 0.0000 0.0 0.0
7..2 0.000 270.4 125.6 197.6348 0.0000 0.0000 0.0 0.0
7..3 0.000 270.4 125.6 197.6348 0.0000 0.0000 0.0 0.0
7..4 0.000 270.4 125.6 197.6348 0.0000 0.0000 0.0 0.0
7..5 0.000 270.4 125.6 197.6348 0.0000 0.0000 0.0 0.0
7..6 0.000 270.4 125.6 197.6348 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -528.204162 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 67.092325 0.000010 0.536449
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908408_1_1664_MLBR_RS07895: 0.000004, NC_002677_1_NP_302087_1_959_ML1572: 0.000004, NZ_LVXE01000006_1_WP_010908408_1_2288_A3216_RS03625: 0.000004, NZ_LYPH01000002_1_WP_010908408_1_256_A8144_RS01215: 0.000004, NZ_CP029543_1_WP_010908408_1_1695_DIJ64_RS08625: 0.000004, NZ_AP014567_1_WP_010908408_1_1738_JK2ML_RS08840: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 67.09233
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.53645 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 270.4 125.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 270.4 125.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 270.4 125.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 270.4 125.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 270.4 125.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 270.4 125.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -528.204119 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 67.097461 0.000000 0.291673 0.063118 216.329627
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908408_1_1664_MLBR_RS07895: 0.000004, NC_002677_1_NP_302087_1_959_ML1572: 0.000004, NZ_LVXE01000006_1_WP_010908408_1_2288_A3216_RS03625: 0.000004, NZ_LYPH01000002_1_WP_010908408_1_256_A8144_RS01215: 0.000004, NZ_CP029543_1_WP_010908408_1_1695_DIJ64_RS08625: 0.000004, NZ_AP014567_1_WP_010908408_1_1738_JK2ML_RS08840: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 67.09746
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.29167 0.70833
w: 0.06312 1.00000 216.32963
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 270.4 125.6 153.5237 0.0000 0.0000 0.0 0.0
7..2 0.000 270.4 125.6 153.5237 0.0000 0.0000 0.0 0.0
7..3 0.000 270.4 125.6 153.5237 0.0000 0.0000 0.0 0.0
7..4 0.000 270.4 125.6 153.5237 0.0000 0.0000 0.0 0.0
7..5 0.000 270.4 125.6 153.5237 0.0000 0.0000 0.0 0.0
7..6 0.000 270.4 125.6 153.5237 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908408_1_1664_MLBR_RS07895)
Pr(w>1) post mean +- SE for w
1 L 0.708 153.523
2 T 0.708 153.521
3 Y 0.708 153.522
4 A 0.708 153.523
5 A 0.708 153.523
6 Y 0.708 153.523
7 R 0.708 153.522
8 D 0.708 153.523
9 V 0.708 153.522
10 R 0.708 153.523
11 F 0.708 153.523
12 V 0.708 153.522
13 L 0.708 153.522
14 T 0.708 153.523
15 N 0.708 153.522
16 M 0.708 153.521
17 T 0.708 153.521
18 E 0.708 153.522
19 D 0.708 153.522
20 Y 0.708 153.522
21 T 0.708 153.521
22 Q 0.708 153.523
23 Q 0.708 153.523
24 L 0.708 153.523
25 A 0.708 153.521
26 D 0.708 153.522
27 E 0.708 153.522
28 V 0.708 153.522
29 S 0.708 153.522
30 R 0.708 153.522
31 R 0.708 153.522
32 D 0.708 153.522
33 G 0.708 153.522
34 S 0.708 153.523
35 G 0.708 153.523
36 L 0.708 153.523
37 W 0.708 153.523
38 L 0.708 153.523
39 Y 0.708 153.523
40 I 0.708 153.522
41 T 0.708 153.521
42 E 0.708 153.523
43 L 0.708 153.523
44 D 0.708 153.522
45 T 0.708 153.521
46 A 0.708 153.523
47 A 0.708 153.522
48 H 0.708 153.523
49 A 0.708 153.522
50 F 0.708 153.522
51 G 0.708 153.523
52 I 0.708 153.521
53 G 0.708 153.523
54 S 0.708 153.523
55 Y 0.708 153.522
56 Q 0.708 153.523
57 W 0.708 153.523
58 H 0.708 153.522
59 D 0.708 153.522
60 A 0.708 153.523
61 A 0.708 153.522
62 A 0.708 153.521
63 H 0.708 153.522
64 V 0.708 153.521
65 N 0.708 153.523
66 G 0.708 153.523
67 L 0.708 153.523
68 L 0.708 153.523
69 T 0.708 153.521
70 H 0.708 153.522
71 L 0.708 153.523
72 T 0.708 153.522
73 E 0.708 153.522
74 V 0.708 153.522
75 L 0.708 153.523
76 P 0.708 153.522
77 R 0.708 153.523
78 N 0.708 153.523
79 A 0.708 153.523
80 V 0.708 153.522
81 L 0.708 153.523
82 L 0.708 153.523
83 V 0.708 153.522
84 T 0.708 153.521
85 A 0.708 153.521
86 N 0.708 153.522
87 H 0.708 153.523
88 G 0.708 153.522
89 V 0.708 153.521
90 L 0.708 153.523
91 N 0.708 153.522
92 V 0.708 153.521
93 P 0.708 153.522
94 N 0.708 153.522
95 D 0.708 153.522
96 S 0.708 153.523
97 S 0.708 153.522
98 I 0.708 153.521
99 D 0.708 153.522
100 V 0.708 153.521
101 N 0.708 153.522
102 A 0.708 153.521
103 D 0.708 153.522
104 P 0.708 153.522
105 T 0.708 153.522
106 S 0.708 153.523
107 A 0.708 153.523
108 R 0.708 153.523
109 R 0.708 153.522
110 N 0.708 153.523
111 T 0.708 153.522
112 G 0.708 153.523
113 G 0.708 153.523
114 R 0.708 153.522
115 R 0.708 153.523
116 R 0.708 153.523
117 A 0.708 153.521
118 A 0.708 153.522
119 N 0.708 153.523
120 A 0.708 153.522
121 L 0.708 153.523
122 P 0.708 153.523
123 T 0.708 153.523
124 H 0.708 153.522
125 S 0.708 153.523
126 T 0.708 153.521
127 P 0.708 153.523
128 A 0.708 153.522
129 P 0.708 153.522
130 Q 0.708 153.523
131 S 0.708 153.522
132 T 0.708 153.522
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908408_1_1664_MLBR_RS07895)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -528.204216 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 67.097461 0.438159 1.933780
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908408_1_1664_MLBR_RS07895: 0.000004, NC_002677_1_NP_302087_1_959_ML1572: 0.000004, NZ_LVXE01000006_1_WP_010908408_1_2288_A3216_RS03625: 0.000004, NZ_LYPH01000002_1_WP_010908408_1_256_A8144_RS01215: 0.000004, NZ_CP029543_1_WP_010908408_1_1695_DIJ64_RS08625: 0.000004, NZ_AP014567_1_WP_010908408_1_1738_JK2ML_RS08840: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 67.09746
Parameters in M7 (beta):
p = 0.43816 q = 1.93378
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00049 0.00600 0.01941 0.04246 0.07711 0.12596 0.19310 0.28573 0.41940 0.64665
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 270.4 125.6 0.1816 0.0000 0.0000 0.0 0.0
7..2 0.000 270.4 125.6 0.1816 0.0000 0.0000 0.0 0.0
7..3 0.000 270.4 125.6 0.1816 0.0000 0.0000 0.0 0.0
7..4 0.000 270.4 125.6 0.1816 0.0000 0.0000 0.0 0.0
7..5 0.000 270.4 125.6 0.1816 0.0000 0.0000 0.0 0.0
7..6 0.000 270.4 125.6 0.1816 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -528.204118 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 325.127618 0.000010 82.019647 24.811023 680.645796
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908408_1_1664_MLBR_RS07895: 0.000004, NC_002677_1_NP_302087_1_959_ML1572: 0.000004, NZ_LVXE01000006_1_WP_010908408_1_2288_A3216_RS03625: 0.000004, NZ_LYPH01000002_1_WP_010908408_1_256_A8144_RS01215: 0.000004, NZ_CP029543_1_WP_010908408_1_1695_DIJ64_RS08625: 0.000004, NZ_AP014567_1_WP_010908408_1_1738_JK2ML_RS08840: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 325.12762
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 82.01965 q = 24.81102
(p1 = 0.99999) w = 680.64580
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.69808 0.72539 0.74115 0.75345 0.76427 0.77453 0.78491 0.79618 0.80985 0.83170 680.64580
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 269.4 126.6 680.6390 0.0000 0.0000 0.0 0.0
7..2 0.000 269.4 126.6 680.6390 0.0000 0.0000 0.0 0.0
7..3 0.000 269.4 126.6 680.6390 0.0000 0.0000 0.0 0.0
7..4 0.000 269.4 126.6 680.6390 0.0000 0.0000 0.0 0.0
7..5 0.000 269.4 126.6 680.6390 0.0000 0.0000 0.0 0.0
7..6 0.000 269.4 126.6 680.6390 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908408_1_1664_MLBR_RS07895)
Pr(w>1) post mean +- SE for w
1 L 1.000** 680.639
2 T 1.000** 680.639
3 Y 1.000** 680.639
4 A 1.000** 680.639
5 A 1.000** 680.639
6 Y 1.000** 680.639
7 R 1.000** 680.639
8 D 1.000** 680.639
9 V 1.000** 680.639
10 R 1.000** 680.639
11 F 1.000** 680.639
12 V 1.000** 680.639
13 L 1.000** 680.639
14 T 1.000** 680.639
15 N 1.000** 680.639
16 M 1.000** 680.639
17 T 1.000** 680.639
18 E 1.000** 680.639
19 D 1.000** 680.639
20 Y 1.000** 680.639
21 T 1.000** 680.639
22 Q 1.000** 680.639
23 Q 1.000** 680.639
24 L 1.000** 680.639
25 A 1.000** 680.639
26 D 1.000** 680.639
27 E 1.000** 680.639
28 V 1.000** 680.639
29 S 1.000** 680.639
30 R 1.000** 680.639
31 R 1.000** 680.639
32 D 1.000** 680.639
33 G 1.000** 680.639
34 S 1.000** 680.639
35 G 1.000** 680.639
36 L 1.000** 680.639
37 W 1.000** 680.639
38 L 1.000** 680.639
39 Y 1.000** 680.639
40 I 1.000** 680.639
41 T 1.000** 680.639
42 E 1.000** 680.639
43 L 1.000** 680.639
44 D 1.000** 680.639
45 T 1.000** 680.639
46 A 1.000** 680.639
47 A 1.000** 680.639
48 H 1.000** 680.639
49 A 1.000** 680.639
50 F 1.000** 680.639
51 G 1.000** 680.639
52 I 1.000** 680.639
53 G 1.000** 680.639
54 S 1.000** 680.639
55 Y 1.000** 680.639
56 Q 1.000** 680.639
57 W 1.000** 680.639
58 H 1.000** 680.639
59 D 1.000** 680.639
60 A 1.000** 680.639
61 A 1.000** 680.639
62 A 1.000** 680.639
63 H 1.000** 680.639
64 V 1.000** 680.639
65 N 1.000** 680.639
66 G 1.000** 680.639
67 L 1.000** 680.639
68 L 1.000** 680.639
69 T 1.000** 680.639
70 H 1.000** 680.639
71 L 1.000** 680.639
72 T 1.000** 680.639
73 E 1.000** 680.639
74 V 1.000** 680.639
75 L 1.000** 680.639
76 P 1.000** 680.639
77 R 1.000** 680.639
78 N 1.000** 680.639
79 A 1.000** 680.639
80 V 1.000** 680.639
81 L 1.000** 680.639
82 L 1.000** 680.639
83 V 1.000** 680.639
84 T 1.000** 680.639
85 A 1.000** 680.639
86 N 1.000** 680.639
87 H 1.000** 680.639
88 G 1.000** 680.639
89 V 1.000** 680.639
90 L 1.000** 680.639
91 N 1.000** 680.639
92 V 1.000** 680.639
93 P 1.000** 680.639
94 N 1.000** 680.639
95 D 1.000** 680.639
96 S 1.000** 680.639
97 S 1.000** 680.639
98 I 1.000** 680.639
99 D 1.000** 680.639
100 V 1.000** 680.639
101 N 1.000** 680.639
102 A 1.000** 680.639
103 D 1.000** 680.639
104 P 1.000** 680.639
105 T 1.000** 680.639
106 S 1.000** 680.639
107 A 1.000** 680.639
108 R 1.000** 680.639
109 R 1.000** 680.639
110 N 1.000** 680.639
111 T 1.000** 680.639
112 G 1.000** 680.639
113 G 1.000** 680.639
114 R 1.000** 680.639
115 R 1.000** 680.639
116 R 1.000** 680.639
117 A 1.000** 680.639
118 A 1.000** 680.639
119 N 1.000** 680.639
120 A 1.000** 680.639
121 L 1.000** 680.639
122 P 1.000** 680.639
123 T 1.000** 680.639
124 H 1.000** 680.639
125 S 1.000** 680.639
126 T 1.000** 680.639
127 P 1.000** 680.639
128 A 1.000** 680.639
129 P 1.000** 680.639
130 Q 1.000** 680.639
131 S 1.000** 680.639
132 T 1.000** 680.639
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908408_1_1664_MLBR_RS07895)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:17
Model 1: NearlyNeutral -528.204162 Model 2: PositiveSelection -528.204119 Model 0: one-ratio -528.204119 Model 7: beta -528.204216 Model 8: beta&w>1 -528.204118 Model 0 vs 1 8.600000001024455E-5 Model 2 vs 1 8.600000001024455E-5 Model 8 vs 7 1.9599999995989492E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
